Advanced search



 
 79.5% of the records
 
 20.5 % of the records
 
 57.8 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumablack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3cability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxishair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

673 results (please see below)  Sort:    
1

D.O. Podcast Increases Pre-Medical Student Knowledge and Attitudes Toward Osteopathic Medicine
Sullivan, V. E., D'Amelio, M. P., Storch, I. M., van Rooyen, D. R., Storch, N. C., Callaway, C. A., Pierce-Talsma, S. L., Hauler, J. J.
Journal of Osteopathic Medicine, 2025/12


3

Reclaiming the body: The mental health imperative of embodied learning in physiotherapy education
Cahyono, B. D., Rahmawati, A., Aditya, R. S., Huda, N., Aristawati, E., Amalia, R., Kartikasari, D.
International Journal of Osteopathic Medicine, 2025/12

4

Response to the letter to the editor: Reclaiming the body: The mental health imperative of embodied learning in physiotherapy education
Eccott, L., Moulson, A., Atkinson, K., Livatino, S., Lewis, J., Cairns, M.
International Journal of Osteopathic Medicine, 2025/12

5

A cross-sectional analysis of pathology exposure across COCA-accredited osteopathic medical schools: Gaps and opportunities in pathology undergraduate medical education
Preston, P., Herman, M., Berry, A., Robinson, M., Schukow, C. P., Kowalski, P.
Academic Pathology, 2025/07
Free full text

6

Efforts in Undergraduate Medical Education to Improve Socioeconomic Status Diversity
Velasquez, D. E., Shrestha, A., Matias, W. R.
Academic Medicine, 2025/05
Free full text

7

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text


9

Improving learning experience through implementing standardized team-based learning process in undergraduate medical education
Andrews-Dickert, R., Nagaraj, R., Zhan, L., Knittig, L., Zhao, Y.
BMC Medical Education, 2024/10
Free full text

10

On-site peer mentorship’s effect on personal and professional development, stress reduction, and ease of transition into the medical education system
Whitfield, S., Hazard, C., Haynes, B., Coffey, T., Lynch, L., Davis, S.
Journal of Osteopathic Medicine, 2024/08

11

The Tensegrity Curriculum: A Comprehensive Curricular Structure Supporting Cultural Humility in Undergraduate Medical Education
Jones, A. C., Bertsch, K. N., Williams, D., Channell, M. K.
Advances in Medical Education and Practice, 2024/05
Free full text

12

The impact of emergency medicine residents on clinical productivity
Pallaci, M., Jouriles, N., dos Santos, A., Miller, J., Gothard, M. D., Seaberg, D. C.
Journal of Osteopathic Medicine, 2024/04
Free full text

13

Where are the Black men in osteopathic medical schools?
Megafu, M. N.
Journal of Osteopathic Medicine, 2024/04
Free full text

14

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text

15

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text

16

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/12
Free full text

17

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text

18

Integrating A Student Co-Created Health Systems Science Curriculum Within UME
Ethridge, B., Steadman, M., Crews, B.
Southern Medical Journal, 2023/07

19

The first step to strengthening graduate level osteopathic education: a national review
Cain, R. A.
Journal of Osteopathic Medicine, 2023/06
Free full text

20

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/06
Free full text

21

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match. Letter
Bohler, F., Aggarwal, N. D.
The Journal of Urology, 2023/04
Free full text

22

Realistic Assessment of Research Publications by Neurosurgery Residency Applicants
Hasley, H. L., O'Malley, G. R., Jr., Bala, S., Weisman, H. E., Roth
World Neurosurgery, 2023/04

23

A Heart for Medicine: Palpitations In the Midst of Training
Coggins, J.
Osteopathic Family Physician, 2023/03

24

Interventional Radiology in Osteopathic Medical Education
Cyphers, E., Groskreutz, D., Grilli, C., Ahuja, R.
Journal of Vascular and Interventional Radiology, 2023/03

25

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text

26

Resident as Educator: The Preclinical Years
Olsen, J., Bernard, M., Middleton, T.
Osteopathic Family Physician, 2023/03

27

Evaluating the impact of a curriculum intervention using an assessment rubric for communication skill development of osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2023/03


29

Perceived Value of Osteopathic Recognition
Maier, R., Weaver, J., Ginoza, J. A., Meyer, D., Gothard, D.
Family Medicine, 2023/02
Free full text

30

Trends in the Sports Medicine Match: An Analysis of the National Resident Matching Program Data from 2010 to 2021
Zaremski, J. L., Waterbrook, A. L., Monseau, A. J., Kliethermes, S. A.
Current Sports Medicine Reports, 2023/01
Free full text


32

Is cadaveric dissection essential in medical education? A qualitative survey comparing pre-and post-COVID-19 anatomy courses
Kochhar, S., Tasnim, T., Gupta, A.
Journal of Osteopathic Medicine, 2023/01
Free full text


34

Influence of Preventive Medicine Residency Programs and Combined Master of Public Health Programs on Specialty Selection
Harding, M. C., Jung, P.
American Journal of Preventive Medicine, 2023/01
Free full text


36

Differences in scholarly productivity between allopathic, osteopathic and non-US international medical graduates matching into dermatology residency
Vaccarello, A., Zheng, D. X., Narang, J., Gallo Marin, B., Xu, J. R., Ouyang, K., Ahmad, A. S., Cwalina, T. B., Scott, J. F., Ho, R. S., Sharma, T. R.
Clinical and Experimental Dermatology, 2022/12
Free full text

37

The effect of the COVID-19 pandemic on osteopathic education in ACGME-OR residencies from February 2020 to February 2021
Bingham, S., Bray, N. N., Eddy, A. J.
Journal of Osteopathic Medicine, 2022/12
Free full text

38

Student performance in medical biochemistry and genetics: comparing campus-based versus zoom-based lecture delivery
Faner, M. A., Ritchie, R. P., Ruger, K. M., Waarala, K. L., Wilkins, C. A.
BMC Medical Education, 2022/11
Free full text

39

Promoting cultural competency and osteopathic medicine awareness among premedical students through a summer premedical rural enrichment program
Kadavakollu, S., Lund, K. S., Swamy, V., Kim, W. D., Llenado, R. A., Nunes, T. F., Qureshi, M., Graneto, J. W., Boyanovsky, B. B.
Journal of Osteopathic Medicine, 2022/11
Free full text

40

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/11
Free full text

41

Osteopathic Medical Students’ Subjective Preparedness for LGBTQ+ Patient Care and Influencing Factors: A Multi-Institutional Survey Study
Morimoto, K., Uy, J. C., Blair, L., Barab, H., Wu, W., Oosterbaan, C., Ozdowski, L., Guenther, E.
The AAO Journal, 2022/09
Free full text

42

Osteopathic Medical Students’ Preferred Method of Participation in Online Lectures and Learning Activities
Morimoto, K., Nelson, C., Ozdowski, L., Galka, M., Calkins, A., Le, B.
The AAO Journal, 2022/09
Free full text

43

Comparing In-person vs. Live-streamed Osteopathic Manual Medicine Lab Instruction
Ellis, M., Finneran, K., Jie, C., Lewis, D.
The AAO Journal, 2022/09
Free full text

44

The Predictive Value of the Residency AOBFP In-Service Exam, Produced and Administered by ACOFP
Torres, J. W., Bowling, J. R., Zipp, C., Williams, N., Sandella, J. M., Martinez, L., Moore, B.
Family Medicine, 2022/09
Free full text

45

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text

46

Addressing disparities in medicine through medical curriculum change: a student perspective
Kureshi, A., Landman, S., Ahmed, M., Savinova, O. V., Becker, D.
Journal of Osteopathic Medicine, 2022/07
Free full text


48

Medical student research opportunities: a survey of osteopathic medical schools in the United States
Hamby, T., Wilson, D. P., Bui, P., Lowery, J., Basha, R.
Journal of Osteopathic Medicine, 2022/06
Free full text

49

To the Editor: Limitations and Alternative Solutions to a USMLE COMLEX-USA Concordance
Jurich, D., Liu, C., Clauser, A.
Journal of Graduate Medical Education, 2022/06
Free full text

50

To the Editor: Response to: Limitations and Alternative Approaches to a USMLE COMLEX-USA Concordance
Sandella, J., Boulet, J., Barnum, S., Tsai, T. H., Wang, Y.
Journal of Graduate Medical Education, 2022/06
Free full text


52

Trauma-Informed Care Program Implementation for Osteopathic Medical Students
Boudreau, R., Hathaway, A.M., Harp, T., Chong, H., Modirian, F., Boghean, K., Bouquet, J.
The AAO Journal, 2022/06
Free full text

53


54

Cross-Sectional Study of Osteopathic General Surgeons in University-Based General Surgery Departments
Khan, M. T., Patnaik, R., Wheeler, C., Ibrahim, M., Wolf, H., Baumgardner, K. C., Lovely, R. S.
Cureus, 2022/05
Free full text

55

Osteopathic student training on preventing domestic violence
Downing-Larick, C., Moore, M., Dreher, M., Stoner, A., Fadel, N., Cheng, N.
Osteopathic Family Physician, 2022/05
Free full text

56

Analysis of Social Mission Commitment at Dental, Medical, and Nursing Schools in the US
Batra, S., Orban, J., Zhang, H., Guterbock, T. M., Butler, L. A., Bogucki, C., Chen, C.
JAMA Network Open, 2022/05
Free full text

57

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text

58

Parental leave in medical school: supporting students as parents
Ortega, S. R., Barnes, J. M., Waller, J. D.
Journal of Osteopathic Medicine, 2022/05
Free full text

59

Assessing the United States' most frequently asked questions about osteopathic medicine, osteopathic education, and osteopathic manipulative treatment
Sajjadi, N. B., Ottwell, R., Shepard, S., Bray, N., Dyer, R., Wilson, J., Vassar, M., Hartwell, M.
Journal of Osteopathic Medicine, 2022/05
Free full text

60

Attracting Medical Students to Family Medicine: An Historical View
Young, R. A., Tinger, S.
Family Medicine, 2022/04
Free full text

61

An analysis of publication trends of orthopedic surgery residency graduates in relation to academic achievement
Carr, M., Anderson, J. M., Shepard, S., Hobbs, J., Walters, C., Johnson, A. L., Vassar, M.
Journal of Osteopathic Medicine, 2022/04
Free full text

62

Professional Impact of the DMU Predoctoral OMM Fellowship
Berenbeim, G., Ellis, M., Finneran, K., Metzler, I., Lewis, D., Jie, C.
The AAO Journal, 2022/03
Free full text

63

Student Perception of an OMM Virtual Practical Examination: In the Setting of Social Distancing
Berenbeim, G., Metzler, I., Lewis, D., Jie, C.
The AAO Journal, 2022/03
Free full text

64



66

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text

67

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02

68

The effectiveness of the metabolic map in promoting meaningful learning
Gromley, Z., Agwuncha, C., Nahar, V. K., Gromley, A.
Journal of Osteopathic Medicine, 2022/01
Free full text

69

Predictors of academic career placement and scholarly impact in fellowship-trained rhinologists
Vohra, V., Watley, D. C., Yan, C. H., Locke, T. B., Bernstein, I. A., Levy, J. M., Rowan, N. R.
International Forum of Allergy and Rhinology, 2022/01
Free full text

70

An analysis of anatomy education before and during Covid-19: August-December 2020
Attardi, S. M., Harmon, D. J., Barremkala, M., Bentley, D. C., Brown, K. M., Dennis, J. F., Goldman, H. M., Harrell, K. M., Klein, B. A., Ramnanan, C. J., Farkas, G. J.
Anatomical Sciences Education, 2022/01
Free full text

71

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05

72

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12

73

Adaptation and validation of the SEGUE checklist to assess osteopathy students' clinical communication skills
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2021/12


75

MD and DO: Differing Medical Degrees and the Associated Perceptions
Harfouch, N., Grunhut, J., Hsu, A., Pinsky, S., Chacko, J., Raden, M., Slanetz, P. J., Sarkany, D.
Current Problems in Diagnostic Radiology, 2021/11

76

Comprehensive Reform and Greater Equity in Applying to Residency-Trainees' Mixed Responses to a Pass/Fail USMLE Step 1
Ganesh Kumar, N., Pontell, M. E., Makhoul, A. T., Drolet, B. C.
Journal of Graduate Medical Education, 2021/10
Free full text

77

The pandemic silver lining: preparing osteopathic learners to address healthcare needs using telehealth
Taylor, J., Wright, A., Summers, M.
Journal of Osteopathic Medicine, 2021/10
Free full text

78

Exploring Race and Ethnicity Representational Inequities in Illinois Medical Schools
Francone, N. O., Simon, M. A., Ortega, P.
Health Equity, 2021/09
Free full text

79

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09

80

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09



83

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text



86

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text

87

Diversity and Inclusion on General Surgery, Integrated Thoracic Surgery, and Integrated Vascular Surgery Residency Program Websites
Mortman, R., Frazier, H. A., Haywood, Y. C.
Journal of Graduate Medical Education, 2021/06
Free full text

88

Effect of a required online graded curriculum in the clerkship years on medical student national standardized examination performance
Glaser, K., Pazdernik, V., Sackett, D., Sheridan, V.
Journal of Osteopathic Medicine, 2021/06
Free full text

89

Effect of a standardized patient encounter on first year medical student confidence and satisfaction with telemedicine
Unrue, E. L., White, G., Cheng, N., Lindsey, T.
Journal of Osteopathic Medicine, 2021/06
Free full text


91

Scholar 12: Beta Trial of an Osteopathic Research Cultural Development Computer Application
Rowane, M.J., Hellmann, D. E., Branning, R. A., Cola, H. M., Fahoum, J. M., Snyder, B. M., Healy, A. M., Qi-Lytle, X., Rowane, M. P., Terrell, M. A., Hostoffer, R. W.
The AAO Journal, 2021/06
Free full text

92

Examining concurrent validity between COMLEX-USA Level 2-Cognitive Evaluation and COMLEX-USA Level 2-Performance Evaluation
Craig, B., Wang, X., Sandella, J., Tsai, T. H., Kuo, D., Finch, C.
Journal of Osteopathic Medicine, 2021/05
Free full text

93

Osteopathic Medicine: What Radiologists Need to Know
Gunderman, L. D., Gunderman, R. B.
Academic Radiology, 2021/05

94

Meaningful use of COMSAE Phase 1 in preparation for COMLEX-USA Level 1
Wang, X., Maeda, H., Craig, B., Tsai, T. H., Sandella, J. M., Fleury, M.
Journal of Osteopathic Medicine, 2021/04
Free full text

95

Using contact-based education to destigmatize opioid use disorder among medical students
Mort, S. C., Díaz, S. R., Beverly, E. A.
Teaching and Learning in Medicine, 2021/04

96

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04

97

The use of 3D printing for osteopathic medical education of rib disorders
Moriles, K., Ramnot, A., Lai, M., Jacobs, R. J., Qureshi, Y.
Journal of Osteopathic Medicine, 2021/03
Free full text

98

Predictors of research self efficacy in first-year osteopathic medical students
Jacobs, R. J., Kane, M. N.
International Journal of Osteopathic Medicine, 2021/03

99

Radiation oncology education and experience in the undergraduate medical setting
Odiase, O. M., Huang, D., Sura, K. T.
Medical Education Online, 2021/03
Free full text

100

Assessing Vaping Views, Usage, and Vaping-Related Education Among Medical Students: A Pilot Study
Ruppel, T., Alexander, B., Mayrovitz, H. N.
Cureus, 2021/02
Free full text

101

The flipped classroom: a novel approach to physical examination skills for osteopathic medical students
Bhai, S. A., Poustinchian, B.
Journal of Osteopathic Medicine, 2021/02
Free full text

102

Evaluating disease outbreaks with syndromic surveillance using medical student clinical rotation patient encounter logs
Bruzda, G., Rawlins, F., Sumpter, C., Garner, H. R.
Journal of Osteopathic Medicine, 2021/02
Free full text

103

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text

104

Predictors of emotional wellbeing in osteopathic medical students in a COVID-19 world
Jacobs, R., Lanspa, M., Kane, M., Caballero, J.
Journal of Osteopathic Medicine, 2021/02
Free full text

105

Transforming a clerkship with telemedicine
Bhatia, R. K., Cooley, D., Collins, P. B., Caudle, J., Coren, J.
Journal of Osteopathic Medicine, 2021/01
Free full text

106

Comparison of State Medical Licensing Board Disclosures Regarding Resident Performance for United States Allopathic, Osteopathic, and Foreign Medical Graduates
Gajewski, M., Hillen, M., Matassa, D., Kunac, A., Anana, M., Pompeo, L., Kothari, N., Murano, T.
The Journal of the American Osteopathic Association, 2020/12
Free full text

107

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text

108

Communication Skills of Grandview/Southview Medical Center General Surgery Residents
Johnson, W., Ngo, A., Elrod, M.
The Journal of the American Osteopathic Association, 2020/10
Free full text

109

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

110

Life vs Loans: Does Debt Affect Career Satisfaction in Osteopathic Graduates?
Richards, J., Scheckel, C. J., Anderson, A., Newman, J. R., Poole, K. G.
The Journal of the American Osteopathic Association, 2020/08
Free full text

111

48-Hour Hospice Home Immersion Encourages Osteopathic Medical Students to Broaden Their Views on Dying and Death
Gugliucci, M. R., Padmanabhan, D. L., Silberstein, E. B.
The Journal of the American Osteopathic Association, 2020/08
Free full text

112

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

113

Effect of Opioid Prescribing Education for Obstetrics and Gynecology Residents in a Safety-Net Hospital
Evans, C., McCullough, D., Best, K., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/07
Free full text

114

How Trainees Finance Their Medical Education: Implications of Higher Education Act Reform
Scheckel, C. J., Richards, J. R., Newman, J. R., Fangman, B. D., Poole, K. G.
The Journal of the American Osteopathic Association, 2020/06
Free full text

115

Does Empathy Decline in the Clinical Phase of Medical Education? A Nationwide, Multi-Institutional, Cross-Sectional Study of Students at DO-Granting Medical Schools
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
Academic Medicine, 2020/06
Free full text

116

Osteopathie auf dem Prüfstand
[Osteopathy under scrutiny]
Dräger, K., Heller, R.
Bundesgesundheitsblatt Gesundheitsforschung Gesundheitsschutz, 2020/05

117

Transitions in Undergraduate Medical Education
Baker, J., Wright, A.
The Journal of the American Osteopathic Association, 2020/05

118

Helping Students Navigate the Single Graduate Medical Education Accreditation System
Díaz, S. R., Baker, S. D., Medio, F. J.
The Journal of the American Osteopathic Association, 2020/04
Free full text

119

Academic Advising Using Theoretical Approaches for Medical Students Who Are Struggling in Preclinical Years
Tewary, S., Jordan, J. A., Rana, A. M., Mayi, B.
The Journal of the American Osteopathic Association, 2020/04
Free full text

120


121

Success Predictors For Third-Year Osteopathic Medical Students on National Standardized Examinations: A Family Medicine Clerkship Course Study
Glaser, K., Sackett, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2020/03
Free full text



124

Implementing a clinical-educator curriculum to enrich internal medicine residents' teaching capacity
Habboush, Y., Stoner, A., Torres, C., Beidas, S.
BMC Medical Education, 2019/12
Free full text

125

Medical Students' Knowledge About Children With Disabilities, Special Education Laws, and Social Services: A Preliminary Scale Development and Pilot Study
Vitalone-Raccaro, N., Sheppard, M. E., Kaari, J. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text

126

Engaging with evidence-based practice in the osteopathy clinical learning environment: A mixed methods pilot study
Vaughan, B., Grace, S., Gray, B., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2019/09

127

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text

128

Enhancing Culturally Sensitive Curriculum in an Osteopathic Medical School
Lopez-Hernandez, G. Y.
Missouri Medicine, 2019/09
Free full text

129

Expanding options: Supporting skills transfer from a post-graduate osteopathy program to clinical practice
Macfarlane, C., Cornall, D.
International Journal of Osteopathic Medicine, 2019/09

130

Introduction to Clerkship: Bridging the Gap Between Preclinical and Clinical Medical Education
Butts, C. A., Speer, J. J., Brady, J. J., Stephenson, R. J., Langenau, E., DiTomasso, R., Fresa, K., Becker, M., Sesso, A.
The Journal of the American Osteopathic Association, 2019/09

131

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

132

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text

133

Survey of Osteopathic Medical Students Regarding Physician Shadowing Experiences Before and During Medical School Training
Langenau, E., Frank, S. B., Calardo, S. J., Roberts, M. B.
Journal of Medical Education and Curricular Development, 2019/05
Free full text

134

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text

135

Allopathic supervision of osteopathic education: What support is needed?
James, S. J., Zakletskaia, L:
Osteopathic Family Physician, 2019/04

136

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text


138

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text

139

Nelson-Denny Reading Test Scores as a Predictor of Student Success in Osteopathic Medical Education
Linsenmeyer, M., Ridpath, L.
The Journal of the American Osteopathic Association, 2019/02
Free full text

140

Medical Degree Disparity Among Authors in Obstetrics and Gynecology Journals
Merritt, B., Simunich, T., Ashurst, J.
The Journal of the American Osteopathic Association, 2019/02
Free full text

141

First-Year Experience Implementing an Adaptive Learning Platform for First- and Second-Year Medical Students at the Lake Erie College of Osteopathic Medicine
Hudder, A., Tackett, S., Moscatello, K.
The Journal of the American Osteopathic Association, 2019/01
Free full text

142

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text

143

Exodus From the Classroom: Student Perceptions, Lecture Capture Technology, and the Inception of On-Demand Preclinical Medical Education
Ikonne, U., Campbell, A. M., Whelihan, K. E., Bay, R. C., Lewis, J. H.
The Journal of the American Osteopathic Association, 2018/12

144

An overview of osteopathy graduates' perceived preparedness at transition from educational environment to clinic environment one year after graduation: a cross sectional study
Luciani, E., Consorti, G., van Dun, P. L. S., Merdy, O., Lunghi, C., Petracca, M., Esteves, J. E., Cerritelli, F.
BMC Medical Education, 2018/12
Free full text


146

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

147

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text

148

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text

149

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text

150

Association Between Performance on COMLEX-USA and the American College of Osteopathic Family Physicians In-Service Examination
Hudson, K. M., Feinberg, G., Hempstead, L., Zipp, C., Gimpel, J. R., Wang, Y.
Journal of Graduate Medical Education, 2018/10
Free full text

151

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text

152

Empathy and Osteopathic Manipulative Medicine: Is It All in the Hands?
Rizkalla, M. N., Henderson, K. K.
The Journal of the American Osteopathic Association, 2018/09
Free full text

153

Anatomie am Lebenden
(Anatomy on the living object)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09

154

Learning through multiple lenses: analysis of self, peer, near-peer and faculty assessment of a clinical history taking task in Australia
Fitzgerald, K., Vaughan, B.
Journal of Educational Evaluation for Health Professions, 2018/09
Free full text

155

Diabetes Fellowship in Primary Care: A Survey of Graduates
Healy, A. M., Tanenberg, R. J., Schwartz, F. L., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2018/08
Free full text

156

Evaluating the effectiveness of teaching osteopathy in a combined didactics setting
Eilerman, A., Keller, M. E., Hixson, D., II, Gupta
Osteopathic Family Physician, 2018/08

157

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text

158

Quantitative Description of Osteopathic Physician Authorship in Prominent Neurosurgery Journals Since 1944: Coming of Age?
Cuoco, J. A., Busch, C. M., Rogers, C. M., Guilliams, E. L., Klein, B. J., Howes, G. A., Marvin, E. A.
Cureus, 2018/08
Free full text

159

Oral Health Training in Osteopathic Medical Schools: Results of a National Survey
Simon, L., Silk, H., Savageau, J., Sullivan, K., Riedy, C.
The Journal of the American Osteopathic Association, 2018/07
Free full text

160

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07

161

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text

162

Musculoskeletal Education in Medical Schools: A Survey of Allopathic and Osteopathic Medical Students
Sabesan, V. J., Schrotenboer, A., Habeck, J., Lombardo, D., Stine, S., Jildeh, T. R., Meiyappan, A.
Journal of the American Academy of Orthopaedic Surgeons. Global research & reviews, 2018/06
Free full text

163

Reducing Health Disparities: Understanding the Unintended Effects of Health Care Professional and Patient Characteristics on Treatment
Nazione, S., Nazione, A.
The Journal of the American Osteopathic Association, 2018/06
Free full text


165

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text

166

Increasing Self-Awareness of Medical Students Through the Use of Ultrasonography
Sandefur, K., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text

167

Tool for Predicting Medical Student Burnout From Sustained Stress Levels: Factor Analysis of the Medical Education Hassles Scale-R
Johnson, J. C., Degenhardt, B. F., Smith, C. K., Wolf, T. M., Peterson, D. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text

168

A Mokken scale analysis of the peer physical examination questionnaire
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2018/03
Free full text

169

Physician-Mentored Patient Rounds to Observe and Assess Entrustable Professional Activities 1 and 2 in Preclinical Medical Students
Chamberlain, N. R., Sexton, P. S., Hardee, M. R., Baer, R. W.
The Journal of the American Osteopathic Association, 2018/03
Free full text

170

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text

171

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

172

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text

173

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text

174

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text

175

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text

176

Effect of Ultrasonography on Student Learning of Shoulder Anatomy and Landmarks
de Vries, K. D., Brown, R., Mazzie, J., Jung, M. K., Yao, S. C., Terzella, M. J.
The Journal of the American Osteopathic Association, 2018/01
Free full text

177

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text

178

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text

179

Gross Anatomy Education Today: The Integration of Traditional and Innovative Methodologies
Houser, J. J., Kondrashov, P.
Missouri Medicine, 2018/01
Free full text


181

Medical Student Decision-Making: Standard Surgical Excision or Mohs Micrographic Surgery to Manage Basal Cell Carcinoma
Mancuso, C., Morris, J. B., Hernandez, N., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2018/01
Free full text

182

Osteopathic Medical Education: Answering the Call
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text

183

Predictors of Osteopathic Medical Students' Readiness to Use Health Information Technology
Jacobs, R. J., Iqbal, H., Rana, A. M., Rana, Z., Kane, M. N.
The Journal of the American Osteopathic Association, 2017/12
Free full text

184

Simulated learning activities as part replacement of clinical placements in osteopathy: A case study
Fitzgerald, K., Denning, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2017/12

185

Influence of perceived difficulty of cases on student osteopaths' diagnostic reasoning: a cross sectional study
Noyer, A. L., Esteves, J. E., Thomson, O. P.
Chiropractic & Manual Therapies, 2017/12
Free full text

186

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text

187

Defining Osteopathic Continuing Medical Education
Loveless, B.
The Journal of the American Osteopathic Association, 2017/12
Free full text

188

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text

189

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text


191

Entry of Medical School Graduates Into Family Medicine Residencies: 2016-2017
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text

192

Results of the 2017 National Resident Matching Program(R) and the American Osteopathic Association Intern/Resident Registration Program
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text

193

Assessment of Nutrition Knowledge and Attitudes in Preclinical Osteopathic Medical Students
Hargrove, E. J., Berryman, D. E., Yoder, J. M., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/10
Free full text

194

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

195

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text

196

An observational study of ultrasound to confirm cervical spine segmental positional rotation
Flaum, T. B., Rusnack, F. M., Mirza, A., Apoznanski, T. E., Munarova, A., Mazzie, J. P., Terzella, M.l J., Yao, S. C.
International Journal of Osteopathic Medicine, 2017/09/01/

197

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09

198

Self-efficacy of Osteopathic Medical Students in a Rural-Urban Underserved Pathway Program
Casapulla, S. L.
The Journal of the American Osteopathic Association, 2017/09
Free full text

199

Clinical Preceptors' Perceptions of Empathy: The Empathy in Osteopathic Training and Education (EMOTE) Study
Davis, G. E., Hartwig, W. C., McTighe, A. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

200

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

201

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text

202

Fundamentals for an Osteopathic Obesity Designed Study: The Effects of Education on Osteopathic Medical Students' Attitudes Regarding Obesity
Gayer, G. G., Weiss, J., Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

203

In Reply to Buser and to Shannon
Cummings, M.
Academic Medicine, 2017/08
Free full text

204

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text

205

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text


207

Assessment of Research Interests of First-Year Osteopathic Medical Students
Carter, L., McClellan, N., McFaul, D., Massey, B., Guenther, E., Kisby, G.
The Journal of the American Osteopathic Association, 2017/07
Free full text

208

Osteopathic medical students entering family medicine and attitudes regarding osteopathic manipulative treatment: Preliminary findings of differences by sex
Baker, H. H., Linsenmeyer, M., Ridpath, L. C., Bauer, L. J., Foster, R. W.
The Journal of the American Osteopathic Association, 2017/06
Free full text

209

Factors influencing osteopathic medical students' intent to work with underserved populations: Implications for curriculum enhancement
Jacobs, R. J., Kane, M. N., Wallace, E. M., Rana, A.f M., Iqbal, H., Rana, Z.
International Journal of Osteopathic Medicine, 2017/06

210

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text

211

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text

212

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text

213

A descriptive, cross-sectional study of medical student preferences for vodcast design, format and pedagogical approach
Pettit, R. K., Kinney, M., McCoy, L.
BMC Medical Education, 2017/05
Free full text

214

Response to “Contribution of Osteopathic Training to the Primary Care Workforce“
Kozakowski, S. M., Travis, A., Bentley, A., Fetter, G.
Family Medicine, 2017/04
Free full text

215

Contribution of Osteopathic Training to the Primary Care Workforce
Malouin, R. A., Keenum, A.
Family Medicine, 2017/04
Free full text

216

Evidence-Based Redesign of the COMLEX-USA Series
Gimpel, J. R., Horber, D., Sandella, J. M., Knebl, J. A., Thornburg, J. E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

217

Residency Program Directors' Interview Methods and Satisfaction With Resident Selection Across Multiple Specialties
VanOrder, T., Robbins, W., Zemper, E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

218

Attitudes of Family Medicine Program Directors Toward Osteopathic Residents Under the Single Accreditation System
Hempstead, L. K., Shaffer, T. D., Williams, K. B., Arnold, L. C.
The Journal of the American Osteopathic Association, 2017/04
Free full text

219

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

220

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

221

Can the Humanities Humanize Health Care?
Baltonado, J., Cymet, T.
The Journal of the American Osteopathic Association, 2017/04
Free full text

222

Changes in Osteopathic Medical Education: The Journey Continues
McClain, E. K.
The Journal of the American Osteopathic Association, 2017/04
Free full text

223

Opening the Doors of Medicine to Women
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/03
Free full text

224

A Qualitative, Interview-Based Study of the Health Policy Fellowship's Osteopathic Identity
Skinner, D., Franz, B.
The Journal of the American Osteopathic Association, 2017/03
Free full text

225

Enhancing clinical education in the private practice setting: A case study in osteopathy
Moore, K., Field, B. J.
International Journal of Osteopathic Medicine, 2017/03


227

Innovation in graduate medical education – using a competency based medical education curriculum
Riley, B. A., Riley, G.
International Journal of Osteopathic Medicine, 2017/03

228

The role of ultrasound and preparation in first-year medical students' learning lumbar spine anatomy and diagnostic skills
Chan, V., Curtis, S., Flaum, T., Terzella, M., Yao, S. C., Cheriyan, G.
International Journal of Osteopathic Medicine, 2017/03

229

Osteopathic Medical Student Practice of Osteopathic Manipulative Treatment During School Break
Pierce-Talsma, S., Hiserote, R. M., Lund, G.
The Journal of the American Osteopathic Association, 2017/03
Free full text

230

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text

231

Correlation Between United States Medical Licensing Examination and Comprehensive Osteopathic Medical Licensing Examination Scores for Applicants to a Dually Approved Emergency Medicine Residency
Kane, K. E., Yenser, D., Weaver, K. R., Barr, G. C. Jr., Goyke, T. E., Quinn, S. M., Worrilow, C. C., Burckhart, A. J., Leonetti, A. L., Yoshioka, I. E., Dusza, S. W., Kane, B. G.
The Journal of Emergency Medicine, 2017/02

232

Osteopathic Philosophy and Manipulation Enhancement Program: Influence on Osteopathic Medical Students' Interest in Osteopathic Manipulative Medicine
Volokitin, M., Ganapathiraju, P. V.
The Journal of the American Osteopathic Association, 2017/01
Free full text

233

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text

234

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text

235

Examining Health Care Students' Attitudes toward E-Professionalism
Gettig, J. P., Noronha, S., Graneto, J., Obucina, L., Christensen, K. J., Fjortoft, N. F.
American Journal of Pharmaceutical Education, 2016/12
Free full text

236

A Survey of Disaster Medical Education in Osteopathic Medical School Curricula
Parrillo, S. J., Christensen, D., Teitelbaum, H. S., Glassman, E. S.
Prehospital and Disaster Medicine, 2016/12
Free full text


238

Does replacing live demonstration with instructional videos improve student satisfaction and osteopathic manipulative treatment examination performance?
Seals, R., Gustowski, S. M., Kominski, C., Li, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text

239

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text

240

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text

241

Correlation Between Standardize Patients' Perceptions of Osteopathic Medical Students and Students' Self-Rated Empathy
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text

242

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text

243

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text

244

Quantitative Description of Medical Student Interest in Neurology and Psychiatry
Ramos, R. L., Cuoco, J. A., Guercio, E., Levitan, T.
The Journal of the American Osteopathic Association, 2016/07
Free full text

245

The Use of COMLEX-USA and USMLE for Residency Applicant Selection
Sandella, J. M., Gimpel, J. R., Smith, L. L., Boulet, J. R.
Journal of Graduate Medical Education, 2016/07
Free full text

246

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text

247

Perception of peer physical examination in two Australian osteopathy programs
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2016/07
Free full text


249

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text

250

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text

251

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

252

Program Characteristics Influencing Allopathic Students' Residency Selection
Stillman, M. D., Miller, K. H., Ziegler, C. H., Upadhyay, A., Mitchell, C. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

253

Effect of a Mandatory Third-Year Osteopathic Manipulative Treatment Course on Student Attitudes
Heineman, K. L., Lewis, D. D., Finnerty, E. P., Crout, S. V., Canby, C.
The Journal of the American Osteopathic Association, 2016/04
Free full text

254

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text

255

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

256

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

257

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text

258

Factors Modifying Burnout in Osteopathic Medical Students
Lapinski, J., Yost, M., Sexton, P., LaBaere, R. J.
Academic Psychiatry, 2016/02



261

Burnout Among Osteopathic Residents: A Cross-sectional Analysis
Chan, A. M., Cuevas, S. T., Jenkins, J.
The Journal of the American Osteopathic Association, 2016/02
Free full text


263

Evaluating medical student engagement during virtual patient simulations: a sequential, mixed methods study
McCoy, L., Pettit, R. K., Lewis, J. H., Allgood, J. A., Bay, C., Schwartz, F. N.
BMC Medical Education, 2016/01
Free full text

264

Gamification and Multimedia for Medical Education: A Landscape Review
McCoy, L., Lewis, J. H., Dalton, D.
The Journal of the American Osteopathic Association, 2016/01
Free full text

265

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text

266

GME Graduate Retention Rates: A Single Institution Study
Frieswyk, T. J.
Unpublished PhD thesis, 2015/12
Free full text




270

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text

271

Incorporating Osteopathic Curriculum Into a Family Medicine Residency
Hempstead, L. K., Harper, D. M.
Family Medicine, 2015/11


273

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11

274

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text

275

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text

276

Feasibility of Using Ultrasonography to Establish Relationships Among Sacral Base Position, Sacral Sulcus Depth, Body Mass Index, and Sex
Lockwood, M. D., Kondrashova, T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/11
Free full text

277

Perceived teaching quality between near-peer and academic tutors in an osteopathic practical skills class
Vaughan, B., Macfarlane, C.
International Journal of Osteopathic Medicine, 2015/09



280

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09

281

Approaching the Single Accreditation System: Curricular Variation in Allopathic, Osteopathic, and Dually Accredited Family Medicine Residency Programs
Mims, L. D., Wannamaker, L. R., Bressler, L. C.
Journal of Graduate Medical Education, 2015/09
Free full text


283

Effect of Table Trainer-to-Student Ratios on Outcome in Student Assessments of Cervical Muscle Energy Techniques
Snider, K. T., Dowling, D. J., Seffinger, M. A., Channell, M. K., Yao, S. C., Gustowski, S. M., Johnson, J. C., Pryor, M. J.
The Journal of the American Osteopathic Association, 2015/09
Free full text

284

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text



287

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text

288

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

289

Learning Environment, Preparedness and Satisfaction in Osteopathy in Europe: The PreSS Study
Luciani, E., van Dun, P. L., Esteves, J. E., Lunghi, C., Petracca, M., Papa, L., Merdy, O., Jakel, A., Cerritelli, F.
PLoS One, 2015/06
Free full text

290

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text

291

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05

292

Student perceptions of gamified audience response system interactions in large group lectures and via lecture capture technology
Pettit, R. K., McCoy, L., Kinney, M., Schwartz, F. N.
BMC Medical Education, 2015/05
Free full text

293

Transitions in osteopathic medical education
Cymet, T. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

294

Challenges of teaching live and distance audiences simultaneously
Davis, S. S., Hurtubise, L.
The Journal of the American Osteopathic Association, 2015/04
Free full text

295

Comparison of COMLEX-USA scores, medical school performance, and preadmission variables between women and men
Dixon, D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

296

Relationship between residency placement and clerkship site enrollment: a retrospective analysis
Elliott, S. P., Goldstein, L. B., Meinberg, D., Jeger, A. M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

297

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text

298

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text

299

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text


301

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text

302

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

303

A systematic review of service-learning in medical education: 1998-2012
Stewart, T., Wubbena, Z. C.
Teaching and Learning in Medicine, 2015/04

304


305

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text

306

Osteopathic postdoctoral training institutions' 2014 annual report
Biszewski, M., Ball, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

307

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

308

In reply to brock and scott
Kauffman, M.
Academic Medicine, 2015/03
Free full text

309

Adapting and feasibility testing pre-registration e-learning resources for Professionalism in Osteopathy in the UK
Browne, F., Rolfe, K., Currie, A., Walker, T., Roff, S.
International Journal of Osteopathic Medicine, 2015/03

310

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03



313

“Making Strange”: A role for the humanities in medical education
Vincent, F.
International Journal of Osteopathic Medicine, 2014/12


315

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text

316

Osteopathic emergency medicine programs infrequently publish in high-impact emergency medicine journals
Baskin, S. M., Lin, C., Carlson, J. N.
Western Journal of Emergency Medicine, 2014/11
Free full text

317

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

318

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text

319

Multitasking behaviors of osteopathic medical students
Shah, A. V., Mullens, D. J., Van Duyn, L. J., Januchowski, R. P.
The Journal of the American Osteopathic Association, 2014/08
Free full text

320

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text

321

Burnout among osteopathic otolaryngology residents: identification during formative training years
Yost, M. G., Johnson, J. C., Johns, M. M., Burchett, K. D.
The Journal of the American Osteopathic Association, 2014/08
Free full text

322

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text

323

Impact of the single accreditation agreement on GME governance and the physician workforce
Kelley, C. S.
The Journal of the American Osteopathic Association, 2014/07
Free full text

324

Perception-based effects of clinical exposure to osteopathic manipulative treatment on first- and second-year osteopathic medical students
Vazzana, K. M., Yao, S. C., Jung, M. K., Terzella, M. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text

325

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text

326

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06

327

Assessing palpation thresholds of osteopathic medical students using static models of the lumbar spine
Snider, E. J., Pamperin, K., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/06
Free full text



330

Osteopathic graduate medical education: new research standards needed
Shulman, H. M., Cooper, K., Devine, W., Trzeciak, M., Burney, U., Chan, W. P., Gomez, A., Humpherys, J., Safavi, H., Yoshida, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

331

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

332

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text

333

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text

334

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text

335

The use of technology and perceptions of its effectiveness in training physicians
Mason, P. B., Turgeon, B. M., Cossman, J. S., Lay, D. M.
Medical Teacher, 2014/04

336

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text

337

Reevaluating osteopathic medical education for the 21st century and beyond
Shannon, S. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text

338

Unified graduate medical education accreditation: a better plow
Bulger, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text

339

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text

340

Technical requirements to become an osteopathic physician
Sandhouse, M. E.
International Journal of Osteopathic Medicine, 2014/03/01/

341

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text

342

Usefulness of Video Learning for Osteopathic Manipulative Medicine Techniques in the Classroom and Clinical Setting
Meghpara, M., Yao, S. C., Flaum, T. B., Caron, E., Terzella, M. J.
The AAO Journal, 2014/03
Free full text

343

Osteopathic student satisfaction and preparedness to practice: A comparative study
Luciani, E., Cerritelli, F., Waters, M., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/03


345

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03

346

Factors important to applicants to osteopathic versus allopathic emergency medicine residency programs
St Amour, B. A.
Western Journal of Emergency Medicine, 2014/03
Free full text

347

Assessing criticality in student research reports: Preliminary results from a new educational card sorting activity
Abbey, H., Esteves, J. E., Vogel, S., Tyreman, S. J.
International Journal of Osteopathic Medicine, 2014/03


349

Evidence of declining empathy in third year osteopathic medical students
Caruso, H. M., Bernstein, B.
International Journal of Osteopathic Medicine, 2014/03

350

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text





355

Prevention curricula assessment of osteopathic medical schools in the United States
Dombrowski, H. T., Vincent, O. D., Wiley, C. L.
International Journal of Osteopathic Medicine, 2013/12

356

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12

357

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12

358

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text


360

Osteopathic graduate medical education: a way forward
Terry, R.
The Journal of the American Osteopathic Association, 2013/12
Free full text


362

Tobacco dependence curricula in US osteopathic medical schools: a follow-up study
Griffith, B. N., Montalto, N. J., Ridpath, L., Sullivan, K.
The Journal of the American Osteopathic Association, 2013/11
Free full text

363

Usefulness of Video Learning for Osteopathic Manipulative Medicine (OMM) Techniques in the Educational and Clinical Setting
Meghpara, M. K., Terzella, M. J., Flaum, T. B., Jung, M.K., Yao, S. C.
The AAO Journal, 2013/09
Free full text

364

One of ours
Burhop, J.
The Journal of the American Osteopathic Association, 2013/08
Free full text

365

Osteopathic Training for MDs
Fredericks, T. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text

366

Distance learning and osteopathic manipulative medicine
Blumer, J. U.
The AAO Journal, 2013/06
Free full text

367

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

368

Osteopathic postdoctoral training institutions and academic sponsorship
Biszewski, M.
The Journal of the American Osteopathic Association, 2013/04
Free full text

369

Osteopathic graduate medical education 2013
DeRosier, A., Lischka, T. A., Martinez, B.
The Journal of the American Osteopathic Association, 2013/04
Free full text

370

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

371

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

372

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

373


374

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text


376

Methods of assessment used by osteopathic educational institutions
Vaughan, B., Sullivan, V., Gosling, C., McLaughlin, P., Fryer, G., Wolff, M., Gabb, R.
International Journal of Osteopathic Medicine, 2012/12

377

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text

378

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text

379

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text

380

Osteopathic education: Editorial call for papers
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2012/09

381

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text

382

Assessing the effectiveness of OMT provided by predoctoral teaching fellows as measured by a visual analog pain scale
Sarkaria, J. A., Render, R. M., Lerma, C. M., Henley, N., Seffinger, M. A., Hruby, R. J.
The AAO Journal, 2012/09
Free full text

383

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the USMLE
Lenchus, J. D.
The Journal of the American Osteopathic Association, 2012/08
Free full text


385

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text

386

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text






392

Osteopathic medical student learning competency
Bell, H., Donohue, W., Liang, Y. J., Kim, J., Cettin, M.
Family Medicine, 2012/03

393

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the United States Medical Licensing Examination
Hasty, R. T., Snyder, S., Suciu, G. P., Moskow, J. M.
The Journal of the American Osteopathic Association, 2012/02
Free full text

394

Osteopathie studieren – wieso, weshalb, warum?
(Why study osteopathy?)
Meyer, B., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02




398

Time to direct COM candidates away from the MCAT?
Kauffman, M.
The Journal of the American Osteopathic Association, 2011/11
Free full text

399

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text

400

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text

401

Eating our seed corn, again!
Berkowitz, M. R.
The AAO Journal, 2011/09
Free full text


403

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text


405

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text

406

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text

407

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

408

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

409

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text

410

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text

411

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03

412

Osteopathic Scholarship, Research and Publication
Berkowitz, M. R.
The AAO Journal, 2011/03
Free full text

413

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text

414

Progression through osteopathic training in Australia: The student experience
Hartup, J. K., Murphy, R. A., Plowman, L. M., Myers, R.
International Journal of Osteopathic Medicine, 2010/12

415

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text

416

Reliability of bony anatomic landmark asymmetry assessment in the lumbopelvic region: application to osteopathic medical education
Stovall, B. A., Kumar, S.
The Journal of the American Osteopathic Association, 2010/11
Free full text

417

Development, implementation, and outcomes of an initiative to integrate evidence-based medicine into an osteopathic curriculum
Laird, S., George, J., Sanford, S. M., Coon, S.
The Journal of the American Osteopathic Association, 2010/10
Free full text


419

Attitudes and Confidence Levels of Fourth Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T., Best, M., Fotopoulos, T. J., Ball, L. D., Ruston, V. J.
The AAO Journal, 2010/09
Free full text

420

Training in osteopathic structural techniques from a student perspective: A survey of final year students
Zegarra-Parodi, R., Renard, E.O., Allamand, P.
International Journal of Osteopathic Medicine, 2010/09

421

Learning outcomes from a biomedical research course for second year osteopathic medical students
Cruser d, A., Brown, S. K., Ingram, J. R., Podawiltz, A. L., Dubin, B. D., Colston, J. S., Bulik, R. J.
Osteopathic Medicine and Primary Care, 2010/07
Free full text

422

Defining osteopathic medicine: can you put your finger on it?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2010/07
Free full text


424

Teaching osteopathic students technique; using research to identify good teaching practice
Browning, S.
International Journal of Osteopathic Medicine, 2010/06


426

The challenges of primary care and innovative responses in osteopathic education
Shannon, S. C., Ferretti, S. M., Wood, D., Levitan, T.
Health Affairs, 2010/05


428

The Effect of Early Clinical Exposure on Future OMT Use
Dalprat, J., Thompson, C., Hruby, R.
The AAO Journal, 2010/03
Free full text

429

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text

430

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text

431

Osteopathic medical education in 2010: another decade of growth
Shannon, S. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

432

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text


434

There Are More Things in Heaven and Earth…
Ching, L. M.G.
The AAO Journal, 2009/12
Free full text

435

Clearly distinct: outcomes of initiative to increase integration of osteopathic principles and practice at West Virginia School of Osteopathic Medicine
Steele, K. M., Baker, H. H.
The Journal of the American Osteopathic Association, 2009/11
Free full text

436

Biomedical research competencies for osteopathic medical students
Cruser, D. A., Dubin, B., Brown, S. K., Bakken, L. L., Licciardone, J. C., Podawiltz, A. L., Bulik, R. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text

437

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

438

Curricular analysis of competency-based osteopathic medical education: application of a matrix for quality enhancement to a standardized patient encounter example
Lockwood, M. D., Tucker-Potter, S., Sargentini, N. J.
The Journal of the American Osteopathic Association, 2009/09
Free full text

439

Editorial - Of originality, breathing dysfunction and clinical education
Lucas, N. P., Moran, R.
International Journal of Osteopathic Medicine, 2009/09

440

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text


442

Cranial palpation pressures used by osteopathy students
Kary, D.
The Journal of the American Osteopathic Association, 2009/07
Free full text

443

Intent to “teach“ and pay to play in osteopathic medical education
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/06
Free full text

444

Measuring awareness, interest, and involvement in the osteopathic community through board certification: a survey of DO residents in ACGME-accredited training programs
Scott, S. C., O'Connor, E. M., Marlow, R. A.
The Journal of the American Osteopathic Association, 2009/06
Free full text

445

Monitoring self-reported adverse events: A prospective, pilot study in a UK osteopathic teaching clinic
Rajendran, D., Mullinger, B., Fossum, C., Collins, P., Froud, R.
International Journal of Osteopathic Medicine, 2009/06

446

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text

447

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text

448

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text

449

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text

450

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text

451

Osteopathic postdoctoral training institutions: a decentralized model for facilitating accreditation and program quality
Peska, D. N., Opipari, M. I., Watson, D. K.
Academic Medicine, 2009/06
Free full text


453

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text

454

Factors affecting specialty choice among osteopathic medical students
Teitelbaum, H. S., Ehrlich, N., Travis, L.
Academic Medicine, 2009/06
Free full text



457


458

Intent to “teach“ and pay to play in osteopathic medical education
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/04
Free full text

459

Classroom lectures - where are the students and don't they care?
Reed, K.
Iowa Medicine: Journal of the Iowa Medical Society, 2009/03-04

460

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text

461

Dual and parallel postdoctoral training programs: implications for the osteopathic medical profession
Burkhart, D. N., Lischka, T. A.
The Journal of the American Osteopathic Association, 2009/03
Free full text

462

Osteopathic medical education in 2009: sails set for improved healthcare?
Shannon, S. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text

463

Evolution of colleges of osteopathic medicine: a discussion of the COCA's “substantive change“ policies
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text

464

The Integration of Undergraduate Osteopathic Manipulative Medicine Fellows into Medical Education: The KCUMB-COM Model
Cox, W. J., Boyajian-O'Neill, L. A., Roach, M. D., Ridgley, J. A.
The AAO Journal, 2009/03
Free full text

465

A for-profit medical school
Mychaskiw, G., 2nd, Wiltshire
Academic Medicine, 2009/01
Free full text

466

Retrospective Study of a Peer Assessment Education Encounter in the Development of Osteopathic Clinical Skills
Lockwood, M. D., Snider, E., Chipman, M.
The AAO Journal, 2008/12
Free full text

467

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12

468

Three pathways to a physician career: applicants to U.S. MD and DO schools and U.S. Citizen applicants to international medical schools
Jolly, P., Garrison, G., Boulet, J. R., Levitan, T., Cooper, R. A.
Academic Medicine, 2008/12


470

The introduction of a novel approach to the teaching and assessment of osteopathic manipulative medicine assessment skills
Fossum, C., Snider, E., Fryer, G., Gillette, N., Degenhardt, B.
International Journal of Osteopathic Medicine, 2008/12

471

End-of-life care curricula in undergraduate medical education: a comparison of allopathic and osteopathic medical schools
Rothman, M. D., Gugliucci, M. R.
American Journal of Hospice and Palliative Care, 2008/10-11

472

Supporting and promoting osteopathic medicine through community-based family practice preceptorships: a survey-based study
Aguwa, M. I., Monson, C. L., Liechty, D. K., Fowler, L. V., Kost, M. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text

473

Whose values are we teaching? Deconstructing responsibilities and duties of teachers of osteopathy
Sommerfeld, P.
International Journal of Osteopathic Medicine, 2008/09

474


475

Dangers of for-profit education: more than just words
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2008/08
Free full text

476

Increase efforts to promote primary care
Rapp, R. W.
The Journal of the American Osteopathic Association, 2008/08
Free full text

477

Introducing osteopathic medical education in an allopathic residency
Rubeor, A., Nothnagle, M., Taylor, J. S.
The Journal of the American Osteopathic Association, 2008/08
Free full text

478

AOA is strong advocate for debt relief and primary care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2008/07
Free full text

479

Role of exercise therapy in osteopathic education, treatment and management
Zamani, J. M.
Unpublished PhD thesis, 2008/07
Free full text

480


481


482

Excessive tuition does not equal excellent education
Andrews, C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text

483

Award-winning debt-management education
Goeppinger, K. H.
The Journal of the American Osteopathic Association, 2008/05
Free full text

484

Mortgaging our future, foreclosing our profession
Kraus II., C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text

485

Working to ease debt burdens
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/05
Free full text

486

The virtual haptic back: a simulation for training in palpatory diagnosis
Howell, J. N., Conatser, R. R., Williams II., R. L., Burns, J. M., Eland, D. C.
BMC Medical Education, 2008/04

487

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

488

Osteopathic medical education in 2008: course corrections and new horizons
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/03
Free full text

489

Medical education summits: building a solid foundation for the future of the osteopathic medical profession
Watson, D. K., Nichols, K. J.
The Journal of the American Osteopathic Association, 2008/03
Free full text

490

OMM education vs “real world“ medicine
Davidson, S. M.
The Journal of the American Osteopathic Association, 2008/02
Free full text

491

Colleges of osteopathic McMedicine?
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2008/02
Free full text


493

OMT Homework
Clark, R. C.
The AAO Journal, 2007/12
Free full text

494

Attitudes and Confidence Levels of Second-Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T. A., Fotopoulos, T. J., Best, M. A.
The AAO Journal, 2007/12
Free full text

495

Evolution of osteopathic graduate medical education: integration of osteopathic principles and practice in postdoctoral training
Lemley, W. W., Steele, K. M., Shires, W. E., McMahan, R. M.
The Journal of the American Osteopathic Association, 2007/11
Free full text

496

RVUCOM: striving to meet the needs of the osteopathic medical profession
Martin, R. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text


498


499

Getting “beyond the barriers“ in reforming osteopathic medical education
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2007/07
Free full text

500

Emphasizing research in osteopathic medical education
Martin, K. D.
The Journal of the American Osteopathic Association, 2007/07
Free full text

501

Repatriating DOs with MD-affiliated residencies
Forte, T. E.
The Journal of the American Osteopathic Association, 2007/05
Free full text

502

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text


504

Osteopathic medical education in 2007: plumbing the depths with the questions we ask
Shannon, S. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text


506

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2007/02
Free full text

507

Teaching “doctoring“: a model curriculum for family medicine
Wilson, M. A., Blondefield, P. J.
The Journal of the American Osteopathic Association, 2007/01
Free full text

508

Approval of ACGME Training as an AOA-approved internship: history and review of current data
Bulger, J. B.
The Journal of the American Osteopathic Association, 2006/12
Free full text

509

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text

510

Teaching critical appraisal: a pilot randomized controlled outcomes trial in undergraduate osteopathic medical education
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/11
Free full text

511

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text

512

Postdoctoral core competencies in the predoctoral curriculum
McNabb, J. E., Kangas, J. C., Higbee, D., Dawson, B.
The Journal of the American Osteopathic Association, 2006/09
Free full text

513

Assessing the Effectiveness of OMT Provided by Undergraduate Teaching Fellows as Measured by a Visual Analog Pain Scale
Lerma, C. M., Render, R. M., Sarkaria, J. A., Homertgen, K. D., Hruby, R. J.
The Journal of the American Osteopathic Association, 2006/08

514

AOA certifying boards are credible and capable
Reeves, R. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text

515

Future of osteopathic medicine depends on investing in graduate medical education
Tosca, M.
The Journal of the American Osteopathic Association, 2006/07
Free full text

516

Addressing substance abuse in medical school curricula
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2006/07
Free full text

517


518

Suggestions and questions for osteopathic medical education
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2006/06
Free full text

519

In a vacuum or in a s(l)ide show: OPP in osteopathic CME programming
Beaman, R. T.
The Journal of the American Osteopathic Association, 2006/06
Free full text

520

Maintaining competence and leadership in manual medicine
Beal, M. C.
The Journal of the American Osteopathic Association, 2006/06
Free full text

521

Competence levels in musculoskeletal medicine: comparison of osteopathic and allopathic medical graduates
Stockard, A. R., Allen, T. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text

522

Progressive idea for osteopathic medical education
Belsky, D. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text

523

Time to accept allopathic physicians into AOA-approved residencies?
Steier, K. J.
The Journal of the American Osteopathic Association, 2006/05
Free full text

524

Will the last DO turn off the lights?
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2006/05
Free full text

525

Calling all osteopathic physicians in New England!
Rossignol, M. E.
The Journal of the American Osteopathic Association, 2006/04

526

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text

527

Center or periphery? The future of osteopathic principles and practices
Gevitz, N.
The Journal of the American Osteopathic Association, 2006/03
Free full text

528

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text

529

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text

530

Osteopathic medical education in 2006: charting a course for the future
Shannon, S. C.
The Journal of the American Osteopathic Association, 2006/02
Free full text

531

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text

532

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text

533

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text

534

Computer animation and improved student comprehension of basic science concepts
Thatcher, J. D.
The Journal of the American Osteopathic Association, 2006/01
Free full text

535

Navigation in neurologic localization: web site launch
Hoegerl, C.
The Journal of the American Osteopathic Association, 2006/01
Free full text

536

Dynamic duo: Maine-Dartmouth Family Practice Residency program and University of New England College of Osteopathic Medicine
Perakis, C.
The Journal of the American Osteopathic Association, 2005/11
Free full text

537

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text

538

Surprised by surgery statistics
Kattner, K. A.
The Journal of the American Osteopathic Association, 2005/10
Free full text

539

Missed opportunity for osteopathic medical education
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

540

The “Big DO“
Werrell, B. H.
The Journal of the American Osteopathic Association, 2005/10
Free full text

541

Jumping through hoops for osteopathic internships
Snyder, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

542

Graduate medical education: accuracy of AOA's annual data-reporting mechanisms questioned
Cummings, M.
The Journal of the American Osteopathic Association, 2005/10
Free full text

543

Clinical Prevention and Population Health Curriculum Framework: the nursing perspective
Allan, J. D., Stanley, J., Crabtree, M. K., Werner, K. E., Swenson, M.
Journal of Professional Nursing, 2005/09
Free full text

544

Evidence base presented--and expanding--for investment in tobacco dependence curricula for osteopathic medical education
Montalto, N. J., Priester, T. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text

545

Loyalty to the profession, not the AOA: evidence base necessary for member support of association policies
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text

546

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text

547

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text

548

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text

549

Sir William Osler then and now: thoughts for the osteopathic profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2005/05
Free full text

550

Same as it ever was
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2005/03
Free full text

551

“Hardship exception“ is necessary
Zawadzki, E.
The Journal of the American Osteopathic Association, 2005/03

552

Osteopathic medical training revisited: developing tomorrow's physicians
Innes, K.
The Journal of the American Osteopathic Association, 2005/03
Free full text

553

Where Do We Go From Here? 2004 Thomas L. Northup Lecture
Glover, J. C.
The AAO Journal, 2005/03
Free full text

554

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text

555

DO notes difference between residency programs
Hornbeck, K. L.
The Journal of the American Osteopathic Association, 2004/09
Free full text

556

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text

557

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text

558

Tobacco dependence curricula in undergraduate osteopathic medical education
Montalto, N. J., Ferry, L. H., Stanhiser, T.
The Journal of the American Osteopathic Association, 2004/08
Free full text

559

Eckpunkte für Curriculum festgelegt
(Cornerstones for curriculum established)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2004/07

560

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text

561

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text

562

Status of complementary and alternative medicine in the osteopathic medical school curriculum
Saxon, D. W., Tunnicliff, G., Brokaw, J. J., Raess, B. U.
The Journal of the American Osteopathic Association, 2004/03
Free full text


564

Bridging the gap between medical education and application of OPP/OMT
Crosby, J. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text

565

Osteopathic emergency physician training and use of osteopathic manipulative treatment
Ray, A. M., Cohen, J. E., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text


567

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text

568

Characteristics of the courses that best predict COMLEX-USA level 1 performance
Sefcik, D. J., Prozialeck, W. C., O'Hare, T. H.
The Journal of the American Osteopathic Association, 2003/10
Free full text

569

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text

570

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text

571

Osteopathic graduate medical education opportunities abound in south Florida
Pinto, M. G.
The Journal of the American Osteopathic Association, 2003/07
Free full text

572

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text

573

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text

574

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01

575

Reasons for student debt during medical education: a Michigan study
Zonia, S. C., Stommel, M., Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 2002/12
Free full text

576

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

577

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11

578

Selection criteria for applicants in primary care osteopathic graduate medical education
Bates, B. P.
The Journal of the American Osteopathic Association, 2002/11
Free full text

579

State of the art in standardized patient programs: a survey of osteopathic medical schools
Errichetti, A. M., Gimpel, J. R., Boulet, J. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text

580

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text

581

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text

582

Re: Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
McGovern, J. J., McGovern, R. J., Lemley, W. W.
The AAO Journal, 2002/09
Free full text

583

Educating health professionals, first responders, and the community about bioterrorism and weapons of mass destruction
Silvagni, A. J., Levy, L. A., McFee, R. B.
The Journal of the American Osteopathic Association, 2002/09
Free full text


585

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text

586

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text

587

Osteopathy: A Noun Not Just An Adjective
Habenicht, A. L.
The AAO Journal, 2002/03
Free full text

588

Osteopathic philosophy must be the foundation of osteopathic medical education
Beals-Becker, L.
The Journal of the American Osteopathic Association, 2002/03
Free full text

589

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text


591

An alert regarding Canada's financial aid for an osteopathic medical education
Campbell, A.
The Journal of the American Osteopathic Association, 2002/01
Free full text

592

End-of-life care focus critical to a complete medical education
Gaber, R.
The Journal of the American Osteopathic Association, 2002/01
Free full text

593

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text

594

Can an Internet-based system assist with administration and distance learning for third- and fourth-year rural clinical rotations?
Baker, H. H., Foster, R. W., Cope, M. K., Boisvert, C., Wallace, G. H.
The Journal of the American Osteopathic Association, 2001/12
Free full text


596

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text

597

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text

598

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text


600

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text


602

Guide OPTI development beyond organizational differences
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

603

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

604

A framework for and case study of medical informatics development at Michigan State University College of Osteopathic Medicine
Notman, M., Greene, J. F.
The Journal of the American Osteopathic Association, 2001/12
Free full text

605

A Fact: The Medical Industry Doesn't Support Hands-On CME!
Noone, S. J.
The AAO Journal, 2001/12
Free full text

606

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text

607

Correlation of scores for the Comprehensive Osteopathic Medical Licensing Examination with osteopathic medical school grades
Hartman, S. E., Bates, B. P., Sprafka, S. A.
The Journal of the American Osteopathic Association, 2001/06
Free full text

608

President Bush's 2002 budget proposal would hamper geriatric education
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text

609

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text


611

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text

612

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text


614

Collaboration between pharmacy and osteopathic medicine to teach via the Internet
Sweeney, M. A., Schuster, M. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text

615

Hardship deferment saves residents' money
Weinberg, A.
The Journal of the American Osteopathic Association, 2000/12
Free full text

616

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text

617

A fresh look at osteopathic medical education in 2000
Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2000/11

618

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

619

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

620

Use of a computer-assisted clinical case (CACC) SOAP note exercise to assess students' application of osteopathic principles and practice
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2000/07
Free full text

621

Survey of medical ethics in US medical schools: a descriptive study
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2000/06
Free full text

622

Physician awareness of domestic violence: does continuing medical education have an impact?
Krueger, P. M., Schafer, S.
The Journal of the American Osteopathic Association, 2000/03
Free full text

623

The Comprehensive Osteopathic Medical Licensing Examination, COMLEX-USA: a new paradigm in testing and evaluation
Osborn, G. G., Meoli, F. G., Buser, B. R., Clearfield, M. B., Bruno, J. P., Sumner-Truax, L.
The Journal of the American Osteopathic Association, 2000/02
Free full text

624

Importance of OMT cannot be overemphasized
Abend, D. S.
Journal of Osteopathic Medicine, 1999/12
Free full text

625

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text


627


628

Osteopathic medical school applicants not allopathic medical school 'rejects'
Kasovac, M.
Journal of Osteopathic Medicine, 1998/10
Free full text

629

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text

630


631

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05

632

Partners for two decades: AOA and the National High Blood Pressure Education Program
Nickey, W. A., Lenfant, C.
Journal of Osteopathic Medicine, 1998/03


634

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text

635

Anatomy of an OPTI dissected: structure, function, and the impact of budget reconciliation legislation
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/11
Free full text

636

Anatomy of an OPTI: Part I. Form, function, and relationships
Meyer, C. T., Mann, M. P., Riley, C., Portanova, R.
Journal of Osteopathic Medicine, 1997/10
Free full text

637

Comparing medical knowledge of osteopathic medical trainees in DO and MD programs: a random effect meta-analysis
Shen, L., Cavalieri, T., Clearfield, M., Smoley, J.
Journal of Osteopathic Medicine, 1997/06
Free full text

638

AOA continuing medical education
MacPherson, S. B., Rodgers, D. J.
The Journal of the American Osteopathic Association, 1996/11
Free full text

639

Osteopathic graduate medical education
Bronersky, V. M., Falbo, P. W.
The Journal of the American Osteopathic Association, 1996/11
Free full text

640

Undergraduate osteopathic medical education
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

641

Osteopathic medical education: the introduction of managed care principles into our undergraduate curriculum
Musser, A. E., Vinn, N.
The Journal of the American Osteopathic Association, 1996/10
Free full text

642

Standardization of the hospital record for osteopathic structural examination: Part 2. Effects of an educational intervention on documentation of palpatory and structural findings and diagnosis
Friedman, H. D., Johnston, W. L., Kelso, A. F., Schwartz, F. N., Beal, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 1996/09
Free full text

643

Results of the 1996 National Resident Matching Program: family practice
Kahn, N. B., Jr., Garner, J. G., Schmittling, G. T., Ostergaard, D. J., Graham
Family Medicine, 1996/09

644

Transforming osteopathic medical education
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/08
Free full text

645

Ambulatory care training standards for continuity of care in osteopathic family medicine
Winters, F. D., Zonia, S., Cook, J. N., Dora, D. L., Meyer, C. T.
The Journal of the American Osteopathic Association, 1996/04
Free full text

646

Retraining osteopaths for general practice
Brumberg, M. A.
Hospital Practice, 1996/02

647

Marketing key to increased women applicants to COMs
Payson, S. M.
The Journal of the American Osteopathic Association, 1996/01
Free full text

648

Osteopathic GME consortia
Meyer, C. T., Mann, M. P.
Academic Medicine, 1995/11

649

Osteopathic postdoctoral training institution: the osteopathic 'road map' to graduate medical education viability
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/11
Free full text

650

Synergism strengthens osteopathic medical education programs
Allen, T. W.
Journal of Osteopathic Medicine, 1995/10
Free full text

651

Osteopathic graduate medical education programs must be maintained
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/09
Free full text

652

Osteopathic graduate medical education: don't give up the ship--yet!
Meyer, C. T.
Journal of Osteopathic Medicine, 1995/06
Free full text

653

Making sense of federal GME reforms: the need for secondary reforms
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/05
Free full text

654

Making sense of federal GME reforms: the impact on osteopathic medicine
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/04
Free full text

655

Time to abolish most osteopathic graduate medical education programs
Kienitz, R.
The Journal of the American Osteopathic Association, 1995/03
Free full text

656

Challenges and opportunities in occupational medicine
McCunney, R. J.
The Journal of the American Osteopathic Association, 1995/02
Free full text

657

A model for improving generalist physician output: the osteopathic experience
Cummings, M., Ennis, M.
Academic Medicine, 1995/01
Free full text

658

DOs who train in allopathic residency programs not 'disloyal'
Wogec, J.
The Journal of the American Osteopathic Association, 1994/12
Free full text

659

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text

660

Managed care and graduate medical education: mutual objectives, barriers, and prospects
Natkow, N., Fry, L. J.
The Journal of the American Osteopathic Association, 1994/07
Free full text

661

Important characteristics of a director of medical education
Powell, V. D., Jr., George
The Journal of the American Osteopathic Association, 1993/11
Free full text

662

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text

663

Osteopathic medicine: a call for reform
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/04
Free full text


665

Integrate osteopathic principles and practices in postgraduate medical education--now
Kasovac, M., Jones, J. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text

666

Voices From the Future: what students, interns, and residents want from osteopathic graduate medical training
Kushner, D., Cooney, J.
The Journal of the American Osteopathic Association, 1992/10
Free full text

667

Heed 'Voices From the Future' and reform GME training
Meyer, C. T.
The Journal of the American Osteopathic Association, 1992/10
Free full text

668

Graduate medical education
JAMA: The Journal of the American Medical Association, 1992/09

669

Selected characteristics of graduate medical education in the United States
Rowley, B. D., Baldwin, D. C., Jr., McGuire
JAMA: The Journal of the American Medical Association, 1991/08


671

Osteopathic postdoctoral education
Baker, H. H., Wachtler, J.
The Journal of the American Osteopathic Association, 1990/11
Free full text

672

The pull toward the vacuum: osteopathic medical education in the 1980s
Cummings, M.
The Journal of the American Osteopathic Association, 1990/04
Free full text


 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends