Advanced search



 
 80.2% of the records
 
 19.8 % of the records
 
 57.9 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal hemodynamic maneuverabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabdominopelvic regionabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic detailingacademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute careacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute generalized exanthematous pustulosisacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadherenceadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadversityadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimers diseaseAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangiogramangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior scaleneanterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic enlargementaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial rulearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrographyarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical diabetesatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybicuspid aortic valvebifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanical responsebiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipartate patellabipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblackblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringblistersbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood oxygen saturationblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasebone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone metastasisbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachiocephalic vesselsbrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous emphysemabullous lesionsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcar accidentcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac apex anglecardiac arrestcardiac cirrhosiscardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabiliationcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCBTCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectionCECScecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular accidentcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic exertional compartment syndromechronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic orchialgiachronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccidioidomycosiscoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive latencycognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecold therapycold water exposurecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscolostomycomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconference registrationconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantscryotherapyCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademodex folliculitisdemographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentoalveolar systemdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic ketoacidosisdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary habitsdietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscolorationdiscontinued trialsdiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisembarkment syndromedisengagement-techniquedisinfectiondisinfection protocoldisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal kyphosisdorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug approvaldrug combinationdrug industrydrug legislationdrug prescriptionsdrug reactiondrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenal perforationduodenojejunal junctionduodenumdupilumabduplex scanningDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadysrhythmiadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaeczema herpeticumedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRejection fractionelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiogramselectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendoscopyendothelial dysfunctionendothelial functionendovascular retrievalenduranceendurance sportsenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophiliaeosinophilic fasciitiseosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal auditory canal exostosisexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubationextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyelidseyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfaceface masksfacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial neuropathyfacial painfacial paralysisfacial structurefacial swellingfacial tapingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfebrile neutrophilic dermatosisfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow rateflu testingfluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood attitudesfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenforamen magnumFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiant cell arteritisgiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonadal veingonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgoutgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegritgroingroin injurygroin paingroove signgross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth failuregrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaglund deformityhair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhand surgeryhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth motivationhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionalhealth professionalshealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemochromatosishemodialysishemodynamichemodynamic controlhemodynamicshemoglobinhemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehereditary spherocytosisHermansky-Pudlak syndromehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanicHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghorseshospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxemiahypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincident painincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury recoveryinjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinstrumentationinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview selectioninterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintimate partner violenceintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischemic strokeischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseisotretinoinITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. BockJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournal policyjournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansaskaposi varicelliform eruptionKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney diseasekidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage disorderslanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngeal cancerlaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTlead exposureleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukodermaleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelichen planus pigmentosus inversuslidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung cancerlung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmaltreatmentmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmaskmask mandatemasksMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMay-Thurner syndromeMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedical writingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetatarsophalangeal jointmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrosurgerymicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle scalenemiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal change diseaseminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymitral valve prolapsemix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonoclonal antibodiesmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular latencyneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnevus spilusnevus unius lateralisnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluonchocerciasisoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisonyxopen arteryopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen oval windowopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid usageopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan mobilityorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational behaviororganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic exerciseosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen supplyoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillary fibroelastomapapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepatent ductus arteriosuspatent foramen ovalepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatient-reported outcomespatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer recoverypeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceived weightperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferencepercutaneous coronary interventionperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericarditispericardiumperichondritisperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languageperson-first languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepolitical advocacypoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepositivismpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cortical atrophyposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprehabilitationprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature epiphyseal closurepremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbycusispresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional sportsprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurigo nodularisprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric distresspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary abscesspulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSpyoderma gangrenosumQ angleq-testQEEGqi gongqigongQLQ-C30qtc intervalquackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesracismradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrashrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreaction timereactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundrealismreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared blood cellsred flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulationsregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of liferiverboardingRL1-803rlq painRLSRobert Fulfordrobotic surgeryroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff intervalrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsscent detectionscent dogsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerodermasclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescrambler therapyscreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch interestsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-harmself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsseroprevalenceserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice dogsservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36SGLT2 inhibitorsshadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortageshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromeShulman syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin rashskin temperatureskin testsskin toneskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialtyspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatic cordspermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervespinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainsspringing techniquesprintsprintingSQOR-V questionnainnairesquamous cell carcinomasquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysterilizationsternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain injurystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous emphysemasubcutaneous hemorrhagesubjective cognitive declinesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital muscle inhibition techniquesuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden cardiac deathsudden infant death syndromeSudeck syndromeSufismsugarsuicidal ideationsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial heatsuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperior vena cava syndromesuperoxide anion radicalssupervised exercisesupervised injection sitessupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgSweets syndromeswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandswollen earsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic inertiatherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic surgerythoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthromboembolismthrombolytic therapythrombosisthrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocilizumabtocilizumab therapytocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatracheobronchial casttrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment algorithmstreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment tacticstreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrial qualitytrialstriamcinolone acetonidetriathletestribal healthcaretrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUgandaUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract diseaseurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccination statusvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvalvular heart diseasevancomycinvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular physiologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena cava filtervena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitamin deficienciesvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noisewhitewater kayakingWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework hourswork schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysxeroderma pigmentosumyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

886 results (please see below)  Sort:    
1

Reliability of spinal palpation for diagnosis of back and neck pain: a systematic review of the literature
Seffinger, M. A., Najm, W. I., Mishra, S. I., Adams, A., Dickerson, V. M., Murphy, L. S., Reinsch, S.
Spine (Phila Pa 1976), Oct 1

2

Strategies to prevent and manage running-related knee injuries: A systematic review of randomised controlled trials
Alexander, J., Johnston, R., Ezzat, A., Culvenor, A., Barton, C.
Journal of Science and Medicine in Sport, Nov 2022 2022-11-02





7

Effects of osteopathic manipulative treatment on cardiovascular function: a systematic review and meta-analysis
Johnston, K., Chow, R., Rubinstein, M., Burtner, M., Hollander, S., Humm, A., Chen, L., DeArmond, M., Koshy-Chenthittayil, S., Hightower, C.
International Journal of Osteopathic Medicine, 2026/03

8

The Association between Exposure to Adverse Childhood Experiences and the Risk of Developing Autoimmune Rheumatic Disease: A Systematic Review
Settbon Moore, R., Krasnik Rawlings, M., Vogel, S.
International Journal of Osteopathic Medicine, 2026/03

9

Incorporation of virtual reality into medical physiology
Benmerzouga, I., Oviawe, E.
Advances in Physiology Education, 2026/03
Free full text

10



12

The effectiveness of manual therapy in people with chronic non-specific low back pain: an umbrella review with meta-analysis
Conde-Vázquez, O., García-Cancela, J., Navarro-Ledesma, S., Pruimboom, L.
Annals of Physical and Rehabilitation Medicine, 2026/03
Free full text

13

Osteopathic Manipulative Treatment for Chronic Obstructive Pulmonary Disease: A Systematic Review
Ponce, A., Paek, K. H., Heintzelman, K.
Cureus, 2026/01
Free full text


15

Investigating biomarkers associated with mortality in patients receiving VA-ECMO for cardiogenic shock: a systematic review
Ramsarran, J., Albertson, T., Hoops, T., Patel, D., Christy, A. N., Joyner, R.
Journal of Osteopathic Medicine, 2026/01
Free full text





20

Effect of osteopathic manipulative treatment on primary pelvic pain - A systematic review with meta-analysis
Parada, J. G., da Silva, E. B., Fernandes, A. P., Portugal, G. B.
International Journal of Osteopathic Medicine, 2025/12




24

Breathing retraining and manual therapy for long COVID – A literature review
Courtney, R., Steele, Z., Collyer, I.
International Journal of Osteopathic Medicine, 2025/12
Free full text


26

Autonomic Rehabilitation: Cardiovagal and Autonomic Impacts of Post Isometric Muscle Energy at the Upper Cervical Spine
Miller, A., Curran, C., Fanous, S., Nakashima, T., Yates, H., Johns, J., Fotopoulos, T., Gustin, D., Wilson, J., McAllister, J., Moon, J., Thornburgh, K., Wenner, A., Garg, R., Gharbo, R.
The AAO Journal, 2025/12

27

Signs and symptoms of vertebrobasilar insufficiency secondary to atherosclerosis: a systematic review
Moors, C., Stapleton, C.
Journal of Osteopathic Medicine, 2025/11
Free full text

28

Predictability of cranial base strains as related to birth presentation: a review of literature
McElwain, S. K., Schmidt, D.
Journal of Osteopathic Medicine, 2025/11
Free full text



31

Swelling and skin changes: an osteopathic approach to pediatric lymphedema management
Jackson, S., Hussaini, A., Galan, J., Chung, T. C., Javed, B.
Journal of Osteopathic Medicine, 2025/10
Free full text

32

Evaluation of Craniosacral Therapy Effects on Brain Wave Patterns in Children with Mild Autism Spectrum Disorder Using the QEEG Method
Kopańska, M., Szczygielski, J., Batrman, P., Banaś-Ząbczyk, A.
Acta Neuropsychologica, 2025/10
Free full text

33

Diaphragm’s Role as a Systems-Connector Muscle: A Narrative Review
Bordoni, B., Morabito, B., Escher, A. R.
Cureus, 2025/10
Free full text

34

Objective measurement of Cranial Rhythmic Impulse (CRI): visual analysis of an observational case series
Strada, M., Galli, M., Cattaneo, R.
Journal of Bodywork and Movement Therapies, 2025/10

35

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10

36

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10

37

The Spinal Facilitation Hypothesis and Reflex Arcs in Modern Osteopathic Medicine
Bordoni, B., Simonelli, M., Morabito, B., Escher, A. R.
Cureus, 2025/09
Free full text


39

A review of osteopathic and related manipulative treatments for improving symptoms of gastrointestinal distress in neurological disorders
Peters, J., Runnels, G., Lauinger, A., Murphy, T., Griffith, A., Slicho, T.
International Journal of Osteopathic Medicine, 2025/09


41

Retrospective Study of Osteopathic Manipulative Treatment on Length of Stay and Opioid Use After Vestibular Schwannoma Resection
Chen, A. I., Golshan, S., Schwartz, M. S., Friedman, R. A.
Otology & Neurotology Open, 2025/09




45

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text

46

Osteopathic diagnosis and treatment of the spine in patients with chronic back pain through the lens of medical infrared thermography: A randomized controlled pilot study
Bohlen, L., Biester, A., Rapp, O., Wentzel, J., Liem, T., Cerritelli, F., Schmidt, T.
Complementary Therapies in Clinical Practice, 2025/08

47

Comparing intubation techniques of Klippel–Feil syndrome patients in the last 10 years: a systematic review
Fisher, M., Simonsen, A., Stewart, C., Alkhatib, S., Niewchas, A., Otto, A., Hansen, R., McIntire, K., Sukpraprut-Braaten, S.
Journal of Osteopathic Medicine, 2025/08
Free full text


49

Impact of osteopathic tests on heart rate and heart rate variability: an observational study on osteopathic students
Gillet, F., Gault, M., Dussault, V., Cheggour, S., Grinand, M., Martinez, P.
Journal of Osteopathic Medicine, 2025/08
Free full text

50

Minimum physical activities protective against Alzheimer’s disease in late life: a systematic review
Sakazaki, A., Lui, A., Muhammad, H., Vu, C., le Roux, A., Lacayo, P., Murakami, S.
Journal of Osteopathic Medicine, 2025/07
Free full text


52

A Holistic Approach to Treatment of Rosacea During Pregnancy: A Systematic Review
Garelick, E., Hurley, M., Bell, L. N., Cubelli, S.
SKIN: Journal of Cutaneous Medicine, 2025/07
Free full text



55

Research gaps in the correlation of anxiety and depression prevalence in former college athletes: a systematic review
Reese, M. L., Eggleston, B. A., Smith, A. M., Young, A. J., Mazur, A., Hartwell, M.
Journal of Osteopathic Medicine, 2025/06
Free full text

56

OMT for acute on chronic pain in systemic scleroderma
White, M., Furlano, A.
The AAO Journal, 2025/06


58

Evaluation of Osteopathic Manipulative Treatment Strategies in Adults with Chronic Neck Pain
Moljo, M., Sreenivasa, S., Neupane, R., Harris, Z., Potter, A.
The AAO Journal, 2025/06


60

Efficacy and safety of musculoskeletal manipulations in elderly population with musculoskeletal disorders: a systematic review
Bagagiolo, D., Persiani, M., Cicchitti, L., Vismara, L., Bruini, I., Mauro, A., Buffone, F.
BMJ Open, 2025/06



63

Author Correction: Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., Perpetuini, D., Keys, J., Merla, A., Cardone, D.
Scientific Reports, 2025/05
Free full text

64

An Expert Consensus of Acceptable Scholarly Activities in Emergency Medicine Residency Training Programs
Garg, N., Totten, V. Y., Greenberg, M. R., Wilkerson, G., Finnell, J. T., Lau, W. B., Miner, J. R., d'Etienne, J. P., Brenner, J. D., Kumar, P., Camargo, C. A.
The Journal of Emergency Medicine, 2025/04


66

A comprehensive review of clinical experiences and extracurricular activities for US premedical students applying to osteopathic medical schools
Kadavakollu, S., Dang, T., Bains, J., Ham-Ying, J., Boyanovsky, B., Qureshi, M., Graneto, J., Richards, S.
Journal of Osteopathic Medicine, 2025/04
Free full text


68

The role of osteopathic manipulative treatment for dystonia: a literature review
Phrathep, D. D., Abdo, Z., Tadros, M., Lewandowski, E., Evans, J.
Journal of Osteopathic Medicine, 2025/04
Free full text


70

Eficacia de la osteopatía en la enfermedad del asma bronquial
(Effectiveness of osteopathy in bronchial asthma)
Peramo Ruíz, J. M.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text

71

Eficacia del tratamiento osteopático visceral para el dolor lumbar
(Effectiveness of visceral osteopathic treatment for low back pain)
Rodríguez Mesa, N.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text

72

A call for improving the internal validity and the reporting of manual therapy trials self-labelled as pragmatic: A methodological review
Roura, S., Alvarez, G., Hohenschurz-Schmidt, D., Solà, I., Núñez-Cortés, R., Bracchiglione, J., Fernández-Jané, C., Phalip, J., Gich, I., Sitjà-Rabert, M., Urrútia, G.
International Journal of Osteopathic Medicine, 2025/03
Free full text

73

Effects of pain education delivered through telerehabilitation on pain and disability in patients with chronic musculoskeletal pain: A systematic review protocol
Velho, G., de Araujo, F. X., da Silva, C. V., Machado, J. C., da Silva, F. C., Hoegh, M. S., Silva, M. F.
International Journal of Osteopathic Medicine, 2025/03


75

Indigenous Epistemological Frameworks and Evidence-Informed Approaches to Consciousness and Body Representations in Osteopathic Care: A Call for Academic Engagement
Zegarra-Parodi, R., Loum, T., D&rsquo, Alessandro, G., Baroni, F., Zweedijk, R., Schillinger, S., Conte, J., Mehl-Madrona, L., Lunghi, C.
Healthcare, 2025/03

76

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R, 2025/03


78

Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., David, P., Jordan, K., Arcangelo, M., Daniela, C.
Scientific Reports, 2025/03
Free full text


80

Gaskell, Langley, and the “para-sympathetic“ idea
Brunet, J. F.
Elife, 2025/03
Free full text

81

Die Milz
(The Spleen)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03

82

Osteopathy meets Neurology
Korff, S., Mersinli, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03

83

Altersbedingte Veränderungen des autonomen Nervensystems
(Age-related changes in the autonomic nervous system)
Scheuchl, F., Peuker, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03

84

Efficacy of pulsed electromagnetic field therapy on pain and physical function in patients with non-specific low back pain: a systematic review
Kull, P., Keilani, M., Remer, F., Crevenna, R.
Wiener Medizinische Wochenschrift, 2025/02
Free full text

85

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text

86

Efficacy of non-surgical, non-pharmacological treatments for congenital muscular torticollis: a systematic review and meta-analysis
Antares, J. B., Jones, M. A., Chak, N. T. N., Chi, Y., Li, H., Li, M., Chan, E. Y. W., Chen, T. M. K., Lee, C. M. Y., Urquhart, D. M.
BMC Musculoskeletal Disorders, 2025/02
Free full text

87

Specificity of cranial cutaneous manipulations in modulating autonomic nervous system responses and physiological oscillations: A controlled study
Keller, M., Perlitz, V., Pelz, H., Borik, S., Repik, I., Geilgens, A., Cotuk, B., Müller, G., Mathiak, K., Mayer, J.
PLoS ONE, 2025/02
Free full text

88

Visceral manipulation intervention in functional dyspepsia with or without gastroesophageal reflux disease: a systematic review.
Achmad, A., Manaf, H.
International Journal of Public Health Science, 2025/02
Free full text

89

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01

90

Is visceral osteopathy therapy effective? A systematic review and meta-analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Esteban-Tarcaya, G., Mamud-Meroni, L., Jiménez-del-Barrio, S.
International Journal of Osteopathic Medicine, 2024/12

91

The effectiveness of Neuromuscular Spinal Manipulation- An updated systematic review and meta-analysis
Lo, C. N., Tsang, E. W., Ngai, S. P. C.
International Journal of Osteopathic Medicine, 2024/12


93

Autonomic Nervous System and Viscera-Related Responses to Manual Therapy: A Narrative Overview
Alanazi, M. S., Degenhardt, B., Franklin, G., Jacobson, E., Fritz, S., Kettner, N., Kremen, V., Lipke, L., Reed, W. R.
International Journal of Osteopathic Medicine, 2024/12
Free full text



96

Impact of Suboccipital Release Osteopathic Manipulative Treatment on Cardiac Control in Healthy Adults
Kachelmeyer, J., Witczak, R., Cummings, K., Crasta, M.
Journal of Osteopathic Medicine, 2024/12

97

Spinal manipulations for migraine: an updated systematic review and meta-analysis of randomized clinical trials
Posadzki, P., Klimek, A. T., Ernst, E.
Systematic Reviews, 2024/11
Free full text

98

A systematic review of manual therapy modalities and anxiety
West, K. L., Huzij, T.
Journal of Osteopathic Medicine, 2024/11
Free full text

99

Is Osteopathic Manipulative Treatment Clinically Superior to Sham or Placebo for Patients with Neck or Low-Back Pain? A Systematic Review with Meta-Analysis
Ceballos-Laita, L., Jiménez-Del-Barrio, S., Carrasco-Uribarren, A., Medrano-de-la-Fuente, R., Robles-Pérez, R., Ernst, E.
Diseases, 2024/11

100

Effect of manual manipulation on mechanical gait parameters
Yanuck, S. B., Fox, S. K., Harting, B. R., Motyka, T. M.
Journal of Osteopathic Medicine, 2024/10

101

Efficacy of osteopathic manipulative treatment (93.6, ICD-9) - systematic review
Dwornik, M., Puszczałowska-Lizis, E., Wójcik, M., Szajkowski, S., Graczykowski, M., Szymański, D., Marszałek, S.
Medical Studies/Studia Medyczne, 2024/10
Free full text

102

Effectiveness of Osteopathic Treatment in Adults with Short Hamstring Syndrome: A Systematic Review
Ogando-Berea, H., Leirós-Rodríguez, R., Hernandez-Lucas, P., Rodríguez-González, Ó
Journal of Clinical Medicine, 2024/10
Free full text

103

Conservative, physical and surgical interventions for managing faecal incontinence and constipation in adults with central neurological diseases
Todd, C. L., Johnson, E. E., Stewart, F., Wallace, S. A., Bryant, A., Woodward, S., Norton, C.
Cochrane Database of Systematic Reviews, 2024/10

104

Efficacy of ankle mobilization on postural control in older people: A systematic review with meta-analysis
Hernández-Guillén, D., García-Gomariz, C., Roig-Casasús, S., Díaz-Díaz, B., Domínguez-Navarro, F., Pérez-Maletzki, J., Blasco, J.M.
International Journal of Osteopathic Medicine, 2024/09
Free full text


106

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

107

Pathophysiology of Nociplastic Pain
Tedeschi, R.
The AAO Journal, 2024/09

108

Effects of High-Velocity Spinal Manipulation on Quality of Life, Pain and Spinal Curvature in Children with Idiopathic Scoliosis: A Systematic Review
Piqueras-Toharias, M., Ibáñez-Vera, A. J., Peinado-Rubia, A. B., Rodríguez-Almagro, D., Lomas-Vega, R., Sedeño-Vidal, A.
Children, 2024/09
Free full text


110

Efectividad de las manipulaciones vertebrales en pacientes con cefalea de tensión
(Effectiveness of spinal manipulations in patients with tension headaches)
Bohoyo Aramburu, C., Urien Abaunza, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text

111

Terapia manual y tratamiento osteopático en el Síndrome del Túnel Capiano
(Manual therapy and osteopathic treatment for Carpal Tunnel Syndrome)
Carleos Mayán, F., Otero Torres, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text

112

Efectividad del tratamiento osteopático en el síndrome de dolor pélvico crónico
(Effectiveness of osteopathic treatment in chronic pelvic pain syndrome)
del Pilar Jopia Escobar, M., Leal Blu, C. G., Negrete Fuentes, K. V.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text


114

Efectividad del tratamiento osteopático en el síndrome subacromial
(Effectiveness of osteopathic treatment in subacromial syndrome)
Izquierdo Aicart, L., Ruiz Rojo, N., Santiago Ramirez, J.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text



117

A Review on Osteopathic Manipulation in Patients With Headache
Sharath, H. V., Nadipena, P. T., Qureshi, M. I., Phansopkar, P.
Cureus, 2024/08
Free full text

118

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08

119

The Neurophysiological Effects of Craniosacral Treatment on Heart Rate Variability: A Systematic Review of Literature and Meta-Analysis
Cook, A. C., Egli, A. E., Cohen, N. E., Bernardi, K., Chae, M. Y., Kapalko, B. A., Coyne, S. A., Scott, R.
Cureus, 2024/07
Free full text

120

Use of person-centered language in obesity-related publications across sports medicine journals: a systematic review of adherence to person-centered language guidelines in sports medicine
Webb, J., Mach, K., Gooch, T., Reddy, A., Anderson, M., Scott, J., Checketts, J. X., Walker, L., Hartwell, M.
Journal of Osteopathic Medicine, 2024/07
Free full text

121

How completely are randomized controlled trials of non-pharmacological interventions following concussion reported? A systematic review
van Ierssel, J. J., Galea, O., Holte, K., Luszawski, C., Jenkins, E., O', Neil, J., Emery, C. A., Mannix, R., Schneider, K., Yeates, K. O., Zemek, R.
Journal of Sport and Health Science, 2024/07
Free full text

122

Alternative Therapies for Ankyloglossia-Associated Breastfeeding Challenges: A Systematic Review
Chowdhury, R., Khoury, S., Leroux, J., Alsayegh, R., Lawlor, C. M., Graham, M. E.
Breastfeeding Medicine, 2024/07

123

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text





128

Reported biological effects following Osteopathic Manipulative Treatment: A comprehensive mapping review
Dal Farra, F., Bergna, A., Lunghi, C., Bruini, I., Galli, M., Vismara, L., Tramontano, M.
Complementary Therapies in Medicine, 2024/06

129



131

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06

132

A Qualitative and Quantitative Analysis of Suboccipital Release on Heart Rate Variability
Moon, J., Fotopoulos, T. J., Gustin, D., Thornburgh, K. R., Wenner, A. R., McAllister, J. M.
The AAO Journal, 2024/06

133

Post Isometric Muscle Energy at the Cervical Spine (OA, C1, C2) Increases Vagal Tone as Quantified by Heart Rate Variability Metrics
Nakashima, T., Curran, C., Yates, H., Fanous, S., Johns, J., Fotopoulos, T. J., Miller, A.
The AAO Journal, 2024/06

134

Interventions to promote medical student well-being: an overview of systematic reviews
Bennett-Weston, A., Keshtkar, L., Jones, M., Sanders, C., Lewis, C., Nockels, K., Solomon, J., Howick, J.
BMJ Open, 2024/05
Free full text

135

The effectiveness of an osteopathic manual technique compared with a breathing exercise on vagal tone as indicated by heart rate variability, a crossover study
Cavanagh, M., Cope, T., Smith, D., Tolley, I., Orrock, P., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text






141

The role of aspirin, statins, colchicine, and IL-1 inhibitors in prevention of cardiovascular events: a systematic integrative review
Arboleda, V., Hackworth, A., Bonnice, S., Gonzalez, V., Cabrera, D., Colletti, C., Baxter, C., Aleman Oliva, C., Kabir, S., Huang, J., Khan, A., Filoramo, S., Ecoff, S., Demory Beckler, M., Kesselman, M. M.
Journal of Osteopathic Medicine, 2024/03
Free full text

142


143

Osteopathisch-manipulative Behandlung bei herzchirurgischen Patient*innen: Eine systematische Übersicht
(Osteopathic-manipulative treatment in cardiac surgery patients: A systematic review)
Rorris, F.P., Skouteli, E.A. T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
Osteopathische Medizin, 2024/03

144

Funktionelle Anatomie der Interozeption
(Functional anatomy of interoception)
Luthin, D., Neuhuber, W.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

145

Efectividad del abordaje osteopático en pacientes con fibromialgia
(Effectiveness of osteopathic treatment in patients with fibromyalgia)
García Ruiz, P.
European Journal Osteopathy & Related Clinical Research, 2024/03
Free full text


147

Eficacia de las técnicas de osteopatía en la dismenorrea
(Effectiveness of osteopathic techniques in dysmenorrhea)
Romero Rodríguez, T., Ruiz Martínez, A., Fernández Villamarín, E.
European Journal Osteopathy & Related Clinical Research, 2024/03

148

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03

149

Is Craniosacral Therapy Effective? A Systematic Review and Meta-Analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Cabanillas-Barea, S., Esteban-Pérez, J., Jiménez-del-Barrio, S.
Healthcare, 2024/03
Free full text


151

Knowledge Mapping Analysis of Research on Pregnancy-Related Pelvic Girdle Pain (PPGP) from 2002 to 2022 Using Bibliometrics
Xu, L., Li, Y., He, Y., Chen, M., Zhang, Y., Liu, C., Zhang, L.
Journal of Pain Research, 2024/02
Free full text

152


153

Clinical Effectiveness of Craniosacral Therapy in Patients with Headache Disorders: A Systematic Review and Meta-analysis
Carrasco-Uribarren, A., Mamud-Meroni, L., Tarcaya, G. E., Jiménez-Del-Barrio, S., Cabanillas-Barea, S., Ceballos-Laita, L.
Pain Management Nursing, 2024/02

154

Interdisciplinary Approach to Orthodontic Treatment Involving an Osteopath and a Dentist (Protocol)
Aptekar, I. A., Abramova, E. V., Postnikov, M. A., Kopetsky, I. S., Eremin, D. A., Postnikova, E. M., Poluianova, E. B., Aptekar, V. I., Muravyov, I. O.
Bulletin of Russian State Medical University, 2024/02
Free full text

155

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text

156

Osteopathic Manipulative Treatment in Dysmenorrhea: A Systematic Review
Bonner, P. E., Paul, H. A., Mehra, R. S.
Cureus, 2024/01
Free full text

157

Delayed discovery: the COVID-19 pandemic’s influence on osteoarthritis clinical trials
Sajjadi, N. B., Anderson, J. M., Hughes, G. K., Abraham, C. E., Malik, J., Hartwell, M., Vassar, M.
Journal of Osteopathic Medicine, 2024/01
Free full text

158

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text


160

Antitumoral Agent-Induced Constipation: A Systematic Review
Calsina-Berna, A., González-Barboteo, J., Llorens-Torromé, S., Julià-Torras, J.
Cancers, 2024/01
Free full text

161

Spinal manipulation combined with exercise therapy could be more effective than exercise therapy alone for shoulder pain and disability: A systematic review and meta-analysis
Santos-Júnior, F. F. U., Rossi, D. M., de Freitas, L. J., Martins, J., de Oliveira, A. S.
International Journal of Osteopathic Medicine, 2023/12

162

Application of high-velocity low-amplitude technique in cervicothoracic junction produces cardiovascular responses in subjects with C7-T1 dysfunction: Randomized crossover trial
Zago, J., de Souza, B. U. L., Amatuzzi, F., Rondinel, T. Z., Queiroz, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2023/12

163

Application of craniosacral therapy in practice
Wójcik, M., Placek, K., Bordoni, B.
Polish Journal of Physiotherapy, 2023/12



166

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text

167

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/12
Free full text

168

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
Free full text


170

Valid and Invalid Indications for Osteopathic Interventions: A Systematic Review of Evidence-Based Practices and French Healthcare Society Recommendations
Khalaf, Z. M., Margulies, P., Moussa, M. K., Bohu, Y., Lefevre, N., Hardy, A.
Cureus, 2023/11
Free full text


172

COVID-19 scent dog research highlights and synthesis during the pandemic of December 2019-April 2023
Dickey, T., Junqueira, H.
Journal of Osteopathic Medicine, 2023/11
Free full text




176

Effekte von Osteopathie auf Migräne
(Effects of osteopathy on migraine)
Pöchlauer-Schneck, J.
Unpublished MSc thesis, 2023/11





181

Placebo analgesia in physical and psychological interventions: Systematic review and meta-analysis of three-armed trials
Hohenschurz-Schmidt, D., Phalip, J., Chan, J., Gauhe, G., Soliman, N., Vollert, J., Lunde, S. J., Vase, L.
European Journal of Pain, 2023/10
Free full text

182

Osteopathic Manipulative Medicine and Its Role in Psychiatry
Bowes, M. R., Speicher, M. R., Tran, L. T., Santiago, P. N.
Cureus, 2023/10
Free full text

183

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text

184

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09


186

Stomatognathes System: Stellenwert für die Osteopathie
(Stomatognathic system: Significance for osteopathy)
Prätorius, O., Herdick, T.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09


188

Short-term effects on heart rate variability of occipito-mastoid suture normalization in healthy subjects
Besson, C., Mur, T., Benaim, C., Schmitt, L., Gremeaux, V.
Frontiers in Neuroscience, 2023/09
Free full text



191

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text

192

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text


194

Modifying functional brain networks in focal epilepsy by manual visceral-osteopathic stimulation of the vagus nerve at the abdomen
Lehnertz, H., Broehl, T., Rings, T., von Wrede, R., Lehnertz, K.
Frontiers in Network Physiology, 2023/07
Free full text

195

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07

196

Systematic review and meta-analysis showed that complementary and alternative medicines were not effective for infantile colic
Cabanillas-Barea, S., Jiménez-del-Barrio, S., Carrasco-Uribarren, A., Ortega-Martínez, A., Pérez-Guillén, S., Ceballos-Laita, L.
Acta Paediatrica: Nurturing the Child, 2023/07
Free full text

197

Integrating A Student Co-Created Health Systems Science Curriculum Within UME
Ethridge, B., Steadman, M., Crews, B.
Southern Medical Journal, 2023/07

198

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text

199

Effectiveness of Osteopathic Manipulative Treatment in Treating Symptoms of Irritable Bowel Syndrome: A Literature Review
Lotfi, C., Blair, J., Jumrukovska, A., Grubb, M., Glidden, E., Toldi, J.
Cureus, 2023/07
Free full text


201

Effectiveness of visceral fascial therapy targeting visceral dysfunctions outcome: systematic review of randomized controlled trials
da Silva, F. C., Vieira, L. S., Santos, L V., Gaudreault, N., Cruvinel-Júnior, R H., Santos, G M.
BMC Complementary Medicine and Therapies, 2023/07
Free full text


203

Study Size Variation Based on Specialty and Intervention Type
Asseraf, N., Torres, J.
The AAO Journal, 2023/06
Free full text

204

An Osteopathic Approach to Chronic Inflammatory Demyelinating Polyneuropathy
Baxter, C., Grote, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text

205

Nervous System Under Attack
Blaukovitch, C., Unger, M., Thorsvik, N., Heller, G.
The AAO Journal, 2023/06
Free full text

206

Happy Feet are Dancing Feet, Response to OMT in a Patient with Morphea Profunda: A Case Report
Bomani-Bailey, A., Ettlinger, H.
The AAO Journal, 2023/06
Free full text

207

Utilization of Osteopathic Structural Examinations by Osteopathic Physicians During A Routine Adult Physical Examination: A Systematic Review
Krzykwa, E., Sulangi, A. J., Moljo, R. J., Johnson, M., Rodriguez, J., Reindel, K., Waters, H., Mehra, R.
The AAO Journal, 2023/06
Free full text


209

The Effect of OMT on Insulin Sensitivity and Glucose Control in Rodent Models: A Pilot Study
Petrillo, G., Cai, W., Keys, J.
The AAO Journal, 2023/06
Free full text

210

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
Free full text

211

Superficial Approach to the Sphenopalatine (Pterygopalatine) Ganglion
Rudberg-Post, L., Matz, O., Gustafson, H., Matz, D.
The AAO Journal, 2023/06
Free full text




215

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06

216

Evaluating the underreporting of patient-reported outcomes in carpal tunnel syndrome randomized controlled trials
Ladd, C., Jacobsen, S. M., Snider, K., Bacani, R., Hillman, C., Shepard, S., Heigle, B., Ottwell, R., Hartwell, M., Vassar, M.
Journal of Osteopathic Medicine, 2023/06
Free full text

217

Terapia manual y tratamiento osteopático en pacientes con EPOC estable
(Manual therapy and osteopathic treatment in patients with stable COPD)
Diaz Serrano, R., Souto Villar, M. A.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text



220

Eficacia del tratamiento osteopático en la dismenorrea
(Effectiveness of osteopathic treatment for dysmenorrhea)
Molina Galera, V.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text



223

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05


225

The effectiveness of visceral osteopathy in pain, disability, and physical function in patients with low-back pain. A systematic review and meta-analysis
Ceballos-Laita, L., Mingo-Gómez, M. T., Medrano-de-la-Fuente, R., Hernando-Garijo, I., Jiménez-Del-Barrio, S.
Explore (NY), 2023/04

226

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text

227

Informing the Physical Therapy Management of Congenital Muscular Torticollis Clinical Practice Guideline: A Systematic Review
Castilla, A., Gonzalez, M., Kysh, L., Sargent, B.
Pediatric Physical Therapy, 2023/04

228

Osteopathic Findings and Treatment of Patient with Crohn's Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text


230

Blinding and sham control methods in trials of physical, psychological, and self-management interventions for pain (article I): a systematic review and description of methods
Hohenschurz-Schmidt, D., Draper-Rodi, J., Vase, L., Scott, W., McGregor, A., Soliman, N., MacMillan, A., Olivier, A., Cherian, C. A., Corcoran, D., Abbey, H., Freigang, S., Chan, J., Phalip, J., Nørgaard Sørensen, L., Delafin, M., Baptista, M., Medforth, N. R., Ruffini, N.
Pain, 2023/03

231

Work from home-related musculoskeletal pain during the COVID-19 pandemic: A rapid review
Gomez, I. N., Suarez, C. G., Sosa, K. E., Tapang, M. L.
International Journal of Osteopathic Medicine, 2023/03
Free full text


233

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text

234

Osteopathic Findings and Treatment of Patient with Crohn’s Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text

235

A scientometrics analysis and visualization of low back pain
Zuo, Y., Zhang, J., Leng, X., Fan, Y., Fu, B., Wang, P.
International Journal of Osteopathic Medicine, 2023/03


237

Eficacia de las técnicas osteopáticas en el dolor de rodilla
(Effectiveness of osteopathic techniques in knee pain)
González Ruiz, P. M., Laguna Aranda, A. M., Aranda Guirado, L.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text


239

Efecto de la osteopatía en la enfermedad por reflujo gastroesofágico
(Effect of osteopathy on gastroesophageal reflux disease)
Martín Ruiz, M.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text


241

Manejo de las radiculopatías mediante manipulaciones espinales
(Management of radiculopathies through spinal manipulation)
Prado Posada, S.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text

242

Efectividad del tratamiento osteopático en el dolor pélvico crónico
(Effectiveness of osteopathic treatment for chronic pelvic pain)
Rivero Rodríguez, S.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text

243

Beneficios del tratamiento osteopático en el periodo obstétrico
(Benefits of osteopathic treatment during pregnancy)
Rodríguez Pérez-Serrano, E., Sedeño Vidal, A.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text







250

Connecting the dots: alterations in bioelectric activity at acupuncture Ting (Jing-Well) points following CV4 cranial manipulation
Hendryx, J. T., Kannan, A., Prashad, J., Falk, K.
Journal of Osteopathic Medicine, 2023/03
Free full text


252

Osteopathic Manipulation as a Method of Cortisol Modification: A Systematic Review
Thibaut, D., Santarlas, V., Hoppes, J., Vásquez-Castillo, A., Morrow, A., Oviedo, E., Toldi, J.
Cureus, 2023/03
Free full text

253

Management of Post-Viral Postural Orthostatic Tachycardia Syndrome With Craniosacral Therapy
Tafler, L., Chaudry, A., Cho, H., Garcia, A.
Cureus, 2023/02
Free full text

254

Lower trapezius muscle function in people with and without shoulder and neck pain: a systematic review
Wang, D. M., Li, C., Hatchard, N., Chang Chien, G. C., Alm, J.
Journal of Osteopathic Medicine, 2023/02
Free full text

255

Dynamic touch induces autonomic changes in preterm infants as measured by changes in heart rate variability
Manzotti, A., Cerritelli, F., Monzani, E., Savioli, L., Esteves, J. E., Lista, G., Lombardi, E., Rocca, S. L., Biasi, P., Galli, M., Chiera, M., McGlone, F. P.
Brain Research, 2023/01

256

Effectiveness of osteopathic manipulative treatment in cardiovascular function: a systematic review protocol
Vanier, C., Johnston, K., DeArmond, M., Salloum, L., Arjmand, S., Toder, E., Ioudina, M.
JBI Evidence Synthesis, 2023/01
Free full text

257

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Wang, M. Y., Ferguson, H., Bingham, J., Senger, B., Swogger, S. E., Johnston, R., Snider, K. T.
Journal of Osteopathic Medicine, 2023/01

258

(Osteopathy as a treatment proposal for patients with temporomandibular disorders: a systematic review)
Pereira de Paula, R., Oliveira da Silva Almeida, D., Garcia de Paula, G., Moreira Alves, L., Oliveira Silva, M., Rodrigues da Cunha, M., Iatecola, A., Ramos Fernandes, V.A., Rodrigues Silva, V., de França, E., Barroso Hirota, V.
Revista Multidisciplinar da Saúde, 2023
Free full text


260

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12

261

Spinal manipulation and mobilisation in the treatment of infants, children, and adolescents: a systematic scoping review
Milne, N., Longeri, L., Patel, A., Pool, J., Olson, K., Basson, A., Gross, A. R.
BMC Pediatrics, 2022/12
Free full text



264

Variations of the Cystohepatic Blood Supply in American Midwestern Donor Cadavers
Memar, S. A., VanSickle, C., Funk, S., Houser, J. J., Markand, S.
Cureus, 2022/12
Free full text

265

Effectiveness of muscle energy technique in patients with nonspecific low back pain: a systematic review with meta-analysis
Santos, G. K., Gonçalves de Oliveira, R., Campos de Oliveira, L., Ferreira C de Oliveira, C., Andraus, R. A., Ngomo, S., Fusco, A., Cortis, C., Da Silva, R. A.
European Journal of Physical and Rehabilitation Medicine, 2022/12
Free full text

266

Manual therapy as a management approach for gastroesophageal reflux disease: A systematic review
Brendon dos Santos, C., Artioli, D. P., Bertolinie, G. R. F.
International Journal of Osteopathic Medicine, 2022/12

267

Five challenges for manual therapies trials with placebo controls: A proposal
D'Alessandro, G., Ruffini, N., Iacopini, A., Annoni, M., Kossowsky, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/12

268

A Systematic Review on Spinal Asymmetries in Case Studies of Unilateral Nephroptosis from a Viscerosomatic Point of View
Oliva-Pascual-Vaca, Á, Castillo-Cañuelo, M. J., Oliva-Pascual-Vaca, J., Pérez-Montalbán, M., Ordonez, F. J., Martínez-Fernández, J. A.
Healthcare, 2022/11
Free full text

269

Osteopathy: effectiveness and safety for musculoskeletal pain and overview of training and quality requirements. AIHTA Project Report No.: 144 2022
Gassner, L., Hofer, V.
HTA Austria – Austrian Institute for Health Technology Assessment GmbH, 2022/11
Free full text

270

Thoracic outlet syndrome: a review for the primary care provider
Cavanna, A. C., Giovanis, A., Daley, A., Feminella, R., Chipman, R., Onyeukwu, V.
Journal of Osteopathic Medicine, 2022/11
Free full text

271

Non-Pharmacological Management od Systematic Lupus Erythematosus and Systematic Sclerosis: A Systematic Literature Review to Inform Eular Recommendations
Parodis, I., Gomez, A., Tsoi, A., Chow, J. W., Pezzella, D., Girard, C., Stamm, T., Boström, C.
Lupus Science and Medicine, 2022/10
Free full text

272

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text

273

La osteopatía visceral como parte del tratamiento del dolor lumbar
(Visceral osteopathy as part of the treatment of lower back pain)
Castejón España, J., Diez Solórzano, P.
European Journal Osteopathy & Related Clinical Research, 2022/09
Free full text

274

Efectividad del tratamiento osteopático en la plagiocefalia
(Effectiveness of osteopathic treatment for plagiocephaly)
Gamarra Herraiz, L.
European Journal Osteopathy & Related Clinical Research, 2022/09
Free full text




278

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/09

279

Efectividad del tratamiento osteopático en pacientes con migraña
(Effectiveness of osteopathic treatment in patients with migraine)
Insausti, P. J.
European Journal Osteopathy & Related Clinical Research, 2022/09
Free full text

280

The psychological burden associated with Ehlers-Danlos syndromes: a systematic review
Kennedy, M., Loomba, K., Ghani, H., Riley, B.
Journal of Osteopathic Medicine, 2022/08
Free full text

281

Effectiveness of osteopathic interventions in patients with non-specific neck pain: A systematic review and meta-analysis
Dal Farra, F., Buffone, F., Risio, R. G., Tarantino, A. G., Vismara, L., Bergna, A.
Complementary Therapies in Clinical Practice, 2022/08

282

Differences between experimental and placebo arms in manual therapy trials: a methodological review
D&rsquo, Alessandro, G., Ruffini, N., Aquino, A., Galli, M., Innocenti, M., Tramontano, M., Cerritelli, F.
BMC Medical Research Methodology, 2022/08
Free full text


284

Osteopathic Treatment for Gastrointestinal Disorders in Term and Preterm Infants: A Systematic Review and Meta-Analysis
Buffone, F., Monacis, D., Tarantino, A. G., Farra, F., Bergna, A., Agosti, M., Vismara, L.
Healthcare, 2022/08
Free full text

285

The Role of Osteopathic Care in Gynaecology and Obstetrics: An Updated Systematic Review
Ruffini, N., D', Alessandro, G., Pimpinella, A., Galli, M., Galeotti, T., Cerritelli, F., Tramontano, M.
Healthcare, 2022/08
Free full text

286

The Main Changes in Pregnancy - Therapeutic Approach to Musculoskeletal Pain
Fiat, F., Merghes, P. E., Scurtu, A. D., Almajan Guta, B., Dehelean, Cristina A., Varan, N., Bernad, E.
Medicina, 2022/08
Free full text

287

Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine
Sookaromdee, P., Wiwanitkit, V.
Journal of Osteopathic Medicine, 2022/08
Free full text

288

Das zerebrospinale venöse System
(The cerebrospinal venous system)
Flenker, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07

289

Osteopathic Manipulative Treatment for Pediatric Conditions: An Update of Systematic Review and Meta-Analysis
Posadzki, P., Kyaw, B. M., Dziedzic, A., Ernst, E.
Journal of Clinical Medicine, 2022/07
Free full text


291

Review of medication-assisted treatment for opioid use disorder
Ghanem, N., Dromgoole, D., Hussein, A., Jermyn, R. T.
Journal of Osteopathic Medicine, 2022/07
Free full text

292

Osteopathic practice in the United Kingdom: A retrospective analysis of practice data
Plunkett, A., Fawkes, C., Carnes, D.
PLoS One, 2022/07
Free full text

293

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07

294

Effectiveness of osteopathic manipulative treatment for pediatric conditions: A systematic review
Franke, H, Franke, J.D., Fryer, G.
Journal of Bodywork and Movement Therapies, 2022/07

295

Cervical cancer screening among women with comorbidities: a cross-sectional examination of disparities from the behavioral risk factor surveillance system
Austin, J., Delgado, P., Gatewood, A., Enmeier, M., Frantz, B., Greiner, B., Hartwell, M.
Journal of Osteopathic Medicine, 2022/07
Free full text

296

Den Nerv getroffen
(Striking a nerve)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07

297

Efectividad del tratamiento osteopático en el estrés
(Effectiveness of osteopathic treatment for stress)
Ramírez López, A.
European Journal Osteopathy & Related Clinical Research, 2022/06
Free full text







304

Psychosocial Interventions for the Treatment of Functional Abdominal Pain Disorders in Children: A Systematic Review and Meta-analysis
Gordon, M., Sinopoulou, V., Tabbers, M., Rexwinkel, R., de Bruijn, C., Dovey, T., Gasparetto, M., Vanker, H., Benninga, M.
JAMA Pediatrics, 2022/06
Free full text

305

A long COVID patient and their experience of osteopathic care: A case report
Monro, M.
International Journal of Osteopathic Medicine, 2022/06

306

Utilizing Osteopathic Manipulative Techniques to Mitigate Fall Risk Among Hospitalized Elderly Patients: A Literature Review
Arshad, U., Baum, B., Carter, R., Gustowski, S.
The AAO Journal, 2022/06
Free full text


308


309

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text

310

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05

311


312

An updated brief overview on post-traumatic headache and a systematic review of the non-pharmacological interventions for its management
Argyriou, A. A., Mitsikostas, D. D., Mantovani, E., Litsardopoulos, P., Panagiotopoulos, V., Tamburin, S.
Expert Review of Neurotherapeutics, 2022/04
Free full text

313

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text

314

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text

315

Eficacia del tratamiento osteopático en el estreñimiento crónico
(Effectiveness of osteopathic treatment for chronic constipation)
Cabello Romero, E.
European Journal Osteopathy & Related Clinical Research, 2022/03
Free full text


317

Efectos de la osteopatía en pacientes con fibromialgia
(Effects of osteopathy on patients with fibromyalgia)
Hormigo Navarro, R.
European Journal Osteopathy & Related Clinical Research, 2022/03
Free full text


319

Mulligan mobilization for cervicogenic headache - A systematic review
Aslıyüce, Y. Ö., Ülger, Ö.
International Journal of Osteopathic Medicine, 2022/03

320

Work-from-home-related musculoskeletal pain during the COVID-10 pandemic: A rapid review protocol
Gomez, I. N., G. Suarez, C., Sosa, K. E., Tapang, M. L.
International Journal of Osteopathic Medicine, 2022/03
Free full text

321

Effectiveness and safety of extracorporeal shock wave treatment for low back pain:a systematic review and meta-analysis of RCTs
Ma, J., Yan, Y., Wang, B., Sun, W., Yue, D., Wang, W.
International Journal of Osteopathic Medicine, 2022/03

322

Weibliche Anatomie: Die Harnblase
Female Anatomy: The Urinary Bladder
Bazin, O., Naudin, M.
Osteopathische Medizin, 2022/03


324

Advances in the therapeutic approach of pudendal neuralgia: a systematic review
Murer, S., Polidori, G., Beaumont, F., Bogard, F., Polidori, E., Kinne, M.
Journal of Osteopathic Medicine, 2022/01
Free full text

325

Pragmatic trials of pain therapies: a systematic review of methods
Hohenschurz-Schmidt, D., Kleykamp, B. A., Draper-Rodi, J., Vollert, J., Chan, J., Ferguson, M., McNicol, E., Phalip, J., Evans, S. R., Turk, D. C., Dworkin, R. H., Rice, A. S. C.
Pain, 2022/01
Free full text


327

Neurogenic Bowel Dysfunction Changes after Osteopathic Care in Individuals with Spinal Cord Injuries: A Preliminary Randomized Controlled Trial
Tamburella, F., Princi, A. A., Piermaria, J., Lorusso, M., Scivoletto, G., Masciullo, M., Cardilli, G., Argentieri, P., Tramontano, M.
Healthcare, 2022/01
Free full text

328

A novel movement system screen for primary care providers: a multisite, observational study
Kettle, C., McKay, L., Cianciolo, A. M., Kareha, S. M., Ruggeri, C. E.
Journal of Osteopathic Medicine, 2022/01
Free full text

329

Lymphatic osteopathic manipulative treatment reduces duration of deltoid soreness after Pfizer/BioNTech COVID-19 vaccine
Marshall, S., Winter, S., Capobianco, J. D.
Journal of Osteopathic Medicine, 2022/01
Free full text

330



332

Reporting results in manual therapy clinical trials: A need for improvement
Núñez-Cortés, R., Alvarez, G., Pérez-Bracchiglione, J., Cabanas-Valdés, R., Calvo-Sanz, J., Bonfill, X., Urrutia, G.
International Journal of Osteopathic Medicine, 2021/12




336

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: Protocol for systematic review and meta-analysis
Rehman, Y., Kirsch, J., Bhatia, S., Johnston, R., Bingham, J., Senger, B., Swogger, S., Snider, K. T.
International Journal of Osteopathic Medicine, 2021/12

337

Therapeutic Effects of Lymphatic Pump Treatment on Lymphangiogenesis and Inflammatory Cytokines in Lymph Nodes of Rats with Adjuvant-Induced Arthritis
Blucher, K. M., Jain, S., Weber, D., Gober, C., Zanotti, B., Incrocci, R., Del Toro, R., Swanson-Mungerson, M., Volin, V. V.
Journal of Osteopathic Medicine, 2021/12

338

Serum osteocalcin in the osteopathic treatment for motor function in Parkinson’s Disease
Gupta, S., Lamba, S., Yao, S. C., Mancini, J.
Journal of Osteopathic Medicine, 2021/12


340

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text

341

Effect of joint manipulation and muscle energy technique in patients with Chronic Obstructive Pulmonary Disease: A review
Bains, D., Goyal, M., Chahal, A., Shaphe, M. A.
Annals of Clinical and Analytical Medicine, 2021/11
Free full text




345

Effectiveness of myofascial release on pain, sleep, and quality of life in patients with fibromyalgia syndrome: A systematic review
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P.
Complementary Therapies in Clinical Practice, 2021/11

346

Spinal Manipulative Therapy for Acute Neck Pain: A Systematic Review and Meta-Analysis of Randomised Controlled Trials
Chaibi, A., Stavem, K., Russell, M. B.
Journal of Clinical Medicine, 2021/10
Free full text

347

Influence of vertebral manipulations on the autonomic nervous system
(Влияние вертебральных манипуляций на вегетативную нервную систему)
Sebastian Rausell, J. M., Martinez Garcia, A. B., Jaume Llinas, A. S., Escobio Prieto, I.
Russian Osteopathic Journal, 2021/10
Free full text


349

Osteopathic Treatment and Evaluation in the Clinical Setting of Childhood Hematological Malignancies
Barbieri, M., Zardo, W., Frittoli, C., Rivolta, C., Valdata, V., Bouquin, F., Passignani, G., Maggiani, A., Jankovic, M., Cossio, A., Biondi, A., Balduzzi, A., Lanfranconi, F.
Cancers, 2021/10
Free full text


351

Spin in the abstracts of systematic reviews and metaanalyses focused on percutaneous coronary intervention
Cole, W. T., Wittl, P., Arthur, W., Ottwell, R., Greiner, B., Koshy, G., Chronister, J., Hartwell, M., Staheli, J., Wright, D. N., Sealey, M., Zhu, L., Vassar, M.
Journal of Osteopathic Medicine, 2021/09
Free full text


353

A Systematic Review of Musculoskeletal Mobilization and Manipulation Techniques Used in Veterinary Medicine
Haussler, K. K., Hesbach, A. L., Romano, L., Goff, L., Bergh, A.
Animals, 2021/09
Free full text

354

(Osteopoathic medical treatment of pediatric patient)
Angersbach, N.
Unpublished MSc thesis, 2021/09


356

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08

357

Vertigo and Balance Disorders-The Role of Osteopathic Manipulative Treatment: A Systematic Review
Tramontano, Marco, Consorti, Giacomo, Morone, Giovanni, Lunghi, Christian
Complementary Medicine Research, 2021/08


359

Muscle Energy Technique in the Rehabilitative Treatment for Acute and Chronic Non-Specific Neck Pain: A Systematic Review
Sbardella, S., La Russa, C., Bernetti, A., Mangone, M., Guarnera, A., Pezzi, L., Paoloni, M., Agostini, F., Santilli, V., Saggini, R., Paolucci, T.
Healthcare, 2021/07
Free full text

360

Effects of myofascial release or self-myofascial release and control position exercises on lower back pain in idiopathic scoliosis: A systematic review
López-Torres, O., Mon-López, D., Gomis-Marzá, C., Lorenzo, J., Guadalupe-Grau, A.
Journal of Bodywork and Movement Therapies, 2021/07


362

An international profile of the practice of osteopaths: A systematic review of surveys
Ellwood, J., Carnes, D.
International Journal of Osteopathic Medicine, 2021/06

363

Diversity and Inclusion on General Surgery, Integrated Thoracic Surgery, and Integrated Vascular Surgery Residency Program Websites
Mortman, R., Frazier, H. A., Haywood, Y. C.
Journal of Graduate Medical Education, 2021/06
Free full text



366

The Effectiveness of Pump Techniques and Pompages: A Systematic Review
Vanti, C., Golfari, M., Pellegrini, G., Panizzolo, A., Turone, L., Giagio, S., Pillastrini, P.
Applied Sciences, 2021/05
Free full text

367

Animal-derived medications: cultural considerations and available alternatives
Babos, M. B., Perry, J. D., Reed, S. A., Bugariu, S., Hill-Norby, S., Allen, M. J., Corwell, T. K., Funck, J. E., Kabir, K. F., Sullivan, K. A., Watson, A. L., Wethington, K. K.
Journal of Osteopathic Medicine, 2021/04
Free full text

368

Assessment of Studies Evaluating Spinal Manipulative Therapy and Infectious Disease and Immune System Outcomes: A Systematic Review
Chow, N., Hogg-Johnson, S., Mior, S., Cancelliere, C., Injeyan, S., Teodorczyk-Injeyan, J., Cassidy, J. D., Taylor-Vaisey, A., Cote, P.
JAMA Network Open, 2021/04
Free full text



371

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text



374

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04




378

Osteopathic model of the development and prevention of occupational musculoskeletal disorders
Price, J. W.
Journal of Osteopathic Medicine, 2021/03
Free full text


380

The validity of lumbo-pelvic landmark palpation by manual practitioners: a systematic review
Alexander, N., Rastelli, A., Webb, T., Rajendran, D.
International Journal of Osteopathic Medicine, 2021/03


382

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03

383

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03












395

Gut Microbiome Changes with Osteopathic Treatment of Constipation in Parkinson's Disease: A Pilot Study
Mancini, J. D., Yao, S., Martinez, L. R., Shakil, H., Li, T. S.
Neurology (ECronicon), 2021/01
Free full text

396

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01

397

Effectiveness of osteopathic interventions in chronic non-specific low back pain: A systematic review and meta-analysis
Dal Farra, F., Risio, R. G., Vismara, L., Bergna, A.
Complementary Therapies in Medicine, 2021/01
Free full text

398

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text



401

The Effect of Osteopathic Manipulative Treatment on Stiff Person Syndrome
Bazzi, M. O., Vemuri, A., Downing, M. A., Barry, P. E.
The Journal of the American Osteopathic Association, 2020/12

402

The Effect of Facial Effleurage on Serum Complement C3 During Acute Rhinosinusitis: A Randomized, Controlled Study
Burke, K. S., Weidman, C., Bradley, J. H.
The Journal of the American Osteopathic Association, 2020/12

403

Kikuchi-Fujimoto Disease Heralding Systemic Lupus Erythematosus
Aun, J. A., Hubbard, M. J.
The Journal of the American Osteopathic Association, 2020/12
Free full text

404

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text



407

Cranial osteopathic treatment and stress-related effects on autonomic nervous system measured by salivary markers: A pilot study
Abenavoli, A., Badi, F., Barbieri, M., Bianchi, M., Biglione, G., Dealessi, C., Grandini, M., Lavazza, C., Mapelli, L., Milano, V., Monti, L., Seppia, S., Tresoldi, M., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2020/10



410

Osteopathic Manipulative Treatments for Pediatric Conditions
Raines, S. G. M., Ramey, A. L.
Osteopathic Family Physician, 2020/10
Free full text

411

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text

412

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text

413

Musculoskeletal disorders and complaints in professional musicians: a systematic review of prevalence, risk factors, and clinical treatment effects
Rotter, G., Noeres, K., Fernholz, I., Willich, S. N., Schmidt, A., Berghöfer, A.
International archives of occupational and environmental health, 2020/09
Free full text


415

Instrumentation used to assess pain in osteopathic interventions: A critical literature review
Santiago, R. J., Esteves, J., Baptista, J. S., Marques, A. T., Costa, J. T.
International Journal of Osteopathic Medicine, 2020/09

416

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

417

Does Osteopathic Manipulative Treatment Induce Autonomic Changes in Healthy Participants? A Thermal Imaging Study
Cerritelli, F., Cardone, D., Pirino, A., Merla, A., Scoppa, F.
Frontiers in Neuroscience, 2020/08
Free full text

418

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07

419

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06


421

Does a manual therapy approach improve the symptoms of functional constipation? A systematic review of the literature
Erdrich, L. M., Reid, D., Mason, J.
International Journal of Osteopathic Medicine, 2020/06

422

Influence of the phrenic nerve in shoulder pain: A systematic review
Fernández-López, I., Peña-Otero, D., Ángeles Atín-Arratibel, M., Eguillor-Mutiloa, M.
International Journal of Osteopathic Medicine, 2020/06

423

Effects of Osteopathic Manipulative Treatment on Musicians: A Systematic Review
Kiepe, M. S., Fernholz, I., Schmidt, T., Brinkhaus, B., Schmidt, A., Weikert, C., Rotter, G.
Medical problems of performing artists, 2020/06



426

Evaluation of the stomatognathic system before and after osteopathic manipulative treatment in 120 healthy people by using surface electromyography
Manzotti, A., Viganoni, C., Lauritano, D., Bernasconi, S., Paparo, A., Risso, R., Nanussi, A.
International Journal of Environmental Research and Public Health, 2020/05
Free full text


428

Helping Students Navigate the Single Graduate Medical Education Accreditation System
Díaz, S. R., Baker, S. D., Medio, F. J.
The Journal of the American Osteopathic Association, 2020/04
Free full text

429

Muscle Energy Technique for Neck Pain: Systematic Review
Son, B. K., Yoo, H. J., Geum, J. H., Lee, J. H., Ha, W. B.
The Journal of Korea CHUNA Manual Medicine for Spine & Nerves, 2020/04
Free full text

430

Severe Postoperative Chronic Constipation Related to Anorectal Malformation Managed with Osteopathic Manipulative Treatment
Vismara, L., Cozzolino, V., Pradotto, L. G., Gentile, R., Tarantino, A. G.
Case Reports in Gastroenterology, 2020/04
Free full text

431

The Effect of High Velocity Low Amplitude Cervical Manipulations on the Musculoskeletal System: Literature Review
Giacalone, A., Febbi, M., Magnifica, F., Ruberti, E.
Cureus, 2020/04
Free full text

432

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text


434

Evidence and recommendations for the use of segmental motion testing for patients with LBP – A systematic review
Stolz, M., von Piekartz, H., Hall, T., Schindler, A., Ballenberger, N.
Musculoskeletal Science and Practice, 2020/02
Free full text



437

Impact of blinding on estimated treatment effects in randomised clinical trials: meta-epidemiological study
Moustgaard, H., Clayton, G. L., Jones, H. E., Boutron, I., Jorgensen, L., Laursen, D. R. T., Olsen, M. F., Paludan-Muller, A., Ravaud, P., Savovic, J., Sterne, J. A. C., Higgins, J. P. T., Hrobjartsson, A.
The BMJ, 2020/01
Free full text


439

Craniosacral therapy for chronic pain: a systematic review and meta-analysis of randomized controlled trials
Haller, H., Lauche, R., Sundberg, T., Dobos, G., Cramer, H.
BMC Musculoskeletal Disorders, 2019/12
Free full text




443

Efecto de la Osteopatía sobre el sistema nervioso autónomo mediante interpretación de la variabilidad
(Effect of osteopathy on the autonomic nervous system through interpretation of variability)
Llinás, A. S. J., Rausell, J. M. S., Escobio Prieto, I.
European Journal Osteopathy & Related Clinical Research, 2019/12
Free full text


445

Tratamiento osteopático en la infertilidad femenina
(Osteopathic treatment for female infertility)
Vázquez, A., Ortega, D.
European Journal Osteopathy & Related Clinical Research, 2019/12

446

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11


448

Effectiveness of an osteopathic treatment on the autonomic nervous system: a systematic review of the literature
Rechberger, V., Biberschick, M., Porthun, J.
European Journal of Medical Research, 2019/10
Free full text


450

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text


452

Is visceral manipulation beneficial for patients with low back pain? A systematic review of the literature
Switters, J. M., Podar, S., Perraton, L., Machotka, Z.
International Journal of Osteopathic Medicine, 2019/09

453

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy for somatoform disorders - a systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

454

Ergojump evaluation of the explosive strength in volleyball athletes pre- and post-fascial treatment
Buscemi, A., Petralia, M. C., Ramaci, T., Rapisarda, A., Provazza, C., Di Corrado, D., Perciavalle, V., Perciavalle, V., Coco, M.
Experimental and Therapeutic Medicine, 2019/08
Free full text

455

Muscle energy technique for chronic obstructive pulmonary disease: a systematic review
Baxter, D. A., Shergis, J. L., Fazalbhoy, A., Coyle, M. E.
Chiropractic & Manual Therapies, 2019/08

456

The efficacy of muscle energy techniques in symptomatic and asymptomatic subjects: a systematic review
Thomas, E., Cavallaro, A. R., Mani, D., Bianco, A., Palma, A.
Chiropractic & Manual Therapies, 2019/08
Free full text


458

Improving the quality of myofascial release research – A critical appraisal of systematic reviews
Ajimsha, M. S., Shenoy, P. D.
Journal of Bodywork and Movement Therapies, 2019/07





463

Integrated pilot medical study on 40 patients affected by open angle glaucoma undergoing topical therapy with additional osteopathic manipulation
Paoli, D., Brusini, P., Michelin, L., Vassallo, F., Ciullo, L., Torelli, L.
Acta Ophthalmologica, 2019/06

464

Spinal manual therapy in infants, children and adolescents: A systematic review and meta-analysis on treatment indication, technique and outcomes
Driehuis, F., Hoogeboom, T. J., Nijhuis-van der Sanden, M. W. G., de Bie, R. A., Staal, J. B.
PLoS One, 2019/06

465

Patient experience, satisfaction, perception and expectation of osteopathic manipulative treatment: A systematic review
Lam, M. T., Banihashem, M., Lam, H. R., Wan, A. B., Chow, E.
International Journal of Osteopathic Medicine, 2019/06


467

Learning and teaching of patient-centred communication skills in allied healthcare manual therapy students: A systematic review
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2019/06

468

Cynefin Framework for Evidence-Informed Clinical Reasoning and Decision-Making
Lunghi, C., Baroni, F.
The Journal of the American Osteopathic Association, 2019/05
Free full text


470

The Impact of Spinal Manipulation on Migraine Pain and Disability: A Systematic Review and Meta-Analysis
Rist, P. M., Hernandez, A., Bernstein, C., Kowalski, M., Osypiuk, K., Vining, R., Long, C. R., Goertz, C., Song, R., Wayne, P. M.
Headache, 2019/04
Free full text

471

Effect of soft tissue mobilization techniques on adhesion-related pain and function in the abdomen: A systematic review
Wasserman, J. B., Copeland, M., Upp, M., Abraham, K.
Journal of Bodywork and Movement Therapies, 2019/04

472

Manipulasjonsteknikker ved nakkeasymmetri hos spedbarn
(Manipulation techniques for infant torticollis)
Brurberg, K. G., Dahm, K. T., Kirkehei, I.
Tidsskrift for den Norske Laegeforening, 2019/04
Free full text

473

Complementary and alternative medicine research in practice-based research networks: A critical review
Lee, H., Peng, W., Steel, A., Reid, R., Sibbritt, D., Adams, J.
Complementary Therapies in Medicine, 2019/04

474

Timing of oral feeding changes in premature infants who underwent osteopathic manipulative treatment
Vismara, L., Manzotti, A., Tarantino, A. G., Bianchi, G., Nonis, A., La Rocca, S., Lombardi, E., Lista, G., Agosti, M.
Complementary Therapies in Medicine, 2019/04

475

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text


477

Ist Asymmetrie Dysfunktion?
(Is asymmetry dysfunction?)
Robert, V.
Osteopathische Medizin, 2019/03

478

Manual therapy for the pediatric population: a systematic review
Parnell Prevost, C., Gleberzon, B., Carleo, B., Anderson, K., Cark, M., Pohlman, K. A.
BMC Complementary and Alternative Medicine, 2019/03
Free full text

479

Benefits and harms of spinal manipulative therapy for the treatment of chronic low back pain: systematic review and meta-analysis of randomised controlled trials
Rubinstein, S. M., de Zoete, A., van Middelkoop, M., Assendelft, W. J. J., de Boer, M. R., van Tulder, M. W.
The BMJ, 2019/03
Free full text


481

Just Say Know to Drugs! A High School Pharmacology Enrichment Program for a Rural Population
Hamrick, L. A., Harter, S. R., Fox, C. L., Dhir, M., Carrier, R. L.
The Journal of the American Osteopathic Association, 2019/02
Free full text

482

Correlation Between Physiologic and Osteopathic Measures of Sympathetic Activity in Women With Polycystic Ovary Syndrome
Davis, S. E., Hendryx, J., Bouwer, S., Menezes, C., Menezes, H., Patel, V., Speelman, D. L.
The Journal of the American Osteopathic Association, 2019/01
Free full text



485

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

486

Quality of randomized control trials and pilot trials in osteopathy according to the CONSORT checklist
Morin, C., Maclure, M., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text


488

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text

489

Scoping review of systematic reviews of complementary medicine for musculoskeletal and mental health conditions
Lorenc, A., Feder, G., MacPherson, H., Little, P., Mercer, S. W., Sharp, D.
BMJ Open, 2018/10
Free full text



492

Efectividad del tratamiento osteopático en el síndrome del túnel carpiano
(Effectiveness of osteopathic treatment in carpal tunnel syndrome)
Bueno Fleirez, M.
European Journal Osteopathy & Related Clinical Research, 2018/09
Free full text


494

Osteopathic Lymphatic Pump Techniques
Franzini, D., Cuny, L. A., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/07
Free full text


496

Lymphatic Pump Treatment Mobilizes Bioactive Lymph That Suppresses Macrophage Activity In Vitro
Castillo, R., Schander, A., Hodge, L. M.
The Journal of the American Osteopathic Association, 2018/07
Free full text


498

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects
Abdelfattah, A., Abdelraoof, N., Nasef, S.
Internal Medicine Journal, 2018/05
Free full text

499

Manipulation and mobilization for treating chronic low back pain: a systematic review and meta-analysis
Coulter, I. D., Crawford, C., Hurwitz, E. L., Vernon, H., Khorsan, R., Suttorp Booth, M., Herman, P. M.
The Spine Journal, 2018/05
Free full text

500

IGeL-Monitor. Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text



503

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03

504

The effects of osteopathic treatment on psychosocial factors in people with persistent pain: A systematic review
Saracutu, M., Rance, J., Davies, H., Edwards, D. J.
International Journal of Osteopathic Medicine, 2018/03


506

Terapia manual como tratamiento en pacientes con coccigodinia
(Manual therapy as treatment for patients with coccygodynia)
Guimaraens, F. I.
European Journal Osteopathy & Related Clinical Research, 2018/03
Free full text

507

Efectos de la manipulación vertebral sobre el sistema nervioso autónomo
(Effects of spinal manipulation on the autonomic nervous system)
Rausell, J. M. S., Martínez García, A. B., Llinás, A. S. J., Escobio Prieto, I.
European Journal Osteopathy & Related Clinical Research, 2018/03
Free full text

508

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text

509

Effects of spinal manipulation and myofascial techniques on heart rate variability: A systematic review
Amoroso Borges, B. L., Bortolazzo, G. L., Neto, H. P.
Journal of Bodywork and Movement Therapies, 2018/01

510

Manual therapy for unsettled, distressed and excessively crying infants: a systematic review and meta-analyses
Carnes, D., Plunkett, A., Ellwood, J., Miles, C.
BMJ Open, 2018/01
Free full text

511

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01

512

Level of evidence and quality of reports of cranial and visceral osteopathic treatment trials
Morin, C., Gaboury, I.
Global Advances in Health and Medicine, 2018

513

Compression of the Fourth Ventricle Using a Craniosacral Osteopathic Technique: A Systematic Review of the Clinical Evidence
Zurowska, A., Malak, R., Kolcz-Trzesicka, A., Samborski, W., Paprocka-Borowicz, M.
Evidence-based Complementary and Alternative Medicine, 2017/12
Free full text

514

Landmark Article Transforms Traditional View of the Autonomic Nervous System
Amen, C. J.
The Journal of the American Osteopathic Association, 2017/12
Free full text

515

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12


517

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text

518

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10


520

The effects of cervical sustained natural apophyseal glides on neck range of movement and sympathetic nervous system activity
Bowler, N., Browning, P., Lascurain-Aguirrebeña, I.
International Journal of Osteopathic Medicine, 2017/09/01/

521

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

522

Effects of Cervical High-Velocity Low-Amplitude Techniques on Range of Motion, Strength Performance, and Cardiovascular Outcomes: A Review
Galindez-Ibarbengoetxea, X., Setuain, I., Andersen, L. L., Ramírez-Velez, R., González-Izal, M., Jauregi, A., Izquierdo, M.
The Journal of Alternative and Complementary Medicine, 2017/09

523

Systematic review and meta-analyses of the difference between the spinal level of the palpated and imaged iliac crests
Cooperstein, R., Truong, F.
The Journal of the Canadian Chiropractic Association, 2017/09
Free full text

524

Diagnostic reliability of osteopathic tests: A systematic review
Basile, F., Scionti, R., Petracca, M.
International Journal of Osteopathic Medicine, 2017/08






530

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text

531

Clinical classification in low back pain: best-evidence diagnostic rules based on systematic reviews
Petersen, T., Laslett, M., Juhl, C.
BMC Musculoskeletal Disorders, 2017/05
Free full text

532

Association of Spinal Manipulative Therapy With Clinical Benefit and Harm for Acute Low Back Pain: Systematic Review and Meta-analysis
Paige, N. M., Miake-Lye, I. M., Booth, M. S., Beroes, J. M., Mardian, A. S., Dougherty, P., Branson, R., Tang, B., Morton, S. C., Shekelle, P. G.
JAMA, 2017/04
Free full text

533

A efetividade do tratamento osteopático na constipação intestinal: uma revisão sistemática
(Effectiveness of the ostheopatic treatment in intestinal constipation: A systematic review)
Rocha Do Vale, J., De Carvalho, H. F. B., Andrade, V. L. Â, Almeida, L. C.
GED - Gastrenterologia Endoscopia Digestiva, 2017/04

534

Biological effects of direct and indirect manipulation of the fascial system. Narrative review
Parravicini, G., Bergna, A.
Journal of Bodywork and Movement Therapies, 2017/04

535


536

Osteopathy for primary headache patients: a systematic review
Cerritelli, F., Lacorte, E., Ruffini, N., Vanacore, N.
Journal of Pain Research, 2017/03
Free full text

537

Técnicas de terapia manual en el impingement del hombro
(Manual therapy techniques for shoulder impingement)
Calero Pérez, C. A., Rodríguez Blanco, C.
European Journal Osteopathy & Related Clinical Research, 2017/03
Free full text

538

La maniobra hemodinámica abdominal modificada
(The Modified Abdominal Hemodynamic Maneuver)
San Segundo Riesco, R., Palomeque del Cerro, L.
European Journal Osteopathy & Related Clinical Research, 2017/03
Free full text


540

Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/02



543

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text


545

Effects of osteopathic manipulative treatment on hand function, disease symptoms and functional status in systemic sclerosis: a series of single-case studies in working women
O'Connor, S., Durand, M. J., Hudson, M., Baron, M., Gaudreault, N.
International Journal of Osteopathic Medicine, 2016/12


547

T4 syndrome – A distinct theoretical concept or elusive clinical entity? A case report
Hirai, P. M., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2016/10

548

Osteopathic manipulative treatment in neurological diseases: Systematic review of the literature
Cerritelli, F., Ruffini, N., Lacorte, E., Vanacore, N.
Journal of the Neurological Sciences, 2016/10

549

Manual Therapy in the Treatment of Idiopathic Scoliosis. Analysis of Current Knowledge
Czaprowski, D.
Ortopedia, Traumatologia, Rehabilitacja, 2016/10
Free full text


551

The potential of osteopathic manipulative treatment in antimicrobial stewardship: A narrative review
Noll, D. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

552

The effectiveness of complementary manual therapies for pregnancy-related back and pelvic pain A systematic review with meta-analysis
Hall, H., Cramer, H., Sundberg, T., Ward, L., Adams, J., Moore, C., Sibbritt, D., Lauche, R.
Medicine (Baltimore), 2016/08
Free full text

553

The paradox of sham therapy and placebo effect in osteopathy: A systematic review
Cerritelli, F., Verzella, M., Cicchitti, L., D', Alessandro, G., Vanacore, N.
Medicine (Baltimore), 2016/08
Free full text



556

(The polyvagal theory in osteopathy)
Porges, S. W., Liem, T.
Osteopathische Medizin, 2016/06


558

Muscle energy technique for non-specific low-back pain. A Cochrane systematic review
Franke, H., Fryer, G., Ostelo, R. W. J. G., Kamper, S. J.
International Journal of Osteopathic Medicine, 2016/06

559

Osteopathic manipulative treatment in gynecology and obstetrics: A systematic review
Ruffini, N., D'Alessandro, G., Cardinali, L., Frondaroli, F., Cerritelli, F.
Complementary Therapies in Clinical Practice, 2016/06


561

Landmark Article Supports Osteopathic Medicine? Setting the Record Straight
Heemstra, V. L.
The Journal of the American Osteopathic Association, 2016/04
Free full text

562

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text

563

Patienteninfo: Schilddrüsenunterfunktion
(Patient information: Hypothyroidism)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

564

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

565

The Glymphatic-Lymphatic Continuum: Opportunities for Osteopathic Manipulative Medicine
Hitscherich, K., Smith, K., Cuoco, J. A., Ruvolo, K. E., Mancini, J. D., Leheste, J. R., Torres, G.
The Journal of the American Osteopathic Association, 2016/03
Free full text

566

Die Polyvagal-Theorie
(The Polyvagal Theory)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

567

Effects of pressure applied during standardized spinal mobilizations on peripheral skin blood flow: A randomised cross-over study
Zegarra-Parodi, R., Pazdernik, V. K., Roustit, M., Park, P. Y., Degenhardt, B. F.
Manual therapy, 2016/02


569

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01


571

Osteopathic manipulative treatment for chronic nonspecific neck pain: A systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
International Journal of Osteopathic Medicine, 2015/12


573

Landmark Article Supports Osteopathic Medicine
Hoegerl, C.
The Journal of the American Osteopathic Association, 2015/11
Free full text

574

Serious Adverse Events and Spinal Manipulative Therapy of the Low Back Region: A Systematic Review of Cases
Hebert, J. J., Stomski, N. J., French, S. D., Rubinstein, S. M.
Journal of Manipulative and Physiological Therapeutics, 2015/11

575

Adverse Events Due to Chiropractic and Other Manual Therapies for Infants and Children: A Review of the Literature
Todd, A. J., Carroll, M. T., Robinson, A., Mitchell, E. K. L.
Journal of Manipulative and Physiological Therapeutics, 2015/11

576

2015 Updated Method Guideline for Systematic Reviews in the Cochrane Back and Neck Group
Furlan, A. D., Malmivaara, A., Chou, R., Maher, C. G., Deyo, R. A., Schoene, M., Bronfort, G., van Tulder, M. W.
Spine (Phila Pa 1976), 2015/11

577

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text


579

Understanding Fibroblasts in Order to Comprehend the Osteopathic Treatment of the Fascia
Bordoni, B., Zanier, E.
Evidence-based Complementary and Alternative Medicine, 2015/09
Free full text



582

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text

583

Colic in infants
Lucassen, P.
BMJ Clinical Evidence, 2015/08
Free full text


585

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07


587

Role of osteopathic manipulative treatment in the management of stiff person syndrome
Rajaii, R. M., Cox, G. J., Schneider, R. P.
The Journal of the American Osteopathic Association, 2015/06
Free full text

588

Effects of the Fourth Ventricle Compression in the Regulation of the Autonomic Nervous System: A Randomized Control Trial
Cardoso-de-Mello-e-Mello-Ribeiro, A. P., Rodríguez-Blanco, C., Riquelme-Agulló, I., Heredia-Rizo, A. M., Ricard, F., Oliva-Pascual-Vaca, Á.
Evidence-Based Complementary and Alternative Medicine, 2015/06
Free full text


590

Kritische Betrachtung einer Besprechung
(Critical consideration of a critique)
Franke, H., Franke, J.D., Fryer, G.
Manuelle Medizin, 2015/05

591

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

592

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

593

A systematic review found no consistent difference in effect between more and less intensive placebo interventions
Fassler, M., Meissner, K., Kleijnen, J., Hrobjartsson, A., Linde, K.
Journal of Clinical Epidemiology, 2015/04

594

Assessment of skin blood flow following spinal manual therapy: a systematic review
Zegarra-Parodi, R., Park, P. Y., Heath, D. M., Makin, I. R., Degenhardt, B. F., Roustit, M.
Manual Therapy, 2015/04

595

A systematic review of service-learning in medical education: 1998-2012
Stewart, T., Wubbena, Z. C.
Teaching and Learning in Medicine, 2015/04


597

Chronic inflammatory disease and osteopathy: a systematic review
Cicchitti, L., Martelli, M., Cerritelli, F.
PLoS One, 2015/03
Free full text



600

Muscle energy technique for non-specific low-back pain
Franke, H., Fryer, G., Ostelo, R. W., Kamper, S. J.
Cochrane Database of Systematic Reviews, 2015/02


602

Laser Doppler Flowmetry in Manual Medicine Research
Zegarra-Parodi, R., Snider, E. J., Park, P. Y. S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/12
Free full text



605

Effect of myofascial techniques applied to the cranial region on autonomic Nervous System analyzed by Heart Rate Variability
Cantalino, J. L. R., Salgado, A. S. I., Santos, I. R., Oliveira, L. V. F., Oliveira, C. S., Ferreira, L. A. B., Da Silveira, N. J. F., Costa, M. S.
Manual Therapy, Posturology & Rehabilitation Journal, 2014/11
Free full text




609

Osteopathic manipulative treatment for nonspecific low back pain: a systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
BMC Musculoskeletal Disorders, 2014/08
Free full text


611

A systematic review investigating the effectiveness of Complementary and Alternative Medicine (CAM) for the management of low back and/or pelvic pain (LBPP) in pregnancy
Close, C., Sinclair, M., Liddle, S. D., Madden, E., McCullough, J. E., Hughes, C.
Journal of Advanced Nursing, 2014/08
Free full text


613

Cost-effectiveness of manual therapy for the management of musculoskeletal conditions: a systematic review and narrative synthesis of evidence from randomized controlled trials
Tsertsvadze, A., Clar, C., Court, R., Clarke, A., Mistry, H., Sutcliffe, P.
Journal of Manipulative and Physiological Therapeutics, 2014/07
Free full text


615

Effectiveness of osteopathic manipulative therapy for managing symptoms of irritable bowel syndrome: a systematic review
Muller, A., Franke, H., Resch, K.L., Fryer, G.
The Journal of the American Osteopathic Association, 2014/06


617

Somatic dysfunction and use of osteopathic manual treatment techniques during ambulatory medical care visits: a CONCORD-PBRN study
Licciardone, J. C., Kearns, C. M., King, H. H., Seffinger, M. A., Crow, W. T., Zajac, P., Devine, W. H., Abu-Sbaih, R. Y., Miller, S. J., Berkowitz, M. R., Dyer, R., Heath, D. M., Treffer, K. D., Nevins, N. A., Aryal, S.
The Journal of the American Osteopathic Association, 2014/05
Free full text

618

Strain counterstrain technique to decrease tender point palpation pain compared to control conditions: a systematic review with meta-analysis
Wong, C. K., Abraham, T., Karimi, P., Ow-Wing, C.
Journal of Bodywork and Movement Therapies, 2014/04

619

Besserung der Symptome bei Multipler Sklerose
(Improvement of symptoms in multiple sclerosis)
Butenschön, W.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04


621

Clinical effectiveness of manual therapy for the management of musculoskeletal and non-musculoskeletal conditions: systematic review and update of UK evidence report
Clar, C., Tsertsvadze, A., Court, R., Hundt, G. L., Clarke, A., Sutcliffe, P.
Chiropractic & Manual Therapies, 2014/03
Free full text

622

Systematic review of the Hawthorne effect: new concepts are needed to study research participation effects
McCambridge, J., Witton, J., Elbourne, D. R.
Journal of Clinical Epidemiology, 2014/03
Free full text

623

Vestibular dysfunction in patients with chronic pain or underlying neurologic disorders
Gilbert, J. W., Vogt, M., Windsor, R. E., Mick, G. E., Richardson, G. B., Storey, B. B., Herder, S. L., Ledford, S., Abrams, D. A., Theobald, M. K., Cunningham, D., Kelly, L., Herring, K. V., Maddox, M. L.
The Journal of the American Osteopathic Association, 2014/03
Free full text

624

Lymphatic Pump Treatment Repeatedly Enhances the Lymphatic and Immune Systems
Schander, A., Padro, D., King, H. H., Downey, H. F., Hodge, L. M.
Lymphatic Research and Biology, 2013/12


626

Prevalence of visits to five types of complementary and alternative medicine practitioners by the general population: a systematic review
Cooper, K. L., Harris, P. E., Relton, C., Thomas, K. J.
Complementary Therapies in Clinical Practice, 2013/11

627

Is manipulative therapy more effective than sham manipulation in adults : a systematic review and meta-analysis
Scholten-Peeters, G. G., Thoomes, E., Konings, S., Beijer, M., Verkerk, K., Koes, B. W., Verhagen, A. P.
Chiropractic & Manual Therapies, 2013/10
Free full text

628

Patients' appraisals of public and private healthcare: a qualitative study of physiotherapy and osteopathy
Bradbury, K. J., Bishop, F. L., Yardley, L., Lewith, G.
Journal of Health Psychology, 2013/10




632

Thoracic and abdominal lymphatic pump techniques inhibit the growth of S. pneumoniae bacteria in the lungs of rats
Creasy, C., Schander, A., Orlowski, A., Hodge, L. M.
Lymphatic Research and Biology, 2013/09
Free full text

633

Interventions for preventing and treating pelvic and back pain in pregnancy
Pennick, V., Liddle, S. D.
Cochrane Database of Systematic Reviews, 2013/08
Free full text

634

Demonstration of Increased Vascular Characteristics Using Bilateral, Multiparameter Sensors After Controlled Vertebral Osteopathic Manipulative Treatment
Heath, D. M., Makin, I. R. S., Pedapati, C., Mast, T. D.
The Journal of the American Osteopathic Association, 2013/08

635

Peripheral Skin Blood Flow Changes After Different Controlled Cervical Osteopathic Mobilizations: A Pilot Study
Zegarra Parodi, R., Kvam, V., Park, P., Shurtz, N. R., Webb, S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/08


637

Osteopathic manipulative treatment for pediatric conditions: a systematic review
Posadzki, P., Lee, M. S., Ernst, E.
Pediatrics, 2013/07

638

Efficacy of osteopathy and other manual treatment approaches for malocclusion – A systematic review of evidence
Andresen, T., Bahr, C., Ciranna-Raab, C.
International Journal of Osteopathic Medicine, 2013/06

639

Upper cervical manual techniques and measures of autonomic nervous system control
Chippendale, E.
International Journal of Osteopathic Medicine, 2013/06

640

Item development for a questionnaire investigating patient self reported perception, satisfaction and outcomes of a single osteopathy in the cranial field (OCF) treatment
Mulcahy, J., Vaughan, B., Boadle, J., Klas, D., Rickson, C., Woodman, L.
International Journal of Osteopathic Medicine, 2013/06

641

Complementary and alternative medicine for pediatric otitis media
Levi, J. R., Brody, R. M., McKee-Cole, K., Pribitkin, E., O'Reilly, R.
International Journal of Pediatric Otorhinolaryngology, 2013/06

642

Osteopathic intervention in chronic non-specific low back pain: a systematic review
Orrock, P. J., Myers, S. P.
BMC Musculoskeletal Disorders, 2013/04
Free full text

643

Bibliometric measures and National Institutes of Health funding at COMs, 2006-2010
Gugliucci, A.
The Journal of the American Osteopathic Association, 2013/04
Free full text


645

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text

646

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text

647

Headache in children: update on complementary treatments
Schetzek, S., Heinen, F., Kruse, S., Borggraefe, I., Bonfert, M., Gaul, C., Gottschling, S., Ebinger, F.
Neuropediatrics, 2013/02
Free full text


649

Osteopathic manipulative treatment (OMT) for lower urinary tract symptoms (LUTS) in women
Franke, H., Hoesele, K.
Journal of Bodywork and Movement Therapies, 2013/01


651

Manual therapy for childhood respiratory disease: a systematic review
Pepino, V. C., Ribeiro, J. D., Ribeiro, M. A., de Noronha, M., Mezzacappa, M. A., Schivinski, C. I.
Journal of Manipulative and Physiological Therapeutics, 2013/01

652

Manual therapy for chronic obstructive airways disease: a systematic review of current evidence
Heneghan, N. R., Adab, P., Balanos, G. M., Jordan, R. E.
Manual Therapy, 2012/12
Free full text

653

A systematic review to evaluate the clinical benefits of craniosacral therapy
Jäkel, A., von Hauenschild, P.
Complementary Therapies in Medicine, 2012/12

654

Craniosacral therapy: a systematic review of the clinical evidence
Ernst, E.
Focus on Alternative and Complementary Therapies, 2012/12



657

Vertebral and internal carotid artery flow during vascular premanipulative testing using duplex Doppler ultrasound measurements: A systematic review
Malo-Urriés, M., Tricás-Moreno, J. M., Lucha-López, O., Estébanez-de-Miguel, E., Hidalgo-García, C., Pérez-Guillén, S.
International Journal of Osteopathic Medicine, 2012/09

658

Spinal manipulations for tension-type headaches: A systematic review of randomized controlled trials
Posadzki, P., Ernst, E.
Complementary Therapies in Medicine, 2012/08

659

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text

660

Quels traitements pour les coliques du nourrisson?
(Which treatments for infantile colics?)
Bruyas-Bertholon, V., Lachaux, A., Dubois, J.P., Fourneret, P., Letrilliart, L.
La Presse Médicale, 2012/07-08

661

The use of spinal manipulative therapy for pediatric health conditions: a systematic review of the literature
Gleberzon, B. J., Arts, J., Mei, A., McManus, E. L.
The Journal of the Canadian Chiropractic Association, 2012/06
Free full text


663

Selected fascial aspects of osteopathic practice
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2012/03
Free full text

664

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03


666

Effect of OMT on Heart Rate in Normotensive and Prehypertensive Individuals
Siu, V. N., Cooper, A., Rezk, M., Terzella, M., Yao, S. C., Gilliar, W.
The Journal of the American Osteopathic Association, 2012/01

667

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text

668

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text

669

Lymphatic pump treatment enhances the lymphatic and immune systems
Hodge, L. M., Downey, H. F.
Experimental Biology and Medicine (Maywood, N.J.), 2011/10

670

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text




674

Spinal manipulation: an update of a systematic review of systematic reviews
Posadzki, P., Ernst, E.
The New Zealand Medical Journal, 2011/08


676

Lymphstau im linken Bein
(Lymphatic congestion in the left leg)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07

677


678

Lymphsystem und osteopathische Forschung
(Lymphatic system and osteopathic research)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07


680

Spinal manipulations for cervicogenic headaches: a systematic review of randomized clinical trials
Posadzki, P., Ernst, E.
Headache: The Journal of Head and Face Pain, 2011/06





685

Is a postural-structural-biomechanical model, within manual therapies, viable?: A JBMT debate
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04

686

A rich seam
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04

687

Invited response: (without science, there must be art)
Hannon, J. C.
Journal of Bodywork and Movement Therapies, 2011/04

688

Invited response (the postural structural model, with boundary conditions)
Irvin, R. E.
Journal of Bodywork and Movement Therapies, 2011/04


690

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04

691

Invited response
McGill, S.
Journal of Bodywork and Movement Therapies, 2011/04


693

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03

694

Osteopathy for musculoskeletal pain patients: a systematic review of randomized controlled trials
Posadzki, P., Ernst, E.
Clinical Rheumatology, 2011/02
Free full text

695

Salivary α-Amylase as a Biomarker of the Response to Rib Raising: A Crossover Study
Kopanczyk, R., Lickliter, J., Henderson, A. T., Fisher, J. F., Li, T. S., Bridges, K. G.
The Journal of the American Osteopathic Association, 2011/01



698

Osteopathic Treatment for Irritable Bowel Syndrome. A Systematic Review.
Müller, A.
Unpublished MSc thesis, 2011
Free full text







705

Effects of rib raising on the autonomic nervous system: a pilot study using noninvasive biomarkers
Magoun Jr., H. I.
The Journal of the American Osteopathic Association, 2010/10
Free full text

706

Adverse events associated with the use of cervical manipulation and mobilization for the treatment of neck pain in adults: a systematic review
Carlesso, L. C., Gross, A. R., Santaguida, P. L., Burnie, S., Voth, S., Sadi, J.
Manual Therapy, 2010/10
Free full text

707

Tensegrity in der Osteopathie
(Tensegrity in osteopathy)
Pflüger, C.
Osteopathische Medizin, 2010/09


709

Adverse events and manual therapy: A systematic review
Carnes, D., Mars, T. S., Mullinger, B., Froud, R., Underwood, M.
Manual Therapy, 2010/08

710

Differential Effects of Suboccipital Inhibition and Fourth Ventricle Compression On Heart Rate Variability: Evidence For Bi-Directional Modulation Of Autonomic Tone
Snider, E. J., Snider, K. T., Halma, K. D., Fossum, C., Fryer, G., Yang, Q., Mueller, G., Bluml, E. M., Purcell, E.
The Journal of the American Osteopathic Association, 2010/08

711

Mindfulness meditation practise as a healthcare intervention: A systematic review
Mars, T. S., Abbey, H.
International Journal of Osteopathic Medicine, 2010/06

712

Osteopathic manual therapy versus conventional conservative therapy in the treatment of temporomandibular disorders: a randomized controlled trial
Cuccia, A. M., Caradonna, C., Annunziata, V., Caradonna, D.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text

713

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04


715

Effectiveness of manual therapies in the UK
Bronfort, G., Haas, M., Evans, R., Leininger, B., Triano, J.
Chiropractic & Osteopathy, 2010/02
Free full text

716

Osteopathic Treatment of Female Incontinence
Hösele, K.
Unpublished MSc thesis, 2010
Free full text

717

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12

718

Feel, think, treat – A review of the German Osteopathic Congress Berlin Nov 20–23 2008
Donnelly, D.
International Journal of Osteopathic Medicine, 2009/12

719

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

720

The Development of a Rodent Model to Study the Effects of Lymphatic Pump Treatment on the Lymphatic and Immune System
Huff, J. B., Winterrowd, K., King, H. H., Hodge, L.
The Journal of the American Osteopathic Association, 2009/08

721

Lymphatic Pump Manipulation Mobilizes Inflammatory Mediators into Lymphatic Circulation
Huff, J. B., Schander, A., King, H. H., Downey, H. F., Hodge, L.
The Journal of the American Osteopathic Association, 2009/08

722

Headache (chronic tension-type)
Krishnan, A., Silver, N.
BMJ Clinical Evidence, 2009/07
Free full text

723

The three leaves of Glénard- An examination of a functional aspect
Wolke, N.
Unpublished MSc thesis, 2009/05
Free full text



726

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques
Noll, D. R.
The Journal of the American Osteopathic Association, 2009/03
Free full text

727

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03










737

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques: a pilot crossover trial
Rivers, W. E., Treffer, K. D., Glaros, A. G., Williams, C. L.
The Journal of the American Osteopathic Association, 2008/11
Free full text

738

Osteopathie bei chronischem Schmerz
(Osteopathy applied to chronic pain patients)
Deichmeier, A., von Fischern, F., Heinbücher, I.
Unpublished D.O. thesis, 2008/10


740

CV4 Alters Autonomic Balance During Paced Breathing
Ananyev, D. A., Rodriguez Jr., C., Mercado, R., Bagla, A., Seffinger, M., Wagner, E. J.
Journal of Osteopathic Medicine, 2008/08

741

Effect of OMT in the Treatment of Initial Vascular Wall Alteration
Cerritelli, F., Carinci, F., Barlafante, G., Pizzolorusso, G., Turi, P., Cozzolino, V., Renzetti, C., Pizzolorusso, F., Orlando, F.
The Journal of the American Osteopathic Association, 2008/08

742

Lymphatic Pump Treatment Mobilizes Leukocytes from the Gut Associated Lymphoid Tissue Into Thoracic Duct Lymph
Schander, A., Bearden, M. K., Huff, J. B., Williams Jr., A. J., Stoll, S. T., Simecka, J. W., King, H. H., Downey, H. F., Hodge, L.
The Journal of the American Osteopathic Association, 2008/08

743

Sistema estomatognático, osteopatía y postura
(The stomatognathic system, osteopathy and posture)
Oliva Pascual-Vaca, Á., Rodríguez Blanco, C.
Osteopatía Científica, 2008/08



746

The Cranial Plunger Theory
Burns, D. K.
The AAO Journal, 2008/06
Free full text


748

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text

749

Osteopathic manipulative treatment (OMT) effects on mandibular kinetics: kinesiographic study
Monaco, A., Cozzolino, V., Cattaneo, R., Cutilli, T., Spadaro, A.
European Journal of Paediatric Dentistry, 2008/03
Free full text

750

Die osteopathische Dysfunktion der Arterie
(Osteopathic Dysfunction of the Arteries)
Chauffour, P., Prat, E., Michaud, J.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02


752

Die Gleitfähigkeit subkutaner Strukturen beim Menschen – eine Einführung
(Introduction to the knowledge of subcutaneous sliding system in humans)
Guimberteau, J. C., Sentucy-Rigall, J., Panconi, B., Bouleau, R., Mouton, P., Bakhach, J.
Osteopathische Medizin, 2008/01

753

Fascia - key for stability, sensomotor function and symmetry
Geiger, A.
Unpublished MSc thesis, 2008/01
Free full text

754

Using the concept of ideomotor therapy in the treatment of a patient with chronic neck pain: A single system research design
McCarthy, S., Rickards, L. D., Lucas, N. P.
International Journal of Osteopathic Medicine, 2007/12






760

Reproducibility Assessment of the Response to CV4 as Measured by the Laser Doppler Flowmeter and Electrocardiogram
Guinn, K. K., Rodriguez, C., Bucheli, D., Alsip, R. L., Seffinger, M., Smith, M. L.
The Journal of the American Osteopathic Association, 2007/08

761

Abdominal Lymphatic Pump Treatment Increases Leukocyte Count and Flux in Thoracic Duct Lymph
Hodge, L., Bearden, M. K., King, H. H., Williams Jr., A. G., Simecka, J. W., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2007/08

762

Developing clinical guidelines for the physiotherapy management of whiplash associated disorder (WAD)
Mercer, C., Jackson, A., Moore, A.
International Journal of Osteopathic Medicine, 2007/06

763

Optimising the psychological benefits of osteopathy
Williams, N. H.
International Journal of Osteopathic Medicine, 2007/06



766

The Influence of osteopathy on the vegetative nervous system in chronic pain patients
Fürpaß, E.
Unpublished MSc thesis, 2007/03
Free full text


768

Back pain and the homoeostatic requirements of the spinal system
Brownhill, K.
International Journal of Osteopathic Medicine, 2007/03


770

Osteopathy. Sensing and Philosophy
Weber, K.H.
Unpublished MSc thesis, 2007/01
Free full text


772

Do any treatments work for irritable bowel syndrome?
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/12




776

Spinal manipulation in patients with disc herniation: A critical review of risk and benefit
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/09


778

CV-4 Induced Physiological Change as Measured by Transcutaneous Laser Doppler Flowmeter
Guinn, K. K., Seffinger, M.
The Journal of the American Osteopathic Association, 2006/08


780

Inhibitory Rib-Raising With Direct Sympathetic Nervous System Measurement
Kinzler, D. W., Siu, J., Smith, M.
The Journal of the American Osteopathic Association, 2006/08

781

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08

782

Das Ohr, Anatomie und Physiologie
(The Ear, Anatomy and Physiology)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

783

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05



786

Polymyalgia rheumatica
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

787

Still's concept of connective tissue: lost in “translation“?
Lee, R. P.
The Journal of the American Osteopathic Association, 2006/04
Free full text

788

A systematic review of systematic reviews of spinal manipulation
Ernst, E., Canter, P. H.
Journal of the Royal Society of Medicine, 2006/04
Free full text

789

Revisiting Castlio and Ferris-Swift's experiments testing the effects of splenic pump in normal individuals
Noll, D. R., Johnson, J. C.
International Journal of Osteopathic Medicine, 2005/12

790

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text

791

Manual techniques addressing the lymphatic system: origins and development
Chikly, B. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

792

(The Effectiveness of Muscle Energy Technique (MET). A systematic review)
Bergold-Meier, S., Franke, H.
Unpublished D.O. thesis, 2005/10

793

Systematic review of effects of manual therapy in infants with kinetic imbalance due to suboccipital strain (KISS) syndrome
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Journal of Manual and Manipulative Therapy, 2005/10

794

Cost-effective osteopathic manipulative medicine: a literature review of cost-effectiveness analyses for osteopathic manipulative treatment
Gamber, R., Holland, S., Russo, D. P., Cruser d, A., Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2005/10
Free full text




798

Lower Extremity Edema: A Case Report
DeLaughter, J. P., Gamber, R. G.
The AAO Journal, 2005/09
Free full text

799

The short term effect of atlanto-axial high velocity low amplitude manipulation with cavitation on Edge Light Pupil Cycle Time
Gosling, C. M. R., Kinross, T., Gibbons, P., Holmes, M.
International Journal of Osteopathic Medicine, 2005/09


801

Osteopathic manipulative treatment for low back pain: a systematic review and meta-analysis of randomized controlled trials
Licciardone, J. C., Brimhall, A. K., King, L. N.
BMC Musculoskeletal Disorders, 2005/08
Free full text

802

The Impact of OMM on the Management of Tension Cephalgia
Patel, A. M., Desai, G. J.
The Journal of the American Osteopathic Association, 2005/07


804

Das Kiefergelenk des Menschen
(The Human Jaw)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

805

Psychosocial factors in osteopathic practice: To what extent should they be assessed?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/06

806

Sources of bias in reviews of spinal manipulation for back pain
Canter, P. H., Ernst, E.
Wiener Klinische Wochenschrift, 2005/05


808

Okulomotorik. Was bewegt das Auge?
(Oculomotorics: What makes the eye move?)
Storr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04

809

Kudos on electronic-only COMLEX-USA
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text


811

Viszerosomatische Reflexe
(Viscerosomatic reflexes)
Friedman, H. D.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

812

Safety bei Untersuchung der Wirbelsäule
(Safety in the area of the spinal column)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01


814

Case Study: An Osteopathic Resolution of a Neurocardiogenic Syncope
Somoano, Y., Hagopian, S.
The AAO Journal, 2004/12
Free full text

815

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text


817

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09

818

Cranial Manipulation Induces Sequential Changes in Blood Flow Velocity on Demand
Nelson, K. E., Sergueef, N., Glonek, T.
The AAO Journal, 2004/09
Free full text



821

From the Archives: The Lymphatic System, Applied Anatomy
Millard, F. P.
The AAO Journal, 2004/03
Free full text

822


823

The effect of thoracic muscle energy technique on FVC and FEV measurements
McKenzie, C., Gosling, C.
Unpublished MSc thesis, 2004/01
Free full text

824

Lasting effects of atlanto-axial manipulation on edge light pupil cycle time
Olarenshaw, A.
Unpublished MSc thesis, 2004/01
Free full text

825

A review of the physiology of cranial osteopathy
Ferguson, A.
Journal of Osteopathic Medicine, 2003/10


827

Cranio-Sacral CV-4 Can Decrease Sleep Latency In Healthy Humans
Cutler, M. J., Holland, B. S., Gamber, R. G., Smith, M. L.
The Journal of the American Osteopathic Association, 2003/08

828

Osteopathic manipulative medicine in the treatment of hypertension: An alternative, conventional approach
Spiegel, A. J., Capobianco, J. D., Kruger, A., Spinner, W. D.
Heart Disease, 2003/07

829

Physiological Background of the Cranial Rhythmic Impulse and The Primary Respiratory Mechanism
Moskalenko, Y., Frymann, V., Kravchenko, T., Weinstein, G.
The AAO Journal, 2003/06
Free full text


831

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

832

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

833

Palm technology moves resident data recording into new dimension
Rosenthal, M. S., Wolford, R. W.
The Journal of the American Osteopathic Association, 2003/01
Free full text

834

The Primary Respiratory Mechanism
Nelson, K. E.
The AAO Journal, 2002/12
Free full text

835

The effect of cranial manipulation on the Traube-Hering-Mayer oscillation as measured by laser-Doppler flowmetry
Sergueef, N., Nelson, K. E., Glonek, T.
Alternative Therapies in Health and Medicine, 2002/11

836

Osteopathic perturbation and immune network compensation
Degabriele, R.
Journal of Osteopathic Medicine, 2002/10

837

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text

838

Cost Effectiveness of Osteopathic Medicine: A Systemic Review
Gamber, R. G., Holland, B. S., Russo, D. P.
The Journal of the American Osteopathic Association, 2002/08

839

Mechanisms and effects of spinal high-velocity, low-amplitude thrust manipulation: previous theories
Evans, D. W.
Journal of Manipulative and Physiological Therapeutics, 2002/05

840

The immune network and homeostasis
Degabriele, R.
Journal of Osteopathic Medicine, 2002/04



843

Reviews of the literature efficacy of spinal manipulation for chronic headache: A systematic review
Bronfort, G., Assendelft, W., Evans, R., Haas, M., Bouter, L. M.
Journal of Osteopathic Medicine, 2001/10

844

Comparison of effects of spinal manipulation and massage on motoneuron excitability
Dishman, J. D., Bulbulian, R.
Journal of Osteopathic Medicine, 2001/10

845

Leukemia immune changes following massage therapy
Field, T., Cullen, C., Diego, M., Hernandez-Reif, M., Sprinz, P., Beebe, K., Kissell, B., Bango-Sanchez, V.
Journal of Osteopathic Medicine, 2001/10

846

Short-term effects of cervical manipulation on edge light pupil cycle time: a pilot study
Gibbons, P., Gosling, C. M., Holmes, M.
Journal of Osteopathic Medicine, 2001/10



849

Cervical mobilisation: concurrent effects on pain, sympathetic nervous system activity and motor activity
Sterling, M., Jull, G., Wright, A.
Journal of Osteopathic Medicine, 2001/10

850

Pain and muscular responses to a neural tissue provocation test in the upper limb
van der Heide, B., Allison, G. T., Zusman, M.
Journal of Osteopathic Medicine, 2001/10


852

Efficacy of spinal manipulation for chronic headache: A systematic review
Bronfort, G.
Journal of Manipulative and Physiological Therapeutics, 2001/09

853

A Pilot Study Assessing Effects of OMT on Immune Changes Associated Wth Academic Stress
Joshi, B. P., Plotkin, B. J., Viselli, S. M.
The Journal of the American Osteopathic Association, 2001/09

854

Palpation of the lateral pterygoid region in TMD--where is the evidence?
Türp, J. C., Minagi, S.
Journal of Dentistry, 2001/09


856

A systematic review of workplace interventions to prevent low back pain
Maher, C. G.
Journal of Osteopathic Medicine, 2001/04

857

Acupuncture in headache: A critical review
Manias, P., Tagaris, G., Karageorgiou, K.
Journal of Osteopathic Medicine, 2001/04

858

Toward optimal health: The experts discuss fibromyalgia
Meisler, J. G., Clauw, D. J., Russell, I. J.
Journal of Osteopathic Medicine, 2001/04

859

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text


861

Influencing the vegetative nervous system through manipulation. 1945
Northup, G. W.
The Journal of the American Osteopathic Association, 2000/10
Free full text

862

The autonomic nervous system in osteopathic therapy. 1948
Waitley, D. D.
The Journal of the American Osteopathic Association, 2000/10
Free full text

863

Carpal tunnel syndrome: more than just a problem at the wrist
Ramey, K. A.
The AAO Journal, 2000/09
Free full text

864

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09

865

Viscero-somatic and somato-visceral spinal reflexes. 1907
Burns, L.
The Journal of the American Osteopathic Association, 2000/04
Free full text

866

Osteopathie - Die sanfte Chirotherapie
(Osteopathy - The gentle chirotherapy)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2000/04

867

Case Study of a 42-year-old patient with Systemic Lupus Erythematosus
Zucker, N.
The AAO Journal, 2000/03
Free full text

868

A systematic review of craniosacral therapy: Biological plausibility, assessment reliability and clinical effectiveness
Green, C., Martin, C. W., Bassett, K., Kazanjian, A.
Complementary Therapies in Medicine, 1999/12/01/


870

Standard osteopathic manipulative treatment acutely improves gait performance in patients with Parkinson's disease
Wells, M. R., Giantinoto, S., D'Agate, D., Areman, R. D., Fazzini, E. A., Dowling, D., Bosak, A.
Journal of Osteopathic Medicine, 1999/02
Free full text



873

Effect of lymphatic and splenic pump techniques on the antibody response to hepatitis B vaccine: a pilot study
Jackson, K. M., Steele, T. F., Dugan, E. P., Kukulka, G., Blue, W., Roberts, A.
Journal of Osteopathic Medicine, 1998/03

874

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02

875

Cycle-to-cycle variability attributed to the primary respiratory mechanism
Lockwood, M. D., Degenhardt, B. F.
Journal of Osteopathic Medicine, 1998/01

876

Comparing psychotic and affective disorders by musculoskeletal structural examination
Iwata, J. L., Rodos, J. J., Glonek, T., Habenicht, A. L.
Journal of Osteopathic Medicine, 1997/12
Free full text


878

Musculoskeletal examination needs to be a matter of habit
Richardson, M. E.
Journal of Osteopathic Medicine, 1997/06
Free full text


880

Chest pain and the role of somatic dysfunction
Wax, C. M., Abend, D. S., Pearson, P. H.
Journal of Osteopathic Medicine, 1997/06
Free full text

881

Update on osteopathic medical concepts and the lymphatic system
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 1996/02
Free full text

882

Nerve compression syndromes as models for research on osteopathic manipulative treatment
Luckenbill-Edds, L., Bechill, G. B.
The Journal of the American Osteopathic Association, 1995/05
Free full text

883

AAO Case History: Immune System
Wallace, E. M.
The AAO Journal, 1994/12
Free full text

884

Manual force, mechanically assisted articular chiropractic technique using long and/or short level contacts
Bergmann, T. F.
Journal of Manipulative and Physiological Therapeutics, 1993/01

885

Short lever, specific contact articular chiropractic technique
Bergmann, T. F.
Journal of Manipulative and Physiological Therapeutics, 1992/12

886

(Diseases of the autonomic nervous system. General aspect of symptomatology)
Takahashi, A., Hasegawa, Y., Kihara, M., Nakao, N.
Nihon Rinsho, 1992/04

 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends