Advanced search



 
 80% of the records
 
 20.0 % of the records
 
 57.8 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic detailingacademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute careacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute generalized exanthematous pustulosisacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadversityadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimers diseaseAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior scaleneanterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrographyarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipartate patellabipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringblistersbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood oxygen saturationblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasebone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous lesionsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabiliationcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive latencycognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecold therapycoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantscryotherapyCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic ketoacidosisdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary habitsdietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocoldisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug reactiondrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumdupilumabDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiogramselectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceendurance sportsenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophiliaeosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfaceface masksfacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial swellingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow rateflu testingfluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood attitudesfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaglund deformityhair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhand surgeryhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodialysishemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanicHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinstrumentationinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview selectioninterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintimate partner violenceintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTlead exposureleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukodermaleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelichen planus pigmentosus inversuslidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle scalenemiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular latencyneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnevus spilusnevus unius lateralisnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluonchocerciasisoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisonyxopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid usageopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatient-reported outcomespatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceived weightperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperichondritisperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cortical atrophyposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurigo nodularisprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesracismradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrashrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreaction timereactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff intervalrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsscent dogsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin rashskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysterilizationsternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective cognitive declinesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden cardiac deathsudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandswollen earsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic inertiatherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrial qualitytrialstriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract diseaseurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvancomycinvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

4788 results (please see below)  Sort:    
1

Strategies to prevent and manage running-related knee injuries: A systematic review of randomised controlled trials
Alexander, J., Johnston, R., Ezzat, A., Culvenor, A., Barton, C.
Journal of Science and Medicine in Sport, Nov 2022 2022-11-02
2

Syndrome des releveurs de l’anus, troubles fonctionnels intestinaux et anomalies articulaires du petit bassin, place du traitement ostéopathiqueLevator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment
(Levator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment)
Riot, F. M., Goudet, P., Mouraux, J. P., Cougard, P.
La Presse Medicale, Jul 31
3

ОСТЕОПАТИЯ КАК ИННОВАЦИОННЫЙ ВЕКТОР В ВОССТАНОВИТЕЛЬНОЙ И СПОРТИВНОЙ МЕДИЦИНЕ
Osteopathy as an innovative Approach to Rehabilitation and Sports Medicine
Vovkogon, A., Sankova, M., Nikolenko, V., Oganesyan, M., Gridin, L.
Human Sport Medicine, 23/08
Free full text
4

Osteopathic manipulative treatment, pain neuroscience education and clinical hypnosis as pain management interventions in chronic low back pain: a randomized sham-controlled feasibility pilot trial
Luchesi, G. L. S., da Silva, A. K. F., Chaves, T. C., Jassi, F. J.
Journal of Bodywork and Movement Therapies, 2026/06
5

Effect of osteopathic technique on respiratory parameters and pain in thoracic outlet syndrome
Elshinnawy, A. M., Eraky, Z. S., Abdallah, E. A., Elmasry, H. M., El-Samouly, H. M.
Journal of Bodywork and Movement Therapies, 2026/06
6

From guidelines to practice: collective learning through clinical audit of the IFOMPT cervical framework
Bailey, D., Fawkes, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2026/03
7

Kritische Einordnung einer Stellungnahme der Französischen Akademie für Medizin: Anlass ist die Pressemitteilung zur viszeralen und kranialen Osteopathie bei Neugeborenen seitens der Académie Nationale de Médecine
(Critical assessment of a statement by the French Academy of Medicine: The occasion is the press release on visceral and cranial osteopathy in newborns by the Académie Nationale de Médecine)
Eichhorn, V., Franke, H.
Osteopathische Medizin, 2026/03
8

Journal Club 2026 – 1
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2026/03
9

Placebo-Effekte in der Osteopathie und anderen manuellen Therapien – Teil 2: Bedeutung für die klinische Praxis, Ausbildung und Forschung
(Placebo effects in osteopathy and other manual therapies – Part 2: Significance for clinical practice, training, and research)
Hohenschurz-Schmidt, D., Liem, T.
Osteopathische Medizin, 2026/03
10

Ein osteopathischer Ansatz für den ganzen Körper: Kompensationsstrategien
(An osteopathic approach for the whole body: compensation strategies)
Jarvis, L.
Osteopathische Medizin, 2026/03
11

Wirksamkeit von Osteopathie und Übungsbehandlung bei Fehlbissen: Eine fallstudienbasierte Untersuchung
(Effectiveness of osteopathy and exercise therapy for malocclusion: A case study-based investigation)
Mach, T.
Osteopathische Medizin, 2026/03
12

Spezifische, kontextuelle und unspezifische Effekte in der Osteopathie
(Specific, contextual, and non-specific effects in osteopathy)
Tripodi, N., Lawton, A., Corcoran, D., Feehan, J.
Osteopathische Medizin, 2026/03
13

Osteopathic Manipulative Treatment as Supportive Care for a Pediatric Patient with a Cerebral Cavernous Malformation: A Case Study
Christian, A. B., Crull, C. J., Agnello, R. N., Motyka, T. M.
The AAO Journal, 2026/03
14

Osteopathic Manipulation to Increase Lactation Quantity: The OMILQ Study Protocol
Conaway, E. M., O'Donnell, A. E.
The AAO Journal, 2026/03
15

An Osteopathic Approach to Hereditary Angioedema Attacks with Predominant Gastrointestinal Features and Concomitant Back Pain: A Case Report
Rowane, M. J., Petro, J., Shilian, R., Rajan, J., Rowane, M. P, Hostoffer, R. W.
The AAO Journal, 2026/03
16

Unexpected Resolution of Chronic Hyposmia Following Osteopathic Manipulative Treatment Applied with Area of Greatest Restriction and Sequencing: A Case Report
Sandoval, A. P., Schneider, R. M.
The AAO Journal, 2026/03
17

Effects of osteopathic manipulative treatment on cardiovascular function: a systematic review and meta-analysis
Johnston, K., Chow, R., Rubinstein, M., Burtner, M., Hollander, S., Humm, A., Chen, L., DeArmond, M., Koshy-Chenthittayil, S., Hightower, C.
International Journal of Osteopathic Medicine, 2026/03
18

Immediate Effects of Osteopathic Manipulative Therapy on Thoracoabdominal Mobility, Respiratory Muscle Strength and Pulmonary Function in Healthy Men: Preliminary Crossover Trial
Zago, J., Rondinel, T., Urueña, B., Amatuzzi, F., Queiroz, R., Nascimento, L., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2026/03
19

Effect of osteopathic vs sham treatment and test-retest improvements on smooth pursuit eye movements
Wogue, R., Paire, A., Cornille, C., Pillevesse, I., Demoury, L., Gharmaoui, M., Paeye, C.
Complementary Therapies in Medicine, 2026/03
20

Resolution of Chemotherapy-Induced Intractable Hiccups Following Osteopathic Manipulative Treatment: A Case Report
Aluri, P. S. C., Ansari, A. Z., Jorden, J. L., Ahmed, F., Hafeez, S.
Cureus, 2026/02
Free full text
21

The effectiveness of osteopathic treatment in cervical whiplash: a randomized controlled trial
Larios-Ortega, J., Díaz-Acuña, A. M., Colón-Fraile, M. T., Rivera-Sequeiros, A., Albornoz-Cabello, M., Ruiz-Romero, M. V.
Journal of Osteopathic Medicine, 2026/02
Free full text
22

Pericardium-Focused Osteopathic Treatment in Chronic Cervicothoracic Pain Following Median Sternotomy for Cardiac Surgery
Shehadeh, H.
Cureus, 2026/02
Free full text
23

Chronic pain outcomes among patients treated by osteopathic vs. allopathic physicians: a 36-month follow-up study
Licciardone, J. C., Lewis, H., Dahl, K., Adams, B., Aryal, S.
Journal of Osteopathic Medicine, 2026/01
Free full text
24

Osteopathic Manipulative Treatment for Chronic Obstructive Pulmonary Disease: A Systematic Review
Ponce, A., Paek, K. H., Heintzelman, K.
Cureus, 2026/01
Free full text
25

Effects of a myofascial and lymphatic osteopathic manipulative treatment protocol on mood and body connection: a randomized pilot study
Levy, E. C., Jung, M.K.
Journal of Osteopathic Medicine, 2026/01
Free full text
26

Early osteopathic treatment delivered to patients with an acute lateral ankle sprain improves recovery: an investigative study
Bournon, C., Prin-Conti, D., Douay, J., Montfajon, P.A., Kanagaratnam, L., Gennai, S.
Journal of Osteopathic Medicine, 2026/01
Free full text
27

Osteopathic manipulative medicine among injured emergency department patients: a nationwide study
Harris, H., DiStefano, A., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2026/01
Free full text
28

Touch-based treatments and infantile colic - Parental perceptions of treatment outcomes related to infants' crying and sleeping
Hannula, L., Rinne, S., Väänänen, T., Aarva, P., Suvilehto, J., Kemppainen, T.
Journal of Pediatric Nursing, 2026/01
Free full text
29

Osteopathic manipulative treatment for enhanced pitch performance in collegiate baseball players: a feasibility study on shoulder and hip interventions
Rosten, C., Brown, S., Nandedkar, T., Pearson, A., Worthington, E., Fastring, D.
Journal of Osteopathic Medicine, 2026/01
Free full text
30

Osteopathic manipulative treatment as a complementary and integrative approach to mitigate stress, anxiety, and depression: A systematic review
Lorenz, N., Mathur, M., Saleem, N., Penn, A., Boesler, D., Bishayee, A.
Explore, 2026/01
31

Einfluss der osteopathischen Behandlung auf das Verdauungssystem von Säuglingen
(Influence of osteopathic treatment on the digestive system of infants)
Pernikar, N.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
32

Wann kann man ein Ausfallhonorar berechnen?
(When can you charge a cancellation fee?)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
33

The possibility of using osteopathic correction in combination with psychotherapeutic techniques in the treatment of tension headaches
(Возможность применения остеопатической коррекции в сочетании с психотерапевтическими техниками в терапии головной боли напряжения)
Rozhdestvenskiy, V. A., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/12
34

Results of manual treatment methods for functional disorders of the digestive system and problems associated with breastfeeding in children of the first year of life
(Результаты мануальных методов лечения при функциональных расстройствах органов пищеварения и проблемах, связанных с грудным вскармливанием, у детей первого года жизни)
Ulitina, N. G., Mokhova, E. S., Tregubova, E. S., Potekhina, Y. P.
Russian Osteopathic Journal, 2025/12
35

The influence of osteopathic correction on the functional activity of the palatine tonsils in the complex therapy of chronic tonsillitis
(Влияние остеопатической коррекции на функциональную активность нёбных миндалин в комплексной терапии хронического тонзиллита)
Vedyashkina, A. S., Mokhov, D. E., Dmitrieva, I. A.
Russian Osteopathic Journal, 2025/12
36

A Prospective Observational Cohort Study of a Standardized Osteopathic Maneuver for Chest Pain Relief
Gianneschi, G. B., Patel, S., Hinfey, P.
International Journal of Osteopathic Medicine, 2025/12
Free full text
37

Effect of osteopathic manipulative treatment on primary pelvic pain - A systematic review with meta-analysis
Parada, J. G., da Silva, E. B., Fernandes, A. P., Portugal, G. B.
International Journal of Osteopathic Medicine, 2025/12
38

Osteopathic manipulative treatment for management of feeding dysfunction in breastfed newborns
Fons, D., Watts, K. B., Vannitamby, H., Rainey, S., Ford-Davis, J., Wang, Y., Van Heukelom, S., Wright, A.
Journal of Osteopathic Medicine, 2025/12
Free full text
39

Clinically significant lung function improvement for collegiate soccer players after OMT with restrictive ribcage motion correlated with Expanded Zink screen
Leung, D. Y., Stiles, E. G.
Journal of Osteopathic Medicine, 2025/12
Free full text
40

Associations in fetal outcomes from cesarean sections with maternal comorbidities: a cross-sectional study of the Pregnancy Risk Assessment Monitoring System
Enmeier, M., Stephenson, E., Prince, J., Markey, C., Phung, B., Hartwell, M.
Journal of Osteopathic Medicine, 2025/12
Free full text
41

A Cross-Sectional Study of Biopsychosocial Factors Associated with Utilization of Osteopathic Manipulative Treatment Among US Adults
Agostini, K., Manzaro, A., Helms, M., Bringhurst, M., Gish, E., Motyka, T.
Journal of Osteopathic Medicine, 2025/12
42

Evaluating the Accuracy and Educational Utility of ChatGPT in Osteopathic Manipulative Medicine (OMM) and Treatment (OMT): A Cross-Sectional Performance Study
Babar, M., Arain, A., Jordan, R., Badeuax, M., Voth, S.
Journal of Osteopathic Medicine, 2025/12
43

Osteopathic Manipulative Treatment for Trauma as Adjunct for Pain and Mobility Limitations after Chest Wall Injury
Baltazar, G. A., Lopez, N., Beaulieu, D., Arrillaga, A., Ripley, D., Ippolito, M., Machado, F., Rubano, J.
Journal of Osteopathic Medicine, 2025/12
44

Utilizing Osteopathic Manipulative Technique to Alleviate Restriction at the Hip from the Tibio-Fibular Joint
Barros, M., Fotopoulos, T. J., Kochno, T., Bennett, A., Salehi, J., Tehrani, N.
Journal of Osteopathic Medicine, 2025/12
45

General Osteopathic Treatment: Status quo – Teil 2
(General Osteopathic Treatment: Status Quo – Part 2)
Engel, M.
Osteopathische Medizin, 2025/12
46

Comparative Efficacy of Anesthesia Versus Osteopathic Manipulative Treatment for Pain Outcomes in Postpartum Women: A Systematic Review and Meta-Analysis
Belli, J., Ramaraju, R., Myers, N.
Journal of Osteopathic Medicine, 2025/12
47

Geschichte des osteopathischen Ansatzes für den ganzen Körper
(History of the osteopathic approach to the whole body)
Jarvis, L.
Osteopathische Medizin, 2025/12
48

Prämenstruelle Beschwerden: Mögliche Auswirkungen auf das PMS durch eine lymphspezifische osteopathische Techniksequenz – eine randomisiert-kontrollierte Pilotstudie
(Premenstrual symptoms: Potential effects on PMS of a lymph-specific osteopathic technique sequence – a randomized controlled pilot study)
König, A.
Osteopathische Medizin, 2025/12
49

Effects of Lymphatic Pump Treatment and Methotrexate in Arthritis Development and Behavior in Rats with Adjuvant-Induced Arthritis
Kafkis, C., Tamane, S., Manuel, M. J., Zanotti, B., Del Toro, R. M., Incrocci, R., Swanson-Mungerson, M., Volin, M. V.
Journal of Osteopathic Medicine, 2025/12
50

Bridging Communication Gaps: Exploring Medical Students’ Understanding and Experiences in Caring for Patients with Hearing Impairments and Language Barriers
Kim, A., Nolin, J. R., Bracy, H., Berko, H., Mazzorana, A., Leiber, K., Hernandez, E.
Journal of Osteopathic Medicine, 2025/12
51

Osteopathic Medical Students’ Perspectives on Osteopathic Manipulative Therapy during Third- Year Clerkships: A Cross-sectional Study of Three Osteopathic Medical Schools
Longley, S., Spears, E., Domingo, F. S., Kymes, E., Dixon, C., Weir, S.B.
Journal of Osteopathic Medicine, 2025/12
52

Evaluating Student Mental Health Resource Utilization and Self-Perceived Mental Health
Muppala, M. S., Sanapala, C., Shields, E., Kemp, E., Goldsteen, R., Tano, S., Grewal, P.
Journal of Osteopathic Medicine, 2025/12
53

Bridging the Gap: A Tri-campus Survey on Student Confidence in Applying OMT in Neurological Conditions
Nallanukala, G. S., Noto-Bell, L., Nallanukala, V.
Journal of Osteopathic Medicine, 2025/12
54

Osteopathic Manipulative Treatment (OMT) for Injury Prevention in Collegiate Baseball Pitchers: Findings and Revised Protocol from a Feasibility Study on Shoulder and Hip Interventions
Nandedkar, T.
Journal of Osteopathic Medicine, 2025/12
55

Pushing into the Barrier: Investigating the Use of OMM Among 3rd and 4th Year Medical Students
Pirzadeh, N., Dona, C. G., Valencia, R., Anche, G., Liang, W. M., Chen, D., Para, R., Volokitin, M.
Journal of Osteopathic Medicine, 2025/12
56

Hands-On Relief: A Pilot Study on the Use of Osteopathic Manipulative Treatment for Tension-Type Headaches
Santos, S. G., Lee, W., Doan, E., Rabiei, Y., Redding, D.
Journal of Osteopathic Medicine, 2025/12
57

Comprehensive structural analysis of piriformis muscle and sciatic nerve in cadavers: potential implications for piriformis syndrome and OMT
Shi, C., Kalagana, H., Ma, Y. T., Mehrhoff, F.
Journal of Osteopathic Medicine, 2025/12
58

Perceptions of Campus Climate and Inclusivity Among LGBTQIA+ Osteopathic Medical Students: A Cross-Sectional Study
Varin, P., Temucin, S., Reese, A., Florescu, N., Grace, C., Bettiker, R., Sonneville, K., Fiscus, V., Tanaka, L.A.
Journal of Osteopathic Medicine, 2025/12
59

Safety and Feasibility of Osteopathic Manipulative Treatment (OMT) in Addressing Plagiocephaly
Wolf, K. J., Martone, J., Varrasso, E., Belsky, J. A.
Journal of Osteopathic Medicine, 2025/12
60

Fascial Counterstrain: A methodological advancement in indirect osteopathic manipulation
Tuckey, B.
International Journal of Osteopathic Medicine, 2025/12
61

Response to Letter to the Editor “Repositioning Menstrual Pain Management: Multidisciplinary Collaboration and Cultural Sensitivity as Key Priorities” about the article “Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., & Arnal-Gómez, A. (2025). Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial. International Journal of Osteopathic Medicine, 56, 100761.”
Espí-López, G. V.
International Journal of Osteopathic Medicine, 2025/12
62

Ultrasound shear wave elastography to assess neck somatic dysfunction and OMT effects
Gao, J., Lynch, E., Coleman, M., Moore, J., Park, D., Wilde, B.
Journal of Osteopathic Medicine, 2025/12
Free full text
63

Efficacy of Osteopathic Manipulative Treatment for Postoperative Recovery Following Total Knee Arthroplasty: A Meta-Analysis of Randomized Controlled Trials
Oar, D. P., DeFrancisis, J. S., Boesler, D.
Cureus, 2025/12
Free full text
64

Associations of comorbidities, opioid use, and intimate partner violence, with urinary tract infections in pregnancy: implications for prevention and screening
Donatucci, K., Pathak, S., McPherson, K., Price, J., Hartwell, M.
Journal of Osteopathic Medicine, 2025/12
Free full text
65

Breathing retraining and manual therapy for long COVID – A literature review
Courtney, R., Steele, Z., Collyer, I.
International Journal of Osteopathic Medicine, 2025/12
Free full text
66

The outcome of a short course of osteopathy for older adults with chronic musculoskeletal (MSK) pain. A single-arm, prospective feasibility study
Orchard, D., Bolt, D., Pinna, T., Antoni-Pineda, G.
International Journal of Osteopathic Medicine, 2025/12
67

Gut-Brain Axis in Inflammatory Bowel Disease: Pathogenesis and Therapeutics
Perry, S., Pillarisetti, L., Gelfman, T., Agrawal, D. K.
Archives of Internal Medicine Research, 2025/12
Free full text
68

Assessing the Efficacy of Osteopathic Manipulative Therapy (OMT) in Managing Chronic Back Pain: A Narrative Review
Tu Zahra, H., Farheen, A., Farooq Bacha, Z., Anas Patni, M.
Dubai Medical Journal, 2025/12
69

Complementary health approach engagement of people with migraines in a nationally representative sample
Bond, A. D., Agostini, K., Motyka, T. M., Cappola, J. D., DiCristo, J. D., Heims, A. D.
Postgraduate Medicine, 2025/12
70

De-stress pain management: Assessing pain management care amongst primary care providers
Browder, B. H., Reynolds, C., Agnello, R.
Postgraduate Medicine, 2025/12
71

Association of neurovascular events with cervical manual therapy: A cohort study
Fraser, J. J., Lonnemann, E.
International Journal of Osteopathic Medicine, 2025/12
72

Reclaiming the body: The mental health imperative of embodied learning in physiotherapy education
Cahyono, B. D., Rahmawati, A., Aditya, R. S., Huda, N., Aristawati, E., Amalia, R., Kartikasari, D.
International Journal of Osteopathic Medicine, 2025/12
73

Response to the letter to the editor: Reclaiming the body: The mental health imperative of embodied learning in physiotherapy education
Eccott, L., Moulson, A., Atkinson, K., Livatino, S., Lewis, J., Cairns, M.
International Journal of Osteopathic Medicine, 2025/12
74

Osteopathic Manipulative Treatment Protocol for Postoperative Care Following Abdominal Surgery: A Quality Improvement Project
Genewick, J., Amendolara, A., Robinson, S., McDonough, M., Loera, M., Stacey, S. K.
Cureus, 2025/12
Free full text
75

Specific osteopathic diagnosis of unilateral knee pain in an elite sprinter: a case report
Mattatia, J., Leplat, A., Saiz, S.
International Journal of Osteopathic Medicine, 2025/12
76

Integrating Cranio-Cervical Neuromyofascial Continuity With Body-Wide Function in Kimmerle Anomaly: An Osteopathic Case Report
Pizzolorusso, G., Borraccia, V., Quaranta, C., D'Alessandro, G., Lunghi, C.
Cureus, 2025/12
Free full text
77

Osteopathic Manipulative Treatment Plus Phototherapy in the Management of Neonatal Hyperbilirubinemia: A Case Report
Zylinski, B. L., Stephenson, C. M., Rajala, J. W., Miller, D. J.
The AAO Journal, 2025/12
Free full text
78

Treatment of Temporomandibular Joint Pain and Dysfunction After a Motor Vehicle Accident Using an Osteopathic Approach: A Case Study
Schneider, N., Schneider, D., Sinnott, M., Kurian, A., Widboom, N., Qureshi, Y.
The AAO Journal, 2025/12
79

Neuropsychological indicators in patients with cervical dorsopathy and the influence of non-pharmacological treatment on them
(Нейропсихологические показатели у пациентов с дорсопатией шейного отдела позвоночника и влияние на них немедикаментозных методов лечения)
Belash, V. O., Mokhov, D. E.
Russian Osteopathic Journal, 2025/12
80

Osteopathic correction in complex treatment of patients with chronic pelvic pain syndrome
(Остеопатическая коррекция в комплексном лечении пациенток с синдромом хронической тазовой боли)
Manto, E. V., Nenashkina, E. N., Safiullina, A. A.
Russian Osteopathic Journal, 2025/12
81

Rationale for the use of osteopathic correction in the complex rehabilitation of chronic nonspecific low back pain in patients with postoperative scars on the anterior abdominal wall
(Обоснование применения остеопатической коррекции в комплексной реабилитации пациенток с послеоперационными рубцами на передней брюшной стенке и хронической неспецифической болью в нижней части спины)
Polismak, O. V., Potekhina, Y. P., Khatkevich, A. V., Paykov, A. Y.
Russian Osteopathic Journal, 2025/12
82

Manual therapy in preoperative preparation of patients with knee arthroplasty
(Мануальная терапия в предоперационной подготовке пациентов с эндопротезированием коленного сустава)
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/12
83

Clerkship Rotations Are a Key Driver of Family Medicine Choice: Insights from the 2024 National Resident Survey
Barr, W., Peterson, L. E., Fleischer, S., Bazemore, A.
Journal of the American Board of Family Medicine, 2025/11
Free full text
84

Osteopathic manipulative treatment improves mobility restrictions and statics in a patient with a pectus excavatum after a sternochondroplasty. A case report
Jeandey, K., Le Nohaïc, A., Solovei, L., Gourjon, G.
Explore, 2025/11
85

A swell case
Fill, L., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2025/11
Free full text
86

Identifying somatic and social concerns that may suggest an underlying mental health condition in pediatric primary care
Shubrook, C., Breneisen, K., Pottenger, M.
Journal of Osteopathic Medicine, 2025/11
Free full text
87

Cross-sectional Survey of the Evidence Implementation Environment of the Australian Chiropractic and Osteopathic Professions
Leach, M. J.
Journal of Manipulative and Physiological Therapeutics, 2025/11
88

Predictability of cranial base strains as related to birth presentation: a review of literature
McElwain, S. K., Schmidt, D.
Journal of Osteopathic Medicine, 2025/11
Free full text
89

The role of osteopathic manipulative medicine in cerebral palsy: bridging treatment gaps and enhancing care
Ngo, A. L., Gharavi Alkhansari, N., Tadakamalla, R., Hess, M., Nguyen, U. T., Yazji, J., Rogers, R. S.
Journal of Osteopathic Medicine, 2025/11
Free full text
90

Emergency department wait times in concordance with blood alcohol content and subsequent alcohol use disorder
Hayes, S., Mach, K., Briggs, J., Hartwell, M.
Journal of Osteopathic Medicine, 2025/11
Free full text
91

Osteopathic manipulative treatment in the management of headaches associated with musculoskeletal dysfunction: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Ying-Fang Wang, M., Johnston, R., Will, M., Gibson, E., Spencer, D., Garcia, C., Snider, K. T.
Journal of Osteopathic Medicine, 2025/11
Free full text
92

Osteopathie bei Transidentität - Eine Einzelfallstudie zum Einfluss auf Lebensqualität, Cortisolwerte und Wohlbefinden bei einem transgender Jugendlichen unter Hormontherapie
(Osteopathy in Transgender Identity - A Single-Case Study on the Impact on Quality of Life, Cortisol Levels, and Well-being in a Transgender Adolescent Undergoing Hormone Therapy)
Gugatschka, N.
Unpublished MSc thesis, 2025/11
93

Osteopathic manipulation to increase lactation quantity: a prospective case series
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2025/11
Free full text
94

Efficacy of Musculoskeletal Manipulation for Endoscopic Discomfort in Patients Undergoing Upper Gastrointestinal Endoscopy and Colonoscopy: A Systematic Review and Meta-Analysis
Kitamura, S., Komiya, S., Kaneko, T., Tsuge, T., Watanabe, J.
Cureus, 2025/11
Free full text
95

Use of osteopathic manipulation techniques for management of acute otitis media in pediatric patients: a scoping review
Kim, C. H.S., McCray, L. R., Nguyen, S. A., Shermetaro, C., Robbins, W. K.
European Archives of Oto-Rhino-Laryngology, 2025/11
Free full text
96

Osteopathische Behandlungsansätze bei gastrointestinalen Beschwerden
(Osteopathic treatment approaches for gastrointestinal complaints)
Leitner, S.
Unpublished MSc thesis, 2025/11
97

A preliminary study on the effect of quantified cranial osteopathic manipulation on wild-type and transgenic rat models of Alzheimer's disease
Hines, D., Tobey, H., Dugan, P., Boehringer, S., Helm, R., Anandakrishnan, R., Werre, S., VandeVord, P., Costa, B. M.
Journal of Alzheimer's Disease Reports, 2025/11
Free full text
98

Assessing fundamental clinical skills of osteopathic medical students
Boulet, J. R., Sandella, J. M., Gimpel, J., LaBaere, R.
Journal of Osteopathic Medicine, 2025/10
Free full text
99

Swelling and skin changes: an osteopathic approach to pediatric lymphedema management
Jackson, S., Hussaini, A., Galan, J., Chung, T. C., Javed, B.
Journal of Osteopathic Medicine, 2025/10
Free full text
100

Evaluating the acute effect of osteopathic manipulative treatment on sprint performance in young adults
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., McKinlay, K. J., Roush, A. J., Cosgrave, C.
Journal of Osteopathic Medicine, 2025/10
Free full text
101

Effectiveness of osteopathic manual treatment in the elderly population: a scoping review of clinical evidence
Molinari, L., Mingrone, L., Novelli, E.
Journal of Osteopathic Medicine, 2025/10
Free full text
102

Diaphragm’s Role as a Systems-Connector Muscle: A Narrative Review
Bordoni, B., Morabito, B., Escher, A. R.
Cureus, 2025/10
Free full text
103

Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Bethea, J., Sharma, H., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
Cureus, 2025/10
Free full text
104

Exploring the use of manual therapy in the management of traumatic brain injury: a scoping review
Delion, T., Noyer, A., Gonzalès-Bandrès, M., Treffel, L., Farrell, G., Cassoudesalle, H., Ménard, M.
Chiropractic and Manual Therapies, 2025/10
Free full text
105

Necrobiosis lipoidica arising in a port wine stain treated with topical ruxolitinib
Edupuganti, N., Nguyen, J., Siddiqui, F., Dukharan, V., Nathoo, R.
Journal of Osteopathic Medicine, 2025/10
Free full text
106

Cutaneous manifestations of Addison’s disease
Lu, C., Jacobs, D., Blannett, S., Kuryan, R. E., Swink, S. M.
Journal of Osteopathic Medicine, 2025/10
Free full text
107

Impact of touch interventions on brain activity in moderately preterm infants: study protocol for a pilot randomised controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., Tansini, L., Pisanu, D., Di Leo, D., Vergani, E., Righini, A., Arrigoni, F., Fanos, V., Rescigno, M., Veggiotti, P., Lista, G., Gazzolo, D.
BMJ Open, 2025/10
Free full text
108

Osteopathic manipulative treatment for refractory chronic traumatic pain and mobility restrictions at a level 1 trauma center
Baltazar, G. A., Cao, M., Van Vleet, J., Hart, S., Jakubowski, A., Suree, N., Petrone, P., Islam, S., Machado, F., Rubano, J.
Journal of Osteopathic Medicine, 2025/10
Free full text
109

Feed, Read, and Grow: An Observational Study on the Impact of Educational Videos About Pediatric Anxiety
Acors, E. L., Renner, B., Worrill, S., Bhagtani, H., Jaimes Ocazionez, S. N., Magalhaes, E. P.
Cureus, 2025/10
Free full text
110

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10
111

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10
112

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/10
Free full text
113

Soft tissue manipulation enhances recovery of muscle mass in a disuse model of sarcopenia
Mustaklem, B., Loghmani, M. T., Waterfill, A. K., Caron, M., Glore, D. A., Meyer, N. R., Shelton, L. D., Day, E.A., Marciano, C., Gepfert, A., Wakefield, C. C., Brown, H., Street, S., Sasse, M. M., Snyder, J., Hiland, T., Hum, J. M., Eland, D. C., Chu, T.M. G.
Journal of Osteopathic Medicine, 2025/10
Free full text
114

Jaw Functional Orthopedics and Osteopathic Approaches As Adjunctive Treatment for Idiopathic Scoliosis: A Case Report
Valério, P., Vasilyeva, M.
Cureus, 2025/10
115

Osteopathic Approaches in the Diagnosis and Treatment of Temporomandibular Joint Dysfunction: An Interdisciplinary Review
Makichyan, T., Frolov, V., Habadze, Z., Starodubtseva, E., Dolzhikov, N., Avetisian, G., Rasulova, D.
Georgian Medical News, 2025/10
Free full text
116

The Spinal Facilitation Hypothesis and Reflex Arcs in Modern Osteopathic Medicine
Bordoni, B., Simonelli, M., Morabito, B., Escher, A. R.
Cureus, 2025/09
Free full text
117

Osteopathische Behandlung bei akuter Tendovaginitis de Quervain
(Osteopathic treatment for acute De Quervain's tendovaginitis)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09
118

Corrigendum to: The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T.H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/09
Free full text
119

Liquorlymphatische Kopplung – eine neue Sicht auf die Entsorgungswege des ZNS
(Glymphatic-lymphatic coupling – A new perspective on the disposal pathways of the CNS)
Peuker, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09
120

Why don't more physicians use osteopathic manipulative medicine? A cross-sectional study of utilization and referral barriers
Stacey, S. K., Furlano, A., Genewick, J., Westfall, E., Gordon, B., Toor, J.
Journal of Osteopathic Medicine, 2025/09
Free full text
121

Osteopathic manipulative treatment in a patient with idiopathic scoliosis assessed by breathing pattern characterization using optoelectronic plethysmography and quality of life — a case report
Gaillard, L., Stubbe, L., Riquet, D., Houel, N.
Journal of Bodywork and Movement Therapies, 2025/09
Free full text
122

Medical student perceptions of psychiatric conditions and the impact of stigmatizing language
Monahan, Z., Stevens, V., Hartwell, M., Ford, A. I.
Journal of Osteopathic Medicine, 2025/09
Free full text
123

Exploring Manual Interventions for Infantile Colic: A Scoping Review of the Evidence
Tedeschi, R., Giorgi, F.
Children, 2025/09
Free full text
124

A review of osteopathic and related manipulative treatments for improving symptoms of gastrointestinal distress in neurological disorders
Peters, J., Runnels, G., Lauinger, A., Murphy, T., Griffith, A., Slicho, T.
International Journal of Osteopathic Medicine, 2025/09
125

Effect of the Spencer Technique on Glenohumeral Joint Range of Motion: A Comparative Analysis of Athletes Versus Non-athletes
Oar, D. P., Zarilla, A., DiSilvestro, D., Buchman, Z. J., Abouafech, A., Boesler, D.
Cureus, 2025/09
Free full text
126

Manual Therapy in Post-operative Knee Management: A Systematic Review of Effects on Pain in Total Knee Replacement (TKR) Patients
Sahni, S., Fares, J. E., Jordan, H.
Cureus, 2025/09
Free full text
127

Retrospective Study of Osteopathic Manipulative Treatment on Length of Stay and Opioid Use After Vestibular Schwannoma Resection
Chen, A. I., Golshan, S., Schwartz, M. S., Friedman, R. A.
Otology & Neurotology Open, 2025/09
128

The epidemiology of osteopathic diagnoses and treatments in United States emergency departments from 2018 to 2021
Distefano, A., Harris, H., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2025/09
Free full text
129

Osteopathic intervention for inflammatory conditions of the lactating breast: a case series
Engel, R., Willy, K., Fuller, E.
International Journal of Osteopathic Medicine, 2025/09
130

Potential impact of an osteopathic intervention for internationally adopted children with fetal alcohol spectrum disorder (FASD); a prospective case series
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., Aldecoa-Bilbao, V., García-Algar, Ó.
International Journal of Osteopathic Medicine, 2025/09
Free full text
131

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/09
132

The Rule of the Artery: Management of Peripheral Vascular Disease with Osteopathic Manipulative Treatment in a Low Resource Setting in Iquitos, Peru
Kamm, M.
Spartan Medical Research Journal, 2025/09
133

A Pediatrician’s Newest Tool: Osteopathic Manipulative Treatment in the Inpatient Setting
Khanafer, R., Holub-Ward, R., Wong, M., Hart, C., Pitman-Hunt, C.
Spartan Medical Research Journal, 2025/09
134

The Use of OMT in the Emergency Department: A Scoping Review
Nemes, P.
Spartan Medical Research Journal, 2025/09
135

The Emerging Role of Osteopathic Manipulative Medicine in Enhancing Quality of Life for Palliative and End-of-Life Patients: A Narrative Review
Ngo, A. L., Nguyen, L., Shahbandeh, C., Nichols, J.
Cureus, 2025/09
Free full text
136

Erythromelalgia: a cutaneous manifestation of polycythemia vera
Saad, M., Dazé, R.
Journal of Osteopathic Medicine, 2025/09
Free full text
137

TIF1-gamma associated dermatomyositis with extensive cutaneous involvement
Geric, K. M., Khan, H. S., Dazé, R.
Journal of Osteopathic Medicine, 2025/09
Free full text
138

Use of a community care coordination team to reduce emergency department utilization and hospital readmissions for the highest utilizers
Shipman, S., Painter, K., Epperson, L. C., Smith, K.
Journal of Osteopathic Medicine, 2025/09
Free full text
139

Osteopathic Manipulative Treatment in Cervical Dystonia Patients Treated with IncobotulinumtoxinA
Décarie, P., Chouinard, S., Venne, G.
International Journal of Osteopathic Medicine, 2025/09
140

Repositioning Menstrual Pain Management: Multidisciplinary Collaboration and Cultural Sensitivity as Key Priorities
Nufi, E. P.
International Journal of Osteopathic Medicine, 2025/09
141

Employment characteristics of individuals who received osteopathic care: a retrospective cross-sectional observational study
Verhaeghe, N., van Dun, P. L. S., Annemans, L.
International Journal of Osteopathic Medicine, 2025/09
Free full text
142

Development of a research mentorship program for Australian osteopaths
Eaves, S., Steel, A.
International Journal of Osteopathic Medicine, 2025/09
143

A novel simulation enhanced education for osteopathic manipulation of hospitalized patients
Eilerman, A. P., Libonate, G., Pothen, S., Rudie, M., Zardoost, S., Donaldson, B., Gable, B.
Journal of Osteopathic Medicine, 2025/09
Free full text
144

COVID-19 mRNA vaccine immune response to the addition of osteopathic manipulative treatment with lymphatic pumps: a randomized controlled trial
Martinez, E. S., Fuchs, S., Szurmant, H., Chen, X., Comer, A., Lee, E., Hruby, R., Giusti, R., Loveless, B., Sees, J. P., Crone, P., Peek, L. J., Pestano, G., Xie, B., Zammuto, J., Hostoffer Jr., R., Sanchez Jr., J.
Virus Research, 2025/09
Free full text
145

Étude de faisabilité LEUCOSTEO : intervention par ostéopathie dans l’accompagnement d’enfants ayant une leucémie aiguë lymphoblastique
(LEUCOSTEO interventional pre-study: Evaluation of osteopathic support needs in the context of acute lymphoblastic leukemia)
De Mauljean, M., Chaillou, D., Mattatia, J., Baldo, C., Gouaux, L., Dalle, J.H., Stubbe, L., Brethon, B.
Douleurs, 2025/09
146

General Osteopathic Treatment: Status quo – Teil 1
(General Osteopathic Treatment: Status Quo – Part 1)
Engel, M.
Osteopathische Medizin, 2025/09
147

Post-/Long-COVID-Syndrom und Post-Vac-Syndrom: Können uns in der Therapie alte Überlegungen helfen?
(Post-/Long-COVID syndrome and post-vaccination syndrome: Can old ideas help us in treatment?)
Heinz, J.
Osteopathische Medizin, 2025/09
148

Interdisziplinäre Perspektiven auf die Ankyloglossie: Diagnostik, Therapie und Evidenz
(Interdisciplinary perspectives on ankyloglossia: diagnosis, treatment, and evidence)
Moghtader, D., Vogt, R.
Osteopathische Medizin, 2025/09
149

Praktische Umsetzung der Studienergebnisse zur Osteopathie bei Dysmenorrhö
(Practical implementation of study results on osteopathy for dysmenorrhea)
Plathner, M.
Osteopathische Medizin, 2025/09
150

Post-COVID-19 Respiratory Dysfunction and Musculoskeletal Pain: Improvement with Osteopathic Manipulative Treatment (OMT)
Dehghani Ashkezari, A., Graber, Z., Yao, S. C.
The AAO Journal, 2025/09
151

The Use of Osteopathic Manipulative Treatment for a Case of Constipation in Childhood
Heineman, K.
The AAO Journal, 2025/09
152

Tipping the scale: Enhancing Neurological Recovery in TBI through Osteopathic Principles
Khanna, N., Ettlinger, H., Shugar, J. D.
The AAO Journal, 2025/09
153

Impact of Osteopathic Manipulative Treatment on Improving Function and Restoring Quality of Life After Sternoclavicular Joint Resection
Krueger, A., Schaefer, M.
The AAO Journal, 2025/09
154

Case #3: Shortness of Breath
McCarty, C. L.
The AAO Journal, 2025/09
155

Osteopathic Manipulative Treatment (OMT) as an Adjunctive Treatment in Major Depressive Disorder (MDD)
Moreno, P., Mather, M., Kinney, L., Pichot, R., Torres, R.
The AAO Journal, 2025/09
156

Osteopathic Manipulative Treatment (OMT) Protocol on Sleep Quality in Medical Students as Measured by the Fitbit Smart Watch: A Pilot Study
Radigan, R., Finkelstein, A., Lee, B., George, E., Bhushan, P., Sousa, A., Yao, S. C.
The AAO Journal, 2025/09
157

Emotional Release of a Male with Somatic Symptom Disorder (SSD) via Osteopathic Manipulative Treatment (OMT)
Tedjo, W., Shugar, J. D.
The AAO Journal, 2025/09
158

OMT as an Adjunct Therapy to Clubbed Feet: A Case Study
Tucker, A., Dorsa, I., Patel, J., Seemann, J., Hicks, K., Leggoe, S.
The AAO Journal, 2025/09
159

Osteopathic correction as part of complex treatment of delayed speech and mental development in preschool children
(Остеопатическая коррекция в составе комплексного лечения задержки речевого и психического развития у детей дошкольного возраста)
Abubakarova, E. N., Stenkova, O. V., Nenashkina, E. N.
Russian Osteopathic Journal, 2025/09
160

DO (under) representation in US guideline development: an investigation of guideline authors from 2021-2023
Amendolara, A. B., Salazar, S., Nguyen, T., Fife, P., Harris, B., Rivera, A. M., Madrid, K., Gray, Y., Stacey, S.
Journal of Osteopathic Medicine, 2025/09
Free full text
161

Comparison of clinical effectiveness of osteopathic correction and massage in the treatment of cervicalgia in surgical specialists experiencing prolonged professional overloads
(Сравнение клинической эффективности остеопатической коррекции и массажа в терапии цервикалгии у специалистов хирургического профиля, испытывающих продолжительные профессиональные перегрузки)
Belash, V. O., Plotnikova, E. N.
Russian Osteopathic Journal, 2025/09
162

Combined rehabilitation of patients after acute cerebrovascular accident in the early recovery period: the role of osteopathic correction
(Комбинированная реабилитация пациентов после острого нарушения мозгового кровообращения в раннем восстановительном периоде: роль остеопатической коррекции)
Makichyan, T. G., Rylsky, A. V., Melkosyants, D. I.
Russian Osteopathic Journal, 2025/09
163

Is osteopathic treatment appropriate for a patient with multimorbidity?
(Уместно ли остеопатическое лечение пациенту с мультиморбидностью?)
Musina, G. M., Novikov, Y. O., Musina, S. M.
Russian Osteopathic Journal, 2025/09
164

Effect of osteopathic correction on the outcome of pregnancy and childbirth in women with chronic pyelonephritis
(Влияние остеопатической коррекции на исход беременности и родов у женщин с хроническим пиелонефритом)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/09
165

Gastrointestinal motility disorder in celiac disease: influence of osteopathic correction
(Нарушение моторики органов желудочно-кишечного тракта при целиакии: влияние остеопатической коррекции)
Oreshko, A. Y., Mokhov, D. E., Tregubova, E. S., Oreshko, L. S.
Russian Osteopathic Journal, 2025/09
166

Centering the Medical Student Perspective in a Mixed-Methods Evaluation of the Holistic Admissions Process at a Mission-Driven Institution
Liszka, B. L.
Unpublished PhD thesis, 2025/08
Free full text
167

Corrigendum to: Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/08
Free full text
168

The effect of osteopathic manipulative treatment on length of stay and pain relief in pediatric appendectomy: a pilot non-randomized time-controlled clinical trial
Lo Piccolo, R., Cantagalli, M. M., Ferroni, T., Fracchiolla, F., Morabito, A.
Frontiers in Pediatrics, 2025/08
Free full text
169

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text
170

Feasibility of Osteopathic Manipulative Treatment for Low Back Pain in Rural Chimaltenango, Guatemala: A Pilot Study
Aspra Rubi, M., Ngo, A. L. T., Cooper, G., Nichols, J.
Cureus, 2025/08
Free full text
171

Osteopathic diagnosis and treatment of the spine in patients with chronic back pain through the lens of medical infrared thermography: A randomized controlled pilot study
Bohlen, L., Biester, A., Rapp, O., Wentzel, J., Liem, T., Cerritelli, F., Schmidt, T.
Complementary Therapies in Clinical Practice, 2025/08
172

Rezul'taty primeneniya manual'noi terapii pri degenerativnykh zabolevaniyakh pozvonochnika s radikulopatiei i bez nee (Obzor literatury)
(Results of manual therapy in degenerative spine diseases with and without radiculopathy (Literature review))
Gameeva, E. V., Miryutova, N. F., Badalov, N. G., Novikov, Y. O., Stepanova, A. M., Tonkoshkurova, A. V.
Problems of Balneology, Physiotherapy and Exercise Therapy, 2025/08
173

Bridging the gap: associations of provider enrollment in OKCAPMAP with social deprivation, child abuse, and barriers to access in the state of Oklahoma, USA
Hartwell, M., Haas, R., Miller, A., Brent, C., Wickliffe, O., Deshpande, S., Coffey, S.
Journal of Osteopathic Medicine, 2025/08
Free full text
174

Die Auswirkungen der osteopathischen Behandlung bei Patientinnen und Patienten mit der gastroösophagealen Refluxkrankheit
(The Impact of Osteopathic Treatment on Patients with Gastroesophageal Reflux Disease)
Hauck, R.
Unpublished MSc thesis, 2025/08
175

Therapeutische Kompetenz, Erfolge und Grenzen osteopathischer Intervention bei Patient:innen mit Demenz
(Therapeutic Competence, Outcomes, and Limitations of Osteopathic Interventions in Patients with Dementia)
Iwobi, A.
Unpublished MSc thesis, 2025/08
176

Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/08
Free full text
177

Effect of osteopathic manipulation on neck kinematics using X-Sens motion capture in non-specific neck pain: a protocol for randomised controlled trial
Hullumani, S., Qureshi, I., Raghumahanti, R.
BMJ Open Sport and Exercise Medicine, 2025/08
Free full text
178

Investigating the trustworthiness of randomized controlled trials in osteopathic research: a systematic review with meta-analysis
Sénéquier, A., Draper-Rodi, J., Alvarez Bustins, G., Braithwaite, F. A., Brown, J., Corcoran, D., Forrest, L., Godsi, E., MacMillan, A., Menard, M., Roura Carvajal, S., Scocca, C., Treffel, L., Vaucher, P., Wagner, A., Soliman, N., Abbey, H., Hohenschurz-Schmidt, D.
Journal of Clinical Epidemiology, 2025/07
Free full text
179

Urinary incontinence in elite female powerlifters aged 20–30: correlating musculoskeletal exam data with incontinence severity index and survey data
Nutt, K. D., Carnes, M., Griffin, L., Rivin, G.
Journal of Osteopathic Medicine, 2025/07
Free full text
180

Das Karpaltunnelsyndrom in der Schwangerschaft aus osteopathischer Sicht
(Carpal tunnel syndrome in pregnancy from an osteopathic point of view)
Schneider-Milo, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
181

Wurzel mit Riechfunktion
(Root with olfactory function)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
182

Find it, find it, find it …
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
183

A multimodal intervention of manual therapy, exercise, and psychological management for painful diabetic neuropathy: intervention development and feasibility trial protocol
Hohenschurz-Schmidt, D., Smith, S., Schmid, A. B., Bright, P., Draper-Rodi, J., Evans, M. C., Kemp, H., Esteves, N. K., Pigott, E., Scott, W., Vollert, J., Williamson, E., Pogatzki-Zahn, E. M., Vogel, S.
Pain Management, 2025/07
Free full text
184

Patience in Practice: A Nonoperative Approach to Osteochondritis Dissecans
Rodas, A. W., Gupta, P., Pan, K., Rule, R., Goddard, M.
Cureus, 2025/07
Free full text
185

Changes in Electromagnetic Activity Following Osteopathic Manipulative Treatment: A Novel Assessment Using Induction Sensors
Savla, P., Brazdzionis, J., Marino, M., Siddiqi, I., Sweiss, R., King, C., Miulli, D. E.
Cureus, 2025/07
Free full text
186

Effects of a single osteopathic manipulative treatment on intraocular pressure reduction: a pilot study
King, H. H., Weinreb, R. N., Walker, E., Zangwill, L. M.
Journal of Osteopathic Medicine, 2025/07
Free full text
187

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text
188

Effect of osteopathic manipulative treatment on comorbid depressive symptoms in patients with chronic low back pain: study protocol for a randomised controlled trial
Bohlen, L., Eggart, M., Müller-Oerlinghausen, B., Lorenz, J., Schleip, R., Liem, T., Cerritelli, F., Esteves, J. E., Shedden-Mora, M., Schmidt, T.
BMJ Open, 2025/07
Free full text
189

A survey of sexual harassment and assault in osteopathic medical schools
Chiriboga, K., Zeller, M., LaPlante, M., Prasad, C.
BMC Medical Education, 2025/07
Free full text
190

A Holistic Approach to Treatment of Rosacea During Pregnancy: A Systematic Review
Garelick, E., Hurley, M., Bell, L. N., Cubelli, S.
SKIN: Journal of Cutaneous Medicine, 2025/07
Free full text
191

Pilot study on the influence of osteopathic manual therapy on cortisol and testosterone concentrations in horses
Vokietytė-Vilėniškė, G., Babarskaitė, G., Poškienė, I., Anskienė, L., Žilaitis, V.
Acta Veterinaria Brno, 2025/07
192

Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial
Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., Arnal-Gómez, A.
International Journal of Osteopathic Medicine, 2025/06
Free full text
193

Effects of osteopathic treatments in a patient who underwent two cardiac surgeries - A case report
Aubin, A., Bekhazi, J., Fortin, A., Paradis, A., Morin, C.
International Journal of Osteopathic Medicine, 2025/06
194

The combined effect of biofeedback training and osteopathic procedures for the treatment of functional daytime urinary incontinence: A prospective, randomized clinical trial
Elgohary, H. M. I., Elfahl, A. M., Elkholy, M. N.
Journal of Bodywork and Movement Therapies, 2025/06
195

An overview of systematic reviews on the efficacy and safety of osteopathic techniques
Zipp, C. R., Semlitsch, T., Tögel, G., Krenn, C., Loder, C., Jeitler, K., Siebenhofer, A.
Journal of Bodywork and Movement Therapies, 2025/06
196

Osteopathische Behandlung bei Säuglingskolik/exzessivem Schreien: Eine prospektive, multizentrische, randomisierte, kontrollierte Studie
(Osteopathic treatment for infant colic/excessive crying: A prospective, multicenter, randomized, controlled trial)
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
Osteopathische Medizin, 2025/06
197

Osteopathische Behandlung eines Reizdarmsyndroms
(Osteopathic treatment of irritable bowel syndrome)
Scheuchl, F., Spohr, G.
Osteopathische Medizin, 2025/06
198

Technik zur Behandlung des Sonnengeflechts (Ganglia coeliaca)
(Technique for treating the solar plexus (celiac ganglia))
Liem, T.
Osteopathische Medizin, 2025/06
199

Aufruf zur Unterstützung einer Interviewstudie zu Erwartungen und Erfahrungen von Osteopathie-Patient*innen
(Call for support for an interview study on the expectations and experiences of osteopathy patients)
Franke, H., Prediger, G., Luthin, D., Henle, A., Engel, M.
Osteopathische Medizin, 2025/06
200

Development of Standardized Osteopathic Manipulative Treatment Tracking Forms Recording Pain and Functional Outcomes to Facilitate Osteopathic Research
Joseph, C., Mintle, L. S., Hoegerl, C., Asher, D., Adams, K., Fugler, P., McKinney, J.
International Journal of Osteopathic Medicine, 2025/06
201

Osteopathic approach to injuries of the overhead thrower’s shoulder
De Luigi, A. J., Raum, G. M., King, B. W., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/06
Free full text
202

Shaft femoral fracture secondary to osteopathic manipulation: case report and medico-legal implication
Prevot, L. B., Bolcato, V., Fozzato, S., Tronconi, L. P., Basile, G.
International Journal of Osteopathic Medicine, 2025/06
203

Acute changes in functional connectivity associated with first osteopathic manual treatment in chronic low back pain spatially overlap with opioid receptor expression
Tomaiuolo, F., Cerritelli, F., Sestieri, C., Keys, J., Paolucci, T., Sensi, S. L., Ferretti, A., Delli Pizzi, S.
Brain Research Bulletin, 2025/06
Free full text
204

Article Review: Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Daugereaux, S.
The AAO Journal, 2025/06
205

An Osteopathic Strategy for the Recognition and Management of Cervicogenic Vertigo: A Case Study
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2025/06
206

Combined Myofascial Technique for a Second Posterior Sacral Segment Dysfunction
Stellon, A. G., Rudberg-Post, L. J., Gustafson, H. C., Hartwell, L. E., Matz, O. C., Woolley, A. L.
The AAO Journal, 2025/06
207

Correlation of Ankyloglossia and Breastfeeding Difficulties in Infants Referred for Osteopathic Manipulation at a Family Medicine Residency Clinic: A Retrospective Chart Review
Bendrick, T., White, M., Drissi, W., Van Huigenbos, P., Hills, K., Furlano, A.
The AAO Journal, 2025/06
208

Osteopathic Treatment Decreases Pain and Opioid Use in Children with Acute Sickle Cell Disease Pain
Brown, A., Goubeaux, D., Belsky, J.
The AAO Journal, 2025/06
209

Use of Osteopathic Manipulative Medicine in Treatment of Neurologic Sequelae of Sjögren’s Syndrome
Campbell, K., Ettlinger, H. M.
The AAO Journal, 2025/06
210

Functional Improvement without the Surgery Referral, A Case Presentation
Candelori, W. J., Gailius, G. C.
The AAO Journal, 2025/06
211

When the Framework Fails: The Cost of Overlooking the Basics in Chest Pain
Collingsworth, M., Schaefer, M., Emmons, A.
The AAO Journal, 2025/06
212

Management of endometriosis: a call to multidisciplinary approach
Duncan, J.M., Delara, R., Ranieri, G., Wasson, M.
Journal of Osteopathic Medicine, 2025/06
Free full text
213

The Use of Osteopathic Manipulative Medicine During the Inpatient Evaluation for Acute Coronary Syndrome
Coppinger, C., Rit, N., Coppinger, J.
The AAO Journal, 2025/06
214

Optimization of Abdominal Surgery and Controlling Intractable Neuropathic Pain with Peri-operative OMT
Cruz, C., Ural, E., Gailius, G. C., Neuer, K.
The AAO Journal, 2025/06
215

Resolving Deep Gluteal Syndrome with OMT
Dirusso, E., Shugar, J.
The AAO Journal, 2025/06
216

Rhabdo Resuscitation and Recovery Using Osteopathic Manipulative Treatment
Fadenrecht, H., Thorsvik, N.
The AAO Journal, 2025/06
217

Novel COL4A1-related phenotype: generalized hypermobility in a patient with heterozygous missense mutation at NM_001845.6(COL4A1): c.4006G>A (p. Val1336Ile)
Mingo, E. N., Unger, M. J. Jr.
The AAO Journal, 2025/06
218

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma—Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text
219

OMT for TBI: A Case Report Showing Improvements in Vision, Mastication, and Post-Traumatic Headaches
Schneider, G., Garrison, S.
The AAO Journal, 2025/06
220

Patterns of OMT Use Across Diverse Practice Settings: Insights from a Multicenter Healthcare System
Toor, J., Stacey, S.
The AAO Journal, 2025/06
221

Osteopathic manipulative treatment and breastfeeding, correlation between age at presentation, mode of delivery, and LATCH scores: a retrospective chart review
White, M., Bendrick, T., Drissi, W., Van Huigenbos, P., Hills, K., Furlano, A.
The AAO Journal, 2025/06
222

OMT for acute on chronic pain in systemic scleroderma
White, M., Furlano, A.
The AAO Journal, 2025/06
223

Tic Douloureaux: Applied Osteopathy for a Case of Refractory Trigeminal Neuralgia
Wright, J., Thorsvik, N.
The AAO Journal, 2025/06
224

The Impact of Simulated Osteopathic Manipulative Medicine Hospital Rounds on Student Confidence and the Likelihood of OMT Use During Clinical Clerkships
Abdulnour, T., Pryor, J., Chun, L.
The AAO Journal, 2025/06
225

Utilizing Osteopathic Manipulative Medicine to Support Lifestyle Behavior Change: A Case Report
Arnold, C., Bercaw, K., Branda, A.
The AAO Journal, 2025/06
226

Look What The Stork Brought; Osteopathic Manipulative Treatment for Postpartum Foot Drop: A Case Study
Bethea, J., Waters, H.
The AAO Journal, 2025/06
227

The use of OMT in Myalgic Encephalomyelitis/Chronic Fatigue Syndrome
Brancale, D., Cooley, D.
The AAO Journal, 2025/06
228

Hand & Helmet: A Crown-to-Coccyx Approach for Positional Plagiocephaly
Enniss, A., Neuer, K., Whitaker, Z., Ural, E.
The AAO Journal, 2025/06
229

From Fatigue to Function: A Case Report of The Use of OMT in Chronic Fatigue Syndrome
Finkelstein, A., Petrillo, G., Keys, J.
The AAO Journal, 2025/06
230

Osteopathic Manipulative Treatment (OMT) in the Management of a Young Male with Lewy Body Dementia (LBD): A Case Study
Finkelstein, A., Radigan, R., Yao, S. C.
The AAO Journal, 2025/06
231

Management of Chemotherapy Induced Strains in a Breast Cancer Survivor with OMT
Johnson, R., White, E., Yu, X., Aldridge, A. F., Bardowell, A.
The AAO Journal, 2025/06
232

Turning the Tie: The Impact of OMT on infant torticollis and tongue tie
Lee, D. W., Katyal, J., Faillace, R.
The AAO Journal, 2025/06
233

Osteopathic Manipulative Treatment in a Case of a Runner with Long-COVID and Autonomic Dysregulation
Lupori, E., Bowen, S., Le, B.
The AAO Journal, 2025/06
234

Clavicular Dysfunctions: An Osteopathic Approach to Neck, Shoulder, and Chest Pain
Machado Douaihi, S. J., Waters, H.
The AAO Journal, 2025/06
235

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06
236

“I Feel Stuck:“ A Case Presentation on the Application of OMM to a Patient with Chronic Atypical Chest Pain After Pulmonary Coccidioidomycosis
Mayberry, M., Ural, E.
The AAO Journal, 2025/06
237

A Viscerosomatic Discovery: Unveiling a Case of Gastroparesis Disguised as Shoulder Pain
McKenna, T., Pfeifer, K., Wallace-Ross, J.
The AAO Journal, 2025/06
238

Exploring the Impact of Teaching Assistants on Student Learning in Osteopathic Manipulative Medicine (OMM) Laboratory Session: A Survey Study
Mehra, M., Ashkezari, A. D., Caron, E., Noto, P., Yao, S. C.
The AAO Journal, 2025/06
239

Evaluating the Efficacy of AI Note-Taking Software in Documenting Osteopathic Manipulative Medicine Treatment Encounters
Milius, M., Jurges, T., Pentlarge, J., Gabriel, D., Yang, N., Yadalla, S., Siddiqui, S., Bills, K., Barnhurst, N.
The AAO Journal, 2025/06
240

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06
241

Evaluation of Osteopathic Manipulative Treatment Strategies in Adults with Chronic Neck Pain
Moljo, M., Sreenivasa, S., Neupane, R., Harris, Z., Potter, A.
The AAO Journal, 2025/06
242

Die Wirksamkeit einer osteopathischen Behandlung auf das Schmerzempfinden von Frauen mit endometrioseassoziierten Schmerzen
(The effectiveness of osteopathic treatment on the pain perception of women with endometriosis-associated pain)
Boltz, A.
Unpublished MSc thesis, 2025/06
243

Comparing Measurements of the Carpal Tunnel and the Median Nerve Before and After Applying Osteopathic Manipulative Treatment: An Ultrasound-Guided Case Study
Nandedkar, T., Brown, S., Schneider, R., Rosten, C.
The AAO Journal, 2025/06
244

Osteopathic Manipulative Treatment (OMT) Techniques Utilized for Specific Post-COVID Symptoms Based on Physician Survey Results
Nawrocka, N., Baronos, A., Yao, S. C.
The AAO Journal, 2025/06
245

When it’s not about Ankyloglossia: A case of Osteopathic Manipulative Treatment for Newborn Breastfeeding Difficulties in the Absence of Restricted Labial or Lingual Frenula
Nixon, B., Waters, H.
The AAO Journal, 2025/06
246

Finding his Voice: A Case Report of the Utility of OMT in a Child with Global Delay
Petrillo, G., Keys, J.
The AAO Journal, 2025/06
247

Evaluating the Acute Effects of Osteopathic Manipulative Treatment on Sprint Times
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., Jo, K., Roush, J., Cosgrave, C.
The AAO Journal, 2025/06
248

The Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Sharma, H., Bethea, J., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
The AAO Journal, 2025/06
249

Short-Lever Assessment of Spinal Side-Bending
Sudweeks, K., McClendon, M., Khalil, F., Kania, A.
The AAO Journal, 2025/06
250

Impact of Osteopathic Manipulative Treatment in Delivering Comprehensive Care in Populations with Disabilities
Villarosa, M., Bae, P., Yeam, J., Hoang, V., White, G., Blumer, J.
The AAO Journal, 2025/06
251

Management of Chronic Migraine in a 34-year-Old Obese Female
White, E., Johnson, R., Yu, X., Bardowell, A.
The AAO Journal, 2025/06
252

Osteopaths’ perspective and experiences of elite track and field athletes osteopathic treatments: A descriptive phenomenological study
Consorti, G., Fard, R., Odorisio, L., Cella, M.
Journal of Bodywork and Movement Therapies, 2025/06
253

Significant Improvement of Fibromyalgia Symptoms With Osteopathic Manipulative Treatment: A Case Report
Ansari, A. Z., Mokodanski, N. A., Ahmed, F., Fairooz, A., Hafeez, S.
Cureus, 2025/06
Free full text
254

Therapeutic efficacy of individual head orthoses in infants with positional plagiocephaly
Chhatwani, S., Degener, C., Rako, L., Kirschneck, C., Möhlhenrich, S. C., Danesh, G., Kelker, M.
Journal of Orofacial Orthopedics, 2025/06
Free full text
255

Long-/Post-Covid - Eine Scoping-Review zu Chancen und Nutzen osteopathischer Behandlungen
(Long-/Post-Covid - A scoping review of the opportunities and benefits of osteopathic treatments)
Klemm, J.
Unpublished MSc thesis, 2025/06
256

The effect of osteopathic manipulative treatment on chronic rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kalkat, A., Hammes, C., Kohli, E., Callahan, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2025/06
Free full text
257

Einfluss einer osteopathischen Behandlung auf das subjektive Wohlbefinden, die Mobilität und die Leistungsfähigkeit der Rückenmuskulatur bei Sportlerinnen und Sportlern
(Influence of osteopathic treatment on the subjective well-being, mobility and performance of the back muscles of athletes)
Kott, V.
Unpublished MSc thesis, 2025/06
258

Effekte der Osteopathie auf die HRV, die NRS und die Lebensqualität bei Patientinnen mit primärer Dysmenorrhoe: Eine integrative Fallserie
(Effects of Osteopathy on HRV, NRS, and Quality of Life in Patients with Primary Dysmenorrhea: An Integrative Case Series)
Markovics, M.
Unpublished MSc thesis, 2025/06
259

Osteopathic practitioner´s considerations on infertility treatment
Triay Salamanca, S.
Unpublished MSc thesis, 2025/06
Free full text
260

The possibility of using osteopathic correction in the complex therapy of patients with chronic telogen hair loss
(Возможность применения остеопатической коррекции в комплексной терапии пациенток с хроническим телогеновым выпадением волос)
Belash, V. O., Garaz, E. G.
Russian Osteopathic Journal, 2025/06
261

Auswirkung osteopathischer Behandlungen schwangerer Frauen während der Schwangerschaft in Bezug auf die Kaiserschnittrate
(Effects of Osteopathic Treatments on Pregnant Women During Pregnancy in Relation to the Cesarean Section Rate)
Neuhold, H.
Unpublished MSc thesis, 2025/06
262

Ultrasound verification of the effect of osteopathic correction on the structural and functional state of the median nerve in carpal tunnel syndrome (pilot study
(Ультразвуковая объективизация влияния остеопатической коррекции на состояние срединного нерва при синдроме запястного канала (пилотное исследование)
Belyaev, A. F., Belomestnov, P. V., Volkonskaya, E. A.
Russian Osteopathic Journal, 2025/06
263

Оsteopathic treatment of supraorbital neuralgia in a child
(Остеопатическое лечение супраорбитальной невралгии у ребенка)
Musina, G. M., Novikov, Y. O., Musina, S. M.
Russian Osteopathic Journal, 2025/06
264

Effect of osteopathic correction on urodynamic parameters in pregnant women with chronic pyelonephritis
(Влияние остеопатической коррекции на показатели уродинамики у беременных с хроническим пиелонефритом)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/06
265

Possibilities of including osteopathic methods of correction in the complex treatment of urolithiasis
(Возможность включения остеопатической коррекции в комплексное лечение мочекаменной болезни)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/06
266

Osteopathische Nachbehandlung alter offener Appendektomien und ihre Auswirkung auf chronische Rückenschmerzen – eine pragmatische, quasirandomisierte, kontrollierte Pilotstudie
(Effect of Osteopathic Treatment After Historical Open Appendectomy on Chronic Low Back Pain: A Pragmatic Quasi-Randomized Controlled Pilot Study)
Rottensteiner, M.
Unpublished MSc thesis, 2025/06
267

Effekte einer osteopathischen Behandlung auf die Herzratenvariabilität bei Patientinnen mit Colitis Ulcerosa: Eine integrative Fallserie
(Effects of Osteopathic Treatment on Heart Rate Variability in Patients with Ulcerative Colitis: An Integrative Case Series)
Schabauer, O.
Unpublished MSc thesis, 2025/06
268

Efficacy and safety of musculoskeletal manipulations in elderly population with musculoskeletal disorders: a systematic review
Bagagiolo, D., Persiani, M., Cicchitti, L., Vismara, L., Bruini, I., Mauro, A., Buffone, F.
BMJ Open, 2025/06
269

Einfluss manueller osteopathischer Behandlung auf den Zeitpunkt des eigenständigen Trinkens der ausreichenden Trinkmenge im Vergleich zu Static Touch Interventionen
(Influence of Manual Osteopathic Treatment on the Time of Full Oral Feeding in Comparison with Static Touch Interventions)
Topf, C.
Unpublished MSc thesis, 2025/06
270

Einfluss einer einmaligen osteopathischen Behandlung auf Stabilität, Symmetrie und Sensomotorik von Kindern mit Angststörung oder ADHS
(Effect of a single osteopathic treatment on stability, symmetry and sensorimotor function in children with symptoms of an anxiety disorder or ADHD)
Wittig-Chronopoulos, M.
Unpublished MSc thesis, 2025/06
271

Effectiveness of osteopathic treatment in women with primary dysmenorrhea: A randomised controlled trial
Plathner, M., Wolf, L.
Journal of Bodywork and Movement Therapies, 2025/06
272

Most TikTok Videos Regarding the Anterolateral Ligament of the Knee Are Posted by Patients and Have Little Educational Value
D'Ambrosi, R., Vieira, T. D., Sonnery-Cottet, B.
Arthroscopy, Sports Medicine, and Rehabilitation, 2025/06
Free full text
273

Osteopathic Manipulative Treatment of the Ankle-Foot Complex in Individuals with Limited Dorsiflexion: Study Protocol for a Randomized Crossover Clinical Trial
Loures de Paula, A., Castro, R. Q., Souza, H. C., de Castro Moreira, B., Moreira Baião, I. C., Schmitz Correa, C. P., Felício, D. C., Fonseca, D. S.
International Journal of Osteopathic Medicine, 2025/06
274

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma-Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text
275

TikTok Videos Related to the Posterior Cruciate Ligament Have Low Educational Value
D'Ambrosi, R., Marchetti, P. M., Albano, D., Ursino, C., Formica, M., Ursino, N., Hewett, T. E.
Arthroscopy, Sports Medicine, and Rehabilitation, 2025/06
Free full text
276

Efficiency of physical therapy and osteopathic techniques in the treatment of operated and recurrent lumbar disc herniation - a case report
Antohe, B.A., Rață, M., Rață, B., Rață, G.
Journal of Bodywork and Movement Therapies, 2025/06
277

Técnicas de terapia manual no manejo da constipação funcional: uma revisão sistemática com metanálise
(Manual therapy techniques in the management of functional constipation: a systematic review with meta-analysis)
Nascimento, M. S.
Unpublished MSc thesis, 2025/05
278

Providing Palliative Care for Two: Managing Cancer-Related Pain During Pregnancy
Okonta, V., Kirkire, L., Schoen, M., Mesarwi, P., Skavinski, K.
Journal of Pain and Symptom Management, 2025/05
279

Pilot study MOVENDOP protocol - impact on quality of life following postoperative osteopathic abdominal mobilizations in patients operated for endometriosis
Comptour, A., Dechambenoit, C., Kwiatkowski, F., Vidal, A., Duval, M., De Antonio, M., Jacobs, A., Bourdel, N.
PLoS One, 2025/05
Free full text
280

Osteopathic Manipulative Treatment for Chronic Low Back Pain and Musculoskeletal Pain in Remote Underserved Populations: A Systematic Literature Review
Friedman, A., Sheth, R., Wallace-Ross, J.
Cureus, 2025/05
Free full text
281

Assessing Osteopathic Medical Students' Knowledge, Attitude, and Perspective on the Use of Assisted Reproductive Technologies (ART)
Patel, A., Capote, M. M., Manguvo, A., Mafuvadze, B.
Cureus, 2025/05
Free full text
282

A Retrospective Multicenter Analysis of Osteopathic Manipulation in Academic and Community Settings
Stacey, S. K., Harmelink, B., Gordon, B., Toor, J., Furlano, A., Genewick, J., Westfall, E.
Cureus, 2025/05
Free full text
283

Breath of Relief: Osteopathic Manipulative Treatment of Chronic Postoperative Pain in a Bilateral Lung Transplant Patient
Duggal, V., Finkelstein, A., Radigan, R., Bhushan, P.
Cureus, 2025/05
Free full text
284

The Impact of a Simulated Intrauterine Device Insertion Clinic on Osteopathic Medical Students’ Knowledge, Attitude, and Self-Efficacy Regarding Intrauterine Devices
Betit, A. L., Kelly, L. P., Garg, R., Patel, P. G.
Cureus, 2025/05
285

Author Correction: Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., Perpetuini, D., Keys, J., Merla, A., Cardone, D.
Scientific Reports, 2025/05
Free full text
286

Towards a more equitable future: development, implementation, and evaluation of a novel e-course on racial disparities in pain management for medical students
Stensland, M., Maples, N., Sanford, E., Martinez, M.
BMC Medical Education, 2025/05
Free full text
287

Reduction in deep organ-space infection in gynecologic oncology surgery with use of oral antibiotic bowel preparation: a retrospective cohort analysis
Kennedy, K., Gaertner-Otto, J., Lim, E.
Journal of Osteopathic Medicine, 2025/05
Free full text
288

Exploring manual therapy in the management of irritable bowel syndrome in adults: A scoping review
Płóciennik-Korycka, N., Pani, S. M., Bruc, B., Contu, P., Wrzesińska, M.
Complementary Therapies in Medicine, 2025/05
Free full text
289

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2025/05
Free full text
290

Elbow injuries in overhead throwing athletes: clinical evaluation, treatment, and osteopathic considerations
King, B. W., Raum, G. M., De Luigi, A. J., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/05
Free full text
291

Osteopathic, logopedic and psychological assessment to improve outcome in patients undergoing cardiac surgery: A randomized clinical trial (TITANIC trial)
Volpato, E., Stilo, L., Tavanelli, M., Bordoni, B., Oreni, L., Toccafondi, A., Moraschi, A., Morici, N.
European Journal of Preventive Cardiology, 2025/05
292

Efficacy of Osteopathic Manipulative Treatment in Creating a Difference in Pain Levels for Patients With Localized Joint Pain: A Meta-Analysis of Randomized Controlled Trials
DeFrancisis, J. S., Vinarski, B. M., Abreu, M., Ibrahim, J., Hostoffer, R.
Cureus, 2025/04
Free full text
293

Does Malpractice Risk Deter Medical Students From Pursuing Obstetrics and Gynecology?
Thai, A., Huynh, K., Pickering, T., Maron, A., Wang, L., Stohl, H.
Cureus, 2025/04
Free full text
294

Patient-Practitioner-Environment Synchronization: Four-Step Process for Integrating Interprofessional and Distinctive Competencies in Osteopathic Practice-A Scoping Review with Integrative Hypothesis
Lunghi, C., Baroni, F., D'Alessandro, G., Consorti, G., Tramontano, M., Stubbe, L., Conte, J., Liem, T., Zegarra-Parodi, R.
Healthcare, 2025/04
Free full text
295

The Effect of Osteopathic Manipulative Treatment Adjunct on Stabilization Splint Treatment in Temporomandibular Joint Anterior Disc Displacement with Reduction Disorder: A Quantitative Analysis, Pilot Study
Aklar, A., Bal, B., Taşdelen, N., İnal, H. S., Ertaş, G.
Journal of Clinical Medicine, 2025/04
Free full text
296

Evaluation of the effectiveness of osteopathic treatment on the mother-newborn dyad in the event of painful breastfeeding in a maternity hospital despite the application of all usual aids: randomized interventional trial in two parallel arms without blinding
Elleau, C., Missmahl, C., Belcadi, W., Aurillac-Lavignolle, V., Sentilhes, L.
Frontiers in Nutrition, 2025/04
Free full text
297

Effect of osteopathic manipulation on pain, disability, range of motion and reposition sense in subjects with postural neck pain: a systematic review protocol
Hullumani, S., Raghumahanti, R., Qureshi, I., Ladkhedkar, P.
BMJ Open, 2025/04
Free full text
298

Efectividad del tratamiento osteopático en la dismenorrea primaria. Revisión sistemática
(Effectiveness of osteopathic treatment for primary dysmenorrhea. A Systematic review)
Muñoz Rodríguez, A.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text
299

The role of osteopathic manipulative treatment for dystonia: a literature review
Phrathep, D. D., Abdo, Z., Tadros, M., Lewandowski, E., Evans, J.
Journal of Osteopathic Medicine, 2025/04
Free full text
300

The Effectiveness of Osteopathic Correction in the Complex Rehabilitation of Patients with Temporomandibular Joint Dysfunction
Makichyan, T., Gusakova, E., Khabadze, Z., Sarkisian, A.
Georgian Medical News, 2025/04
Free full text
301

Eficacia de las técnicas osteopáticas en sujetos con cefalea tensional
(Effectiveness of osteopathic techniques in subjects with tension headaches)
Cortes Vega, E. A.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text
302

Eficacia de la osteopatía en la enfermedad del asma bronquial
(Effectiveness of osteopathy in bronchial asthma)
Peramo Ruíz, J. M.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text
303

Les dysfonctions somatiques chez le nouveau-né : une étude prospective
(Somatic Dysfunctions in Newborns: A Prospective Study)
Lemaire, C.
Unpublished MSc thesis, 2025/03
Free full text
304

Tradition-Dismissive vs. Tradition Reconceptualization Approaches in Musculoskeletal Care: The Example of Osteopathic Care
DAlessandro, G., Lunghi, C., Consorti, G., Zanon, S., Berti, F., Turinetto, M., Di Pietrantonio, L., Longobardi, M., Zegarra-Parodi, R., Baroni, F.
Applied Sciences, 2025/03
Free full text
305

Categorizing treatment mechanisms for Complementary and Integrative Musculoskeletal Interventions
Cook, C. E., Abraira, V. E., Burns, J., Degenhardt, B. F., Kawchuk, G., Keter, D., Loghmani, M. T., Reed, W. R., Winkelstein, B. A., McDevitt, A.
International Journal of Osteopathic Medicine, 2025/03
306

A call for improving the internal validity and the reporting of manual therapy trials self-labelled as pragmatic: A methodological review
Roura, S., Alvarez, G., Hohenschurz-Schmidt, D., Solà, I., Núñez-Cortés, R., Bracchiglione, J., Fernández-Jané, C., Phalip, J., Gich, I., Sitjà-Rabert, M., Urrútia, G.
International Journal of Osteopathic Medicine, 2025/03
Free full text
307

Does manual therapy improve pain, disability, and glenohumeral motion in overhead athletes? Systematic review and meta-analysis
Santana, S. D. F., Gava, V., de Oliveira, V. M. A., dos Santos, G. A., Lima, T. A. S., Kamonseki, D. H.
International Journal of Osteopathic Medicine, 2025/03
308

Diagnosing and treating upper back pain: insights from New Zealand’s manipulative physiotherapists and osteopaths
Kovanur Sampath, K., Smith, T., Belcher, S., Farrell, G., Fryer, G., Vaughan, B., Moran, R.
Journal of Manual & Manipulative Therapy, 2025/03
309

Prevalence of pelvic examinations on anesthetized patients without informed consent
Cutting, R., Reddy, V., Polam, S., Neiman, N., Manna, D.
Journal of Osteopathic Medicine, 2025/03
Free full text
310

Effekt von osteopathischen Behandlungen während interdisziplinärem Gewichtsreduktionskonzept von Patienten mit Adipositas Grad 1 -3
(Effect of Osteopathic Treatments During an Interdisciplinary Weight Reduction Program in Patients with Grade 1–3 Obesity)
Brenner, M.
Unpublished MSc thesis, 2025/03
311

Impact of osteopathic manipulative medicine training during graduate medical education and its integration into clinical practice
Kramer, J. L., Trombetti, K., De Asis, K., Mai, V., Swing, E.
Journal of Osteopathic Medicine, 2025/03
Free full text
312

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R, 2025/03
313

Assessing the effects of manual therapy on pain in patients living with Persistent Non-Specific Low Back Pain (PNSLBP): Which evaluation criteria and measurement tools used in randomised controlled clinical trials? A systematic review
Bilhaut, A., Olivier, A.H., Draper-Rodi, J., Cretual, A., Ménard, M.
International Journal of Osteopathic Medicine, 2025/03
314

Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., David, P., Jordan, K., Arcangelo, M., Daniela, C.
Scientific Reports, 2025/03
Free full text
315

„Du lebst und stirbst durch mich“: Das Zwerchfell im osteopathischen Kontext
(“You live and die through me“: the diaphragm in an osteopathic context)
Engel, M.
Osteopathische Medizin, 2025/03
316

Osteopathische Behandlung therapieresistenter Schmerzen: Chronisch abdominaler Schmerz, eingeschränkte Atmung und Unverträglichkeit von Schmerzmitteln bei Zustand nach Colon-ascendens-Karzinom
(Osteopathic treatment of therapy-resistant pain: Chronic abdominal pain, restricted breathing and intolerance to painkillers in the condition after ascending colon cancer)
Geilgens, A., Repik, I.
Osteopathische Medizin, 2025/03
317

Wo steckt der Geist in der Osteopathie?: Zur Frage nach dem Menschen im 21. Jahrhundert
Kaiser, A. K.
Osteopathische Medizin, 2025/03
318

An Innovative Osteopathic Curriculum for Allopathic and Osteopathic Family Medicine Residents
Price, J. W.
The AAO Journal, 2025/03
319

Effect of osteopathic correction on the manifestations of postcholecystectomy syndrome
(Влияние остеопатической коррекции на проявления постхолецистэктомического синдрома)
Bibikov, A. A., Nenashkina, E. N., Oreshko, A. Y.
Russian Osteopathic Journal, 2025/03
320

Possibility of using manual therapy and osteopathic correction for delayed speech and motor development in children
(Возможности применения мануальной терапии и остеопатической коррекции при задержке речевого и моторного развития у детей)
Bobko, A. Y., Bobko, Y. N., Adulas, E. I., Mizonova, I. B., Bulina, O. V., Suslova, G. A.
Russian Osteopathic Journal, 2025/03
321

Dynamics of osteopathic status in patients with chronic tonsillitis during complex treatment with inclusion of osteopathic correction
(Динамика остеопатического статуса у пациентов с хроническим тонзиллитом при комплексном лечении с включением остеопатической коррекции)
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushk, S. A.
Russian Osteopathic Journal, 2025/03
322

Non-medicamentous methods in conservative treatment and preoperative preparation of patients with gonarthritis (literature review
(Немедикаментозные методы в консервативном лечении и предоперационной подготовке пациентов с гонартритом (обзор литературы)
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/03
323

Osteopathic correction as part of complex treatment of patients with uterine form of infertility
(Остеопатическая коррекция в составе комплексного лечения пациенток с маточной формой бесплодия)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/03
324

Application of osteopathic correction in complex therapy of patients with varicose veins of the lower limbs
(Применение остеопатической коррекции в комплексной терапии пациенток с варикозной болезнью нижних конечностей)
Belash, V. O., Usenko, K. P.
Russian Osteopathic Journal, 2025/03
325

Diaphragm functions and their disorder during artificial ventilation of the lungs (literature review)
Функции диафрагмы и их нарушение при искусственной вентиляции легких (обзор литературы)
Tolmachev, K. M., Potekhina, Y. P.
Russian Osteopathic Journal, 2025/03
326

Osteopathic Manual Therapy Versus Conventional Conservative Therapy in the Management of Temporomandibular Disorders
Rahman, S.
Journal of Modern Health and Rehabilitation Sciences, 2025/03
Free full text
327

Gender Health Gap und die Rolle der Osteopathie in der Frauenheilkunde
(Gender Health Gap and the role of osteopathy in gynecology)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
328

Track and field coaches' perspective and experiences of including osteopaths in shared management of elite athletes: A descriptive phenomenological study
Fard, R., Cella, M., Odorisio, L., Consorti, G.
Journal of Bodywork and Movement Therapies, 2025/03
329

Formen der funktionellen Harninkontinenz bei Kindern
(Forms of functional urinary incontinence in children)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
330

Practitioner characteristics of osteopaths who treat pregnant women and children: An Australasian perspective from two practice-based research networks
Steel, A., Draper-Rodi, J., Fleischmann, M., Morin, C., Ferreira, A. P., Vaughan, B., Orrock, P.
Complementary Therapies in Clinical Practice, 2025/02
331

Formation of myofаscial pain syndrome and its correction in patients with tension headache
Vesnin, A. V., Tovazhnianska, O. L.
Journal of V. N. Karazin Kharkiv National University. Series 'Medicine', 2025/02
332

Efficacy of pulsed electromagnetic field therapy on pain and physical function in patients with non-specific low back pain: a systematic review
Kull, P., Keilani, M., Remer, F., Crevenna, R.
Wiener Medizinische Wochenschrift, 2025/02
Free full text
333

Neuroimaging Model of Visceral Manipulation in Awake Rat
Cramer, S. R., Han, X., Chan, D. C. Y., Neuberger, T., Zhang, N.
Journal of Neuroscience, 2025/02
334

Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Galeazzi, Y., Houel, N., Gouaux, L., Rohan, A., Le Heiget, H., Jung, C., Housset, B., Stubbe, L.
Pain Reports, 2025/02
Free full text
335

Effects of manual osteopathic interventions on psychometric and psychophysiological indicators of anxiety, depression and stress in adults: a systematic review and meta-analysis of randomised controlled trials
Gordon, T. C., Hope-Bell, J., Draper-Rodi, J., MacMillan, A., Miller, D., Edwards, D. J.
BMJ Open, 2025/02
Free full text
336

Exploring the Impact of Osteopathic Manipulative Treatment on Chronic Migraine Relief: A Case Study
Lahlou, Y., Aamir, M., Shadiack, V.
Cureus, 2025/02
Free full text
337

“The Dark Side of Musculoskeletal Care”: Why Do Ineffective Techniques Seem to Work? A Comprehensive Review of Complementary and Alternative Therapies
Mamud-Meroni, L., Tarcaya, G. E., Carrasco-Uribarren, A., Rossettini, G., Flores-Cortes, M., Ceballos-Laita, L.
Biomedicines, 2025/02
Free full text
338

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text
339

“There is a way to work together“: A qualitative study on complementary medicine therapists' perceptions of their role in the Swiss healthcare system
Dubois, J., Rodondi, P.Y., Akre, C.
Complementary Therapies in Clinical Practice, 2025/02
Free full text
340

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text
341

Diagnosis and Treatment of Thoracic Outlet Syndrome in an Elderly Male Patient: A Case Report and Protocol Evaluation
Dale, J. L., Sood, H.
Cureus, 2025/02
Free full text
342

Efficacy of non-surgical, non-pharmacological treatments for congenital muscular torticollis: a systematic review and meta-analysis
Antares, J. B., Jones, M. A., Chak, N. T. N., Chi, Y., Li, H., Li, M., Chan, E. Y. W., Chen, T. M. K., Lee, C. M. Y., Urquhart, D. M.
BMC Musculoskeletal Disorders, 2025/02
Free full text
343

Severe Hyperostosis Frontalis Interna in a 91-Year-Old Female Cadaver: A Case Report
Chiu, J., Nikirk, J., Loomis, M., Hu, S., Prada, G.
Cureus, 2025/02
Free full text
344

Approche neuroprotectrice de l’ostéopathie chez les grands prématurés : tolérance, sécurité et bénéfices potentiels
(Neuroprotective approach of osteopathy in very preterm infants: tolerance, safety, and potential benefits)
O'Connor, S.
Unpublished PhD thesis, 2025/01
Free full text
345

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
346

Gedanken zur Behandlung von Cochlea-Implantat-Trägern
(Thoughts on the treatment of cochlear implant users)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
347

Heilungshindernisse
(Obstacles to healing)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
348

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text
349

Uncovering gaps in management of vasomotor symptoms: findings from a national need assessment
Hubka, T. A., Crim, A., Koh, J. Y., Larrison, C., McKeithen, T., Fleming, M., Caruso, J., Prud&rsquo, homme, M.
Journal of Osteopathic Medicine, 2025/01
Free full text
350

An Unusual Presentation of Respiratory Dysfunction in Parkinson’s Disease: A Case Study
Rundquist, L. D., Lyons, S. E., Moljo, R. J., Blavo, C.
Cureus, 2025/01
Free full text
351

Osteopathic treatment of infants with infantile colic/excessive crying: a prospective, multicentric, randomized controlled trial and nested observational trial
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
BMC Pediatrics, 2025/01
Free full text
352

Wirkungslos und teuer: Warum Osteopathie bei Babys sinnlos ist
Pannen, A.
Tagesspiegel, 2025/01
353

Early osteopathic manipulative treatment to prevent cranial positional deformities: A randomized controlled trial
Genelot, C., Macioce, V., Huguet, H., Harrewijn, I., Cambonie, G., Dessauge, D., Mura, T., Moulis, L., Captier, G.
Archives de Pédiatrie, 2025/01
Free full text
354

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text
355

Three-Dimensional Posture Analysis-Based Modifications After Manual Therapy: A Preliminary Study
Scoppa, F., Graffitti, A., Pirino, A., Piermaria, J., Tamburella, F., Tramontano, M.
Journal of Clinical Medicine, 2025/01
Free full text
356

Osteopathic Manipulative Treatment for Postconcussive Symptoms: A Case Report
Tobon, S., Bierbower, S., Giovanis, A.
Military Medicine, 2025/01
357

Osteopathic Manipulative Treatment: A Safe and Feasible Adjunct in Sickle Cell Disease Pain Management
Brown, A., Goubeaux, D., Jacob, S. A., Belsky, J. A.
Pediatric Blood & Cancer, 2025/01
358

The Effect of Osteopathic Visceral Manipulation on Quality of Life and Postural Stability in Women with Endometriosis and Women with Pelvic Organ Prolapse: A Non-Controlled Before-After Clinical Study
Wójcik, M., Kampioni, M., Hudáková, Z., Siatkowski, I., Kędzia, W., Jarząbek-Bielecka, G.
Journal of Clinical Medicine, 2025/01
Free full text
359

Evaluation of an Osteopathic Manipulative Medicine Curriculum for Pediatric Residents
LeMay, M., Newhall, L.
Academic Pediatrics, 2025/01
360

The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T. H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/01
Free full text
361

The value of the osteopathic approach in supporting women suffering from endometriosis
Metzmacker, P., Bengoetxea, A., Mellier, J.
European Journal of Pain, 2025 Nov 01 2025–11–21
Free full text
362

Resolution of Chronic Coccydynia after Osteopathic Manipulative Treatment: A Case Report.
Valdés, D., Sherrington, M., Waters, L. M.
Osteopathic Family Physician, 2024/9
363

Use of Osteopathic Manipulative Treatment for the Management of Pectus Excavatum: A Single Case Study
Lin, Z. X., Perez, A., Volokitin, M.
Cureus, 2024/5
Free full text
364

Osteopathic Manipulative Treatment During Post-operative Recovery: A Scoping Review
Randall, C. G., Paul, H. A., Lumley, H., Ortega, A., Rowley, J., Brown, B., Mohan, S., Smith, K., Messer, T., Swan, E., Mehra, R. S.
Cureus, 2024/2
Free full text
365

Dynamometry for the assessment of trunk muscle strength in postpartum women with pregnancy-related posterior pelvic girdle pain: A reliability study
Jafarian, F.S., Jafari-Harandi, M., Yeowell, G., Sadeghi-Demneh, E.
International Journal of Osteopathic Medicine, 2024/12
366

Osteopathic Treatment of a person with Arnold-Chiari Malformation and Syringomyelia: a case report
Cases-Solé, R., Varillas-Delgado, D., Trinidad-Cascudo, F., Pino-Tamayo, M. C., García-Algar, O.
International Journal of Osteopathic Medicine, 2024/12
367

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text
368

Neuropsychiatric considerations in treating anorexia nervosa patients with osteopathic manipulative medicine: a narrative review
Talebi-Talghian, T., Schulz, P., Huzij, T.
Journal of Osteopathic Medicine, 2024/12
Free full text
369

Factors affecting the risk of falls in people over 60 years old living in a long-term care social institution
(Факторы, влияющие на риск падений у лиц старше 60 лет, находящихся в социальном учреждении долговременного ухода)
Maltsev, S. B., Sevastyanov, M. A., Medvedev, D. S., Tsyndin, D. V., Trotsyuk, D. V., Yushkova, I. D., Polyakova, V. O., Mozgovoy, E. D.
Russian Osteopathic Journal, 2024/12
370

Treatment of migraine with aura with osteopathic manipulative treatment: a case report with renewed perspectives
Babek, N., Fiechter, C., Caretti, R., Phinney, T.
Journal of Osteopathic Medicine, 2024/12
Free full text
371

Autonomic Nervous System and Viscera-Related Responses to Manual Therapy: A Narrative Overview
Alanazi, M. S., Degenhardt, B., Franklin, G., Jacobson, E., Fritz, S., Kettner, N., Kremen, V., Lipke, L., Reed, W. R.
International Journal of Osteopathic Medicine, 2024/12
Free full text
372

Osteopathic Manual Treatment in Women with Endometriosis: A Scoping Review on Clinical Symptoms, Fertility and Quality of Life
De Strooper, M., De Nys, L., Theys, L., Vermeersch, A., Quaghebeur, J.
International Journal of Osteopathic Medicine, 2024/12
Free full text
373

An appraisal of neuroimmune changes and potential benefits of Osteopathic Manipulative Treatment integration with therapeutic management of Post COVID-19 Condition: a literature review
Senigagliesi, F., Scialla, S., Marasco, M. L.
International Journal of Osteopathic Medicine, 2024/12
374

Effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in individuals with chronic low back pain: A double-blind, randomised placebo-controlled trial
Armbrust, D., Arêas, G. P. T., Fonseca, C. L., Arêas, F. Z. S., Duarte, N. A. C., Santana, S. A. A., Dumont, A. J. L., Neto, H. P., Oliveira, C. S.
Clinical Rehabilitation, 2024/12
375

Somatic Dysfunctions in Newborns: A Prospective Study
Lemaire, C., Morin, C., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2024/12
376

The Effects of Osteopathic Manipulative Treatment on Arrhythmias: A Double-blind Randomized Controlled Trial in Patients with Cardiac Implantable Electronic Devices
Nikakis, J., Malkov, D., Tale, E., Mangla, M., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
The Journal of Innovations in Cardiac Rhythm Management, 2024/12
Free full text
377

Osteopathische Behandlung radikulärer Schmerzen
(Osteopathic treatment of radicular pain)
Beckmann, U.
Osteopathische Medizin, 2024/12
378

Applying an osteopathic intervention to improve mild to moderate mental health symptoms: a mixed-methods feasibility randomised trial
Hope-Bell, J., Draper-Rodi, J., Edwards, D. J.
Chiropractic & Manual Therapies, 2024/12
Free full text
379

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität – Teil 2: Ergebnisse der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability - Part 2: Results of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/12
380

Das General Movement Assessment (GMA) in der osteopathischen Praxis
(The General Movement Assessment (GMA) in osteopathic practice)
Luthin, D.
Osteopathische Medizin, 2024/12
381

The Effects of Osteopathic Manipulative Treatment on Climbing Performance
Beyer, B. R., Sheppard, C., Bolig, J., Muvvala, M.
Journal of Osteopathic Medicine, 2024/12
382

Institutional Funding of Medical Students for Research Conferences: Is There a Benefit for the NRMP?
Dennis, J. F., Khan, H., Papatheofanis, C., Agollari, K., Marino, R., Schumann, T., Woolhiser, E.
Journal of Osteopathic Medicine, 2024/12
383

Perception of Osteopathic Medicine in a Rural Clinic in Peru
Hovetter, K., Henke, C., Lopes, K., Berger, M., Boswell, K., Kandil, F., Ridpath, L., Waddell, M., Schmidt, D.
Journal of Osteopathic Medicine, 2024/12
384

Improving Sleep with OMT: A Randomized Controlled Trial using Cervical Techniques to Improve Sleep for OMSI
Le, D., Fagen, D., Christensen, S., Jensen, C., Alacron, A., Slife, R., Thakur, C., Teo, R., Spradley, G., Jackson, S, Zamanian, P., Finley, D., Tran, N., Tran, A., Redeman, K., Marble, A., Keane, J., Mangiaracina, M.
Journal of Osteopathic Medicine, 2024/12
385

Multifaceted Therapeutic Approaches for the Management of Dyspareunia: A Narrative Review
Rastogi, M., Deka, K., Krishnan, S., Narayan, A., Nayak, M. M., Kumar, K. V.
The Open Public Health Journal, 2024/12
Free full text
386

Exploring Attitudes Towards Osteopathic Medicine in First and Second Year Osteopathic Medical Students Following Osteopathic Manipulative Medicine
Neiman, N., de Jesus, A., Zeller, A. M.
Journal of Osteopathic Medicine, 2024/12
387

The Effect of Osteopathic Manipulative Treatment in Chronic Rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kallat, A., Callahan, M., Kohli, E., Hammes, C., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/12
388

Haltung bewahren. Körperhaltung und OMT
Liem, T.
Naturheilpraxis, 2024/12
389

Using Osteopathic Manipulative Therapy to Treat Irritable Bowel Syndrome and Severe Refractory Gastroesophageal Reflux Disease: A Case Report
Johnson, T., Jahnke, A. R., Reindel, K.
Cureus, 2024/12
Free full text
390

Osteopathic correction in the complex treatment of patients with panic disorder
(Остеопатическая коррекция в комплексном лечении пациенток с паническим расстройством)
Adamasova, Y. V., Belash, V. O.
Russian Osteopathic Journal, 2024/12
391

The influence of osteopathic correction on the functional state of volleyball athletes
(Влияние остеопатической коррекции на функциональное состояние спортсменов-волейболистов)
Alukaev, M. I., Ahmetzianov, T. Z., Potekhina, Y. P., Nenashkina, E. N., Yanushanets, O. I.
Russian Osteopathic Journal, 2024/12
392

Manual medical technologies in complex treatment and rehabilitation of patients with primary osteoarthritis (literature review
(Мануальные медицинские технологии в комплексном лечении и реабилитации пациентов с первичным остеоартритом (обзор литературы)
Mokhov, A. D., Belyaeva, I. B., Mokhov, D. E., Gavrilova, T. A.
Russian Osteopathic Journal, 2024/12
393

The possibility of using osteopathic correction in the complex treatment of patient with tinnitus
(Возможность применения остеопатической коррекции в комплексном лечении пациента с тиннитусом)
Revina, M. B.
Russian Osteopathic Journal, 2024/12
394

Osteopathic correction as part of complex treatment of patients with irritable bowel syndrome
(Остеопатическая коррекция в составе комплексного лечения пациентов с синдромом раздраженного кишечника)
Yarysheva, Y. V., Dmitriev, A. A., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/12
395

The Effect of Osteopathic Manipulative Treatment on Acute Post COVID-19 Anosmia and Ageusia Symptoms: A Case Report
Mehra, M., Companion, N., Yao, S. C., Ventimiglia, M.
The AAO Journal, 2024/12
396

Uso do tratamento manipulativo osteopático em lactentes submetidos a ventilação mecânica e falha de extubação
(Use of osteopathic manipulative treatment in infants undergoing mechanical ventilation and extubation failure)
da Cunha, A. A.
Unpublished MSc thesis, 2024/12
Free full text
397

Association of prenatal substance exposure and the development of the amygdala, hippocampus, and parahippocampus
Hartwell, M., Bloom, M., Elenwo, C., Gooch, T., Dunn, K., Breslin, F., Croff, J. M.
Journal of Osteopathic Medicine, 2024/11
Free full text
398

Osteopathie bei Personen mit einem Ehlers-Danlos-Syndrom - exemplarisch cEDS. Eine Einzelfallstudie
(Osteopathy for people with Ehlers-Danlos syndrome - exemplary cEDS. A single case study)
Eggert, M.H.
Unpublished MSc thesis, 2024/11
399

The use of respiratory patient reported outcome measures (PROMs) in the management of COPD: Perceptions of Australian osteopaths
Engel, R., Baxter, D., Muddle, L., Vaughan, B., Grace, S.
Complementary Therapies in Clinical Practice, 2024/11
Free full text
400

Osteopathie in der Rehabilitation von Patienten mit rezidivierenden muskuloskeletalen Verletzungen: eine experimentelle Studie
(Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study)
Sankova, M. V., Nikolenko, V. N., Vovkogon, A. D., Oganesyan, M. V., Trishina, A., Babarzai, L., Antonyan, S. Z., Babarzai, F., Pontes-Silva, A., Zharikov, Y. O.
Manuelle Medizin, 2024/11
401

Einfluss osteopathischer Interventionen auf den Krankheitsverlauf und deren Auswirkung auf die gesundheitsbezogene Lebensqualität von pädiatrischem Morbus Crohn: Eine Einzelfallstudie
(Influence of osteopathic interventions on disease progression and its impact on health-related quality of life in pediatric Crohn's disease: a single-case study)
Vollmer, A.
Unpublished MSc thesis, 2024/11
402

Effizienz einer osteopathischen Intervention des Diaphragma bei Betroffenen mit Amyotropher Lateralsklerose (ALS)
(Efficacy of osteopathic intervention through the Diaphragm technique in ALS patients)
Wendel, J.
Unpublished MSc thesis, 2024/11
403

Pelvic joint stiffness and fear of falling in patients over 75 years of age: a prospective cohort study of 100 patients
Laizeau, C., Jochmans, S., Aufaure, S.
Journal of Osteopathic Medicine, 2024/11
Free full text
404

A Retrospective Comparison of Outcomes after Osteopathic Manipulative Treatments Compared to Trigger Point Injections for Patients with Low Back Pain
Santhosh, R., Smith, A., McCarrell, J., Goff, B.
PM&R, 2024/11
405

Efficacy of manual therapy for sacroiliac joint pain syndrome: a systematic review and meta-analysis of randomized controlled trials
Trager, R. J., Baumann, A. N., Rogers, H., Tidd, J., Orellana, K., Preston, G., Baldwin, K.
Journal of Manual & Manipulative Therapy, 2024/11
406

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text
407

A systematic review of manual therapy modalities and anxiety
West, K. L., Huzij, T.
Journal of Osteopathic Medicine, 2024/11
Free full text
408

Is Osteopathic Manipulative Treatment Clinically Superior to Sham or Placebo for Patients with Neck or Low-Back Pain? A Systematic Review with Meta-Analysis
Ceballos-Laita, L., Jiménez-Del-Barrio, S., Carrasco-Uribarren, A., Medrano-de-la-Fuente, R., Robles-Pérez, R., Ernst, E.
Diseases, 2024/11
409

Osteopathic Manipulative Therapy Effects on Prolonged Post-COVID Olfactory Dysfunction
Stenta, M. E.
PM&R, 2024/11
Free full text
410

Management of Medial Tibial Stress Syndrome with osteopathic manipulative treatment in a basketball player: Case Report
Colli, D., Tarantino, A. G., Bergna, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2024/10
411

The impact of prepregnancy body mass index on pregnancy and neonatal outcomes
Mackeen, A. D., Boyd, V. E., Schuster, M., Young, A. J., Gray, C., Angras, K.
Journal of Osteopathic Medicine, 2024/10
Free full text
412

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10
413

Kann osteopathische Behandlung der Patella Knieschmerzen, Beweglichkeit und Lebensqualität verbessern? Eine randomisierte kontrollierte Studie
(Can Osteopathic Treatment of the Patella Improve Knee Pain, Mobility, and Quality of Life? A Randomized Controlled Study)
Dierenbach, R.
Unpublished MSc thesis, 2024/10
414

Effect of manual manipulation on mechanical gait parameters
Yanuck, S. B., Fox, S. K., Harting, B. R., Motyka, T. M.
Journal of Osteopathic Medicine, 2024/10
415

Efficacy of osteopathic manipulative treatment (93.6, ICD-9) - systematic review
Dwornik, M., Puszczałowska-Lizis, E., Wójcik, M., Szajkowski, S., Graczykowski, M., Szymański, D., Marszałek, S.
Medical Studies/Studia Medyczne, 2024/10
Free full text
416

Effects of Osteopathic Manipulative Treatment on Rare Diseases: A Case Report on Gordon Syndrome
Johnson, T., Waters, H. B.
Cureus, 2024/10
Free full text
417

Effectiveness of Osteopathic Treatment in Adults with Short Hamstring Syndrome: A Systematic Review
Ogando-Berea, H., Leirós-Rodríguez, R., Hernandez-Lucas, P., Rodríguez-González, Ó
Journal of Clinical Medicine, 2024/10
Free full text
418

Novel Diagnosis and Treatment for Neurogenic Thoracic Outlet Syndrome
Tafler, L., Borkowski, S., Javaid, G., Gandolfo, D., Kleyn, D.
Cureus, 2024/10
Free full text
419

Elite Track and Field Athletes’ Perspective and Experiences of Osteopathic Treatments: A Descriptive Phenomenological Study
Cella, M., Consorti, G., Odorisio, L., Fard, R.
Journal of Bodywork and Movement Therapies, 2024/10
420

Effect of Standard Physical Exercises for Non-specific Low Back Pain Combined with Multimodal Osteopathy Treatment on Pain Intensity and Functional Capacity: A Study Protocol for a Randomized Controlled Trial
Ferreira, C. R., Hort, J. P., Bezerra, L. A., Neto, H. P., Biasotto-Gonzalez, D. A., Politti, F.
Journal of Advances in Medicine and Medical Research, 2024/10
Free full text
421

Verbesserung der Schlafqualität während der Wechseljahre - Ein osteopathischer Ansatz
(Sleep quality improvement during Perimenopause – an osteopathic approach)
Schellhorn, S.
Unpublished MSc thesis, 2024/10
422

Effect of electromagnetic stimulation combined with visceral manipulation on stress urinary incontinence in postmenopausal women: A randomized controlled trial
Mohamed, D. M. A., Kamel, D. M., El-Moatasem, A. M., Ali, E. A., Radwan, M. A., Ahmed, S. M.
Journal of Bodywork and Movement Therapies, 2024/10
423

Conservative, physical and surgical interventions for managing faecal incontinence and constipation in adults with central neurological diseases
Todd, C. L., Johnson, E. E., Stewart, F., Wallace, S. A., Bryant, A., Woodward, S., Norton, C.
Cochrane Database of Systematic Reviews, 2024/10
424

An Osteopathic Approach to Foot Drop: A Case Report of Posterior Fibular Head
Volokitin, M., Libman, A. E., Milani, S., Banihashem, M., Ayon, S.
Cureus, 2024/10
Free full text
425

Impacto do tratamento manipulativo osteopático nos músculos faciais de crianças com sequência de Moebius
(Impact of osteopathic manipulative treatment in children with congenital facial paralysis)
Amoroso Borges, B. L.
Unpublished Dissertation, 2024/10
Free full text
426

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10
427

Primary and secondary prevention of musculoskeletal pain and disability in chiropractic, osteopathy, and physiotherapy: A scoping review
Draper-Rodi, J., Delion, T., MacMillan, A., Storey, A. I., Spadaccini, J., Jebi, W., Thomson, O. P., Hohenschurz-Schmidt, D.
International Journal of Osteopathic Medicine, 2024/09
Free full text
428

Die Bedeutung des osteopathischen Behandelns für Kinder nach einer Frühgeburt: Eine Befragung von Kinderosteopath*innen
(The importance of osteopathic treatment for children after premature birth: a survey of pediatric osteopaths)
Hackner, L., Belz, S., Esch, S.
Osteopathische Medizin, 2024/09
429

Efficacy of ankle mobilization on postural control in older people: A systematic review with meta-analysis
Hernández-Guillén, D., García-Gomariz, C., Roig-Casasús, S., Díaz-Díaz, B., Domínguez-Navarro, F., Pérez-Maletzki, J., Blasco, J.M.
International Journal of Osteopathic Medicine, 2024/09
Free full text
430

Heilungshindernis bei klaffender Tube – ein Fallbericht
(Obstacle to healing a patulous Eustachian tube - a case report)
Kaltenbrunner, U.
Osteopathische Medizin, 2024/09
431

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität: Teil 1 – Ziele, Material und Methoden der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability: Part 1 - Objectives, material and methods of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/09
432

ADHS bei Erwachsenen in der osteopathischen Praxis
(ADHD in adults in the osteopathic practice)
Plathner, M.
Osteopathische Medizin, 2024/09
433

Osteopathy: A potential ally against anorexia?
Mattatia, J.
Advances in Integrative Medicine, 2024/09
434

Young Doctors Program-Colorado: An Elective Elementary School Program to Improve Health Literacy, Utilization of the Healthcare System, and Osteopathic Awareness
Sposet, S., Fabich, R., McEchron, M.
Medical Science Educator, 2024/09
Free full text
435

Validität palpationsbasierter Messungen des Beckenschiefstands – eine Sekundäranalyse
(Validity of palpation-based measurements of pelvic obliquity - a secondary analysis)
Brandl, A., Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
436

Endometriose
(Endometriosis)
Engel-Schulmeyer, A., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
437

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
438

Behandlung des männlichen chronischen Beckenschmerzsyndroms (CBSS)
(Treatment of male chronic pelvic pain syndrome (CPPS))
Switters, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
439

Positional plagiocephaly: results of the osteopathic treatment of 424 infants. An observational retrospective cohort study
Panza, R., Piarulli, F., Rizzo, V., Schettini, F., Baldassarre, M. E., Di Lorenzo, A., Tafuri, S., Laforgia, N.
Italian Journal of Pediatrics, 2024/09
Free full text
440

Osteopathic Approach to Proximal Hamstring Tendinopathy-related Sciatic Nerve Entrapment (PHTrSNE): Case Report
Hermoso, J., Bailey, G., Bhatti, K., Sneed, J.
The AAO Journal, 2024/09
441

Osteopathic Considerations in the Medical Treatment of a Patient with COVID-Related Respiratory Distress
Yang, Y., Carnes, M., Kingery, J., Stiles, E.
The AAO Journal, 2024/09
442

Evaluation of the clinical effectiveness of osteopathic gallbladder drainage techniques
(Оценка клинической результативности остеопатических техник дренирования желчного пузыря)
Belash, V. O., Zavadsky, E. Y., Zueva, A. I.
Russian Osteopathic Journal, 2024/09
443

Influence of a single osteopathic procedure on the regulatory processes of the body of premature infants (pilot study
(Влияние однократной процедуры остеопатической коррекции на регуляторные процессы организма недоношенных детей (пилотное исследование)
Belyaev, A. F., Yurchenko, M. S., Kharkovskaya, T. S., Kurleeva, T. Y., Akhtanina, E. A.
Russian Osteopathic Journal, 2024/09
444

Osteopathic status and quality of life of pregnant women in megacities
(Остеопатический статус и качество жизни беременных в мегаполисах)
Nenashkina, E. N., Tregubova, E. S., Davletshina, L. T., Kozlova, O. P.
Russian Osteopathic Journal, 2024/09
445

Chronic Rhinosinusitis Management: A Narrative Review Comparing Interventional Treatment With Osteopathic Manipulation
Klover, C. R., Gorantla, V. R.
Cureus, 2024/09
Free full text
446

„Wie der Ast gebogen wird, so wächst der Baum“
Teichmann, P.
Skeptiker, 2024/09
447

Response to “Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection“
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2024/09
Free full text
448

Available Treatments and Adjunctive Therapies for Polycystic Ovarian Syndrome (PCOS) Patients of Reproductive Age: A Scoping Review
Cochran, L., Nadolny, R., Garcia, K., Kluglein, K. A., Yagoda, A., Gandhi, P., Dressel, J., Prol, B., Peralta, R., Shipp, A., Costin, J. M.
Cureus, 2024/09
Free full text
449

Investigating the safety and feasibility of osteopathic manipulative medicine in hospitalized children and adolescent young adults with cancer
Belsky, J. A., Brown, A. M.
Journal of Osteopathic Medicine, 2024/09
Free full text
450

Effects of Osteopathic Manipulative Treatment (OMT) on Lower Extremity Muscle Characteristics in Parkinson's disease (PD) Patients
Radigan, R., Finkelstein, A., Mehra, M., Bhushan, P., Lombardo, T., Yao, S.
Movement Disorders, 2024/09
451

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2024/09
Free full text
452

Tratamiento osteopático integral de la lumbociática L4-L5 post-discectomía
(Comprehensive osteopathic treatment of post-discectomy L4-L5 lumbar sciatica)
Barra Burotto, E.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
453

Efectividad de las manipulaciones vertebrales en pacientes con cefalea de tensión
(Effectiveness of spinal manipulations in patients with tension headaches)
Bohoyo Aramburu, C., Urien Abaunza, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
454

Terapia manual y tratamiento osteopático en el Síndrome del Túnel Capiano
(Manual therapy and osteopathic treatment for Carpal Tunnel Syndrome)
Carleos Mayán, F., Otero Torres, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
455

Efectividad del tratamiento osteopático en el síndrome de dolor pélvico crónico
(Effectiveness of osteopathic treatment in chronic pelvic pain syndrome)
del Pilar Jopia Escobar, M., Leal Blu, C. G., Negrete Fuentes, K. V.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
456

Efectos de la terapia osteopática en pacientes intervenidos quirúrgicamente de esternotomía media por problemas cardíacos
(Effects of osteopathic therapy in patients who have undergone median sternotomy surgery for heart problems)
Garro Sais, C.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
457

Efectividad del tratamiento osteopático en el síndrome subacromial
(Effectiveness of osteopathic treatment in subacromial syndrome)
Izquierdo Aicart, L., Ruiz Rojo, N., Santiago Ramirez, J.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
458

Efectividad del tratamiento osteopático en pacientes con trastorno temporomandibular
(Effectiveness of osteopathic treatment in patients with temporomandibular disorder)
Raisman, M., Muro Ruíz, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
459

Trends in Utilization and Cost of Nonpharmacological Pain Therapies in the United States Under Medicare Part B, 2000-2022
Whedon, J., Zakhary, G.
Journal of Integrative and Complementary Medicine, 2024/09
460

The establishment of conscientious monopolies in rural communities
Bohler, F., Garden, A.
Journal of Osteopathic Medicine, 2024/08
Free full text
461

Data-driven analysis of whole-brain intrinsic connectivity in patients with chronic low back pain undergoing osteopathic manipulative treatment
Tomaiuolo, F., Cerritelli, F., Delli Pizzi, S., Sestieri, C., Paolucci, T., Chiacchiaretta, P., Sensi, S. L., Ferretti, A.
NeuroImage: Clinical, 2024/08
Free full text
462

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text
463

On-site peer mentorship’s effect on personal and professional development, stress reduction, and ease of transition into the medical education system
Whitfield, S., Hazard, C., Haynes, B., Coffey, T., Lynch, L., Davis, S.
Journal of Osteopathic Medicine, 2024/08
464

A Natural Approach to Bell's Palsy: An Osteopathic Treatment Option
Schneider, N., Shih, S., Rundquist, L., Llanio, L., Kurian, A., Ring, A., Barry, P.
Cureus, 2024/08
Free full text
465

A Review on Osteopathic Manipulation in Patients With Headache
Sharath, H. V., Nadipena, P. T., Qureshi, M. I., Phansopkar, P.
Cureus, 2024/08
Free full text
466

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text
467

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08
468

Musculoskeletal Healthcare Professionals' perspectives on objective postural assessment (Expectation and Experience): A UK (Multiprofessional) nationwide survey, 21 August 2024, PREPRINT (Version 1) available at [Journal: Research Square
Martin, D.C., McGuigan, P., Matei, R., Kandasamy, G.
, 2024/08
469

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text
470

The effect of osteopathic manipulative treatment on quality of life in patients with cardiac implantable electronic devices
Nikakis, J., Tale, E., Malkov, D., Arora, U. S., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2024/08
Free full text
471

Post-operative osteopathic manipulative treatment of Morel-Lavallee syndrome assessed using infrared thermal imaging: A case report
Maillot, C., Riquet, D., Stubbe, L., Bodnar, J.L., Houel, N.
Journal of Bodywork and Movement Therapies, 2024/07
Free full text
472

The short- and long-term effect of osteopathic manipulative treatment on pain, and psychosocial factors in adults with chronic low back pain
Nicodemus, C. L., Epstein, J., Huebner, M., DeCicco, B., Shaik, M.
Journal of Osteopathic Medicine, 2024/07
Free full text
473

Effects of a novel osteopathic visceral technique for the pancreas on pain and range of motion in a patient with neck pain: Case report
Ferreira Faria, M. Â.
Journal of Bodywork and Movement Therapies, 2024/07
474

How completely are randomized controlled trials of non-pharmacological interventions following concussion reported? A systematic review
van Ierssel, J. J., Galea, O., Holte, K., Luszawski, C., Jenkins, E., O', Neil, J., Emery, C. A., Mannix, R., Schneider, K., Yeates, K. O., Zemek, R.
Journal of Sport and Health Science, 2024/07
Free full text
475

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text
476

Interoceptive bodily awareness in patients seeking pain relief with osteopathic manipulative treatment: an observational cohort pilot study
Emmet, D. K., Davis, G., Pierce-Talsma, S., Shubrook, J. H., Mehling, W.
Journal of Osteopathic Medicine, 2024/07
Free full text
477

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07
478

Kraft- und Spannungsübertragung in der unteren Extremität
(Transmission of force and tension in the lower extremity)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
479

The Effects of Osteopathic Manipulative Treatment on Brain Activity: A Scoping Review of MRI and EEG Studies
Bonanno, M., Papa, G. A., Ruffoni, P., Catalioto, E., De Luca, R., Maggio, M. G., Calabrò, R. S.
Healthcare, 2024/07
Free full text
480

Alternative Therapies for Ankyloglossia-Associated Breastfeeding Challenges: A Systematic Review
Chowdhury, R., Khoury, S., Leroux, J., Alsayegh, R., Lawlor, C. M., Graham, M. E.
Breastfeeding Medicine, 2024/07
481

Osteopathie bei Gliedergürtelmuskeldystrophie Miyoshi 3
(Osteopathy for Limb-girdle muscular dystrophy Miyoshi 3)
Ritter, C. I.
Unpublished MSc thesis, 2024/07
Free full text
482

A 25-year-old woman with 7 years of intractable hiccups treated with OMT – A case report
Bowman, D. E., Pohlod, C.
International Journal of Osteopathic Medicine, 2024/06
483

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text
484

Responsiveness to osteopathic manipulative treatments in people with non-specific low back pain: A secondary analysis of the LC-OSTEO trial
Rören, A., Yagappa, D. M., Zegarra-Parodi, R., Fabre, L., Krief, G., Daste, C., Lefèvre-Colau, M. M., Rannou, F., Nguyen, C.
Annals of Physical and Rehabilitation Medicine, 2024/06
485

Tumid lupus masquerading as rosacea
Ambur, A. B., Khalid, M., Ambur, A. B., Kaya, K., Nathoo, R.
Journal of Osteopathic Medicine, 2024/06
Free full text
486

Comorbidities associated with symptoms of subjective cognitive decline in individuals aged 45–64
Monahan, Z., Heath, J., Santos, A. D., Ford, A., Hartwell, M.
Journal of Osteopathic Medicine, 2024/06
Free full text
487

Effects of osteopathic manipulative therapy on recurrent pelvic pain and dyspareunia in women after surgery for endometriosis: a retrospective study
Alboni, C., Melegari, S., Camacho Mattos, L., Farulla, A.
Minerva Obstetrics and Gynecology, 2024/06
488

Osteopathie und inneres Wohlbefinden bei Menschen mit chronischer Erkrankung
(Osteopathy and inner well-being by people with chronic illness)
Fachinger, B. C.
Unpublished MSc thesis, 2024/06
489

Risiken und Komplikationen der zervikalen Manipulation
(Risks and adverse events of cervical manipulation)
Feil-Santos, M.
Unpublished MSc thesis, 2024/06
490

Der Einfluss von Osteopathie auf Schluckstörung und Erbrechen bei CMS
(The influence of osteopathy on dysphagia and vomiting in CMS)
Hinterreither, R.
Unpublished MSc thesis, 2024/06
491

Osteopathie bei Trinkschwierigkeiten Neugeborener
(Osteopathy for feeding dysfunctions in newborns)
Hofko, P.
Unpublished MSc thesis, 2024/06
492

Osteopathie bei Frühgeborenen-Effekte auf klinische Parameter. Ein systematischer Review
(Osteopathy in premature babies-effects on clinical parameters. A systematic review)
Kaineder, G.
Unpublished MSc thesis, 2024/06
493

Der Einfluss von Osteopathie auf Spastik bei einer Multiple Sklerose (MS) Patientin
(The influence of osteopathy on spasticity in a multiple sclerosis (MS) patient)
Pleister, M.I.
Unpublished MSc thesis, 2024/06
494

Reported biological effects following Osteopathic Manipulative Treatment: A comprehensive mapping review
Dal Farra, F., Bergna, A., Lunghi, C., Bruini, I., Galli, M., Vismara, L., Tramontano, M.
Complementary Therapies in Medicine, 2024/06
495

Effects of Osteopathic Manipulative Treatment (OMT) on the Thoracic Duct via Ultrasound Imaging
Atkinson, E., Kawachi, S., Kozar, A. J.
The AAO Journal, 2024/06
496

From finger to breast: OMT helps latch
Barr, J., O'Donnell, A.
The AAO Journal, 2024/06
497

Osteopathic Manipulative Treatment, a Novel Adjunct in Sickle Cell Disease Care: Interim Safety and Feasibility Analysis
Brown, A., Eyassu, E., Hoffmann, L., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
The AAO Journal, 2024/06
498

The Role of Osteopathic Structural Findings in Meningitis
Cecil, E., Burke, D.
The AAO Journal, 2024/06
499

Efficacy of Osteopathic Manipulative Treatment in Post-Stroke Recovery Patients
Dalton, D., Walker, A., Vu, P., Medina, C.
The AAO Journal, 2024/06
500

OMT Improves Diaphragm Range of Motion on Ultrasound Imaging
DiSabato, X., Atkinson, E., Kozar, A. J., Robinson, L., Dixon, E.
The AAO Journal, 2024/06
501

OMT in Headache Management: Systematic Review and Meta-Analysis Protocol
Gibson, E., Will, M., Garcia, C. J., Johnson, R., Kirsch, J. R., Spencer, D. V., Wang, M. Y.F., Rehman, Y., Snider, K. T.
The AAO Journal, 2024/06
502

Osteopathic correction in the complex treatment of women of reproductive age with pelvic organ prolapse
(Остеопатическая коррекция в комплексном лечении женщин репродуктивного возраста с пролапсом тазовых органов)
Bakanova, A. R., Lebedev, D. S., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/06
503

The role of diaphragmatic motion in peritoneal lymphatic absorption examined in case of splenic rupture
King, C., Ettlinger, H.
The AAO Journal, 2024/06
504

The Role of Osteopathic Manipulative Treatment in a Case of Pediatric Craniosynostosis
Kurup, D., Ettlinger, H.
The AAO Journal, 2024/06
505

Short leg syndrome in clinical practice
(Синдром короткой ноги в клинической практике)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06
506

More Than a Pain in the Butt: Response to OMT as a diagnostic aid to identify arterial gluteal claudication
Mather, M., Schaefer, M.
The AAO Journal, 2024/06
507

Evaluating the effects of Osteopathic Manipulative Treatments in Pregnancy: Comparing the difference between outpatient versus inpatient treatments on incidence rates of C sections
Politi Gonzalez, C., Torres, J.
The AAO Journal, 2024/06
508

The case for Frequency Specific Microcurent in combination therapy of an acute forearm injury
Shah, A., Johnson, A.
The AAO Journal, 2024/06
509

Dynamic styles of osteopaths based on assessment of the bioelectrical activity of the brain using the method of mathematical analysis of a first-order multivariate structural function
(Динамические стили остеопатов на основе оценки биоэлектрической активности мозга с применением метода математического анализа мультивариативной структурной функции первого порядка)
Piskunova, G. E., Trifonov, M. I., Panasevich, E. A., Belyaev, A. F.
Russian Osteopathic Journal, 2024/06
510

Keeping the MonSter Under Control: The Role of Osteopathic Manipulative Therapy (OMT) in Characterization and Management of Chronic Pain in Multiple Sclerosis
Song, Y. J., Faruque, R., Hall, T., Waddington, M.
The AAO Journal, 2024/06
511

Seize the Dura: An Osteopathic Approach to Postictal Delirium
Vijayakar, R., Obialo, S., Nixon, K.
The AAO Journal, 2024/06
512

Hat die osteopathische Behandlung einen Einfluss auf persistierende Symptome unter Hormonersatztherapie bei Frauen mit einer Hashimoto-Thyreoiditis? Prä-Post-Studie.
(Does individual osteopathic treatment influence persistent symptoms under hormone replacement therapy in women with Hashimoto´s thyreoiditis? A pre-post study )
Kriehmig, S., Vetter, A., Rüdrich, K.
Unpublished D.O. thesis, 2024/06
513

An Osteopathic Approach to Prolonged Surgical Scar and Epidural Site Pain after Cesarean Section: A Case Study
Whitaker, Z., Gailius, G.
The AAO Journal, 2024/06
514

Die osteopathische Behandlung von Patienten mit idiopathischem Parkinson-Syndrom. Prä-Post-Studie.
(Does individual osteopathic treatment influence Parkinson´s disease-specific health related quality of life in patients suffering from idiopathic Parkinson´s disease?
Schellhase, M., Schröter, C.
Unpublished D.O. thesis, 2024/06
515

Workin’ 9 to 5, but Now Can Thrive: Chronic Headache Diagnosed and Treated with OMT
Bernett, A. M., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06
516

Piriformis or Not Piriformis? The Impact of OMT on Buttock and Hip Pain: A Case Report
Blankenbaker, J., Ural, E.
The AAO Journal, 2024/06
517

Osteopathic Management of Bertolotti Syndrome
Bowen, A., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06
518

Resolution of Notalgia Paresthetica Symptoms following Osteopathic Manipulative Treatment (OMT): A Case Report
Bressler, K., Macmillan, G., Mancini, J., Yao, S. C., Papadopoulos, D., Abu-Sbaih, R.
The AAO Journal, 2024/06
519

Invasive Beatmung und prolongiertes Weaning: Auswirkungen osteopathischer Techniksequenzen
(Invasive ventilation and prolonged weaning. Effects of osteopathic sequences of techniques)
Boehme, A., Thönnessen, P., Ibel, R.
Osteopathische Medizin, 2024/06
520

Oh Snap! Osteopathic Treatment of Tendon Rupture with Link to Long Term Statin Use
Carpinelli, S., Richie, C.
The AAO Journal, 2024/06
521

Response to Osteopathic Manipulative Treatment in a Newborn with Breastfeeding Difficulties: A Case Report
Coxon, J., Gannon, T. M.
The AAO Journal, 2024/06
522

Comparison of the effects of abdominal massage and osteopathic manipulative treatment home program on constipation in children with cerebral palsy
Chatip, A. T., Acar, G., Akçay, A. A.
JGH Open, 2024/06
Free full text
523

Osteopathic Management of Chronic Pain Following Bilateral Periacetabular Osteotomy in Developmental Hip Dysplasia
Edgar, T., Heller, G. R., Hutson, M., Melin, D., Bardowell, A.
The AAO Journal, 2024/06
524

Manual Therapy Interventions in Patients With Chronic Obstructive Pulmonary Disease: A Comprehensive Narrative Review
Chilhate, P. K., Lalwani, L.
Cureus, 2024/06
Free full text
525

“I walk funny and I don’t know why,” Osteopathic manipulative treatment for an adult female with congenital bilateral Femoral Neck Anteversion (FNA)
Fredrickson, T., Broussard, D., Waters, H.
The AAO Journal, 2024/06
526

Osteopathie, was bist du?: Homo- und Heterogenität zwischen osteopathischen und manualmedizinischen Techniken
(Osteopathy, what are you?: Homogeneity and heterogeneity between osteopathic and manual medicine techniques)
Engel, M.
Osteopathische Medizin, 2024/06
527

Stagnating the Symptomatic Progression of Primary Lateral Sclerosis
Geyer-Roberts, E., Desai, B., Perez, J., Grote, J., Helderlein, P., Posey, A.
The AAO Journal, 2024/06
528

Development of an Osteopathic Manipulative Treatment Clinician-Parent Home Care Education Intervention for Children with Otitis Media
Krzykwa, E., Pietrantoni, D., Waters, H.
The AAO Journal, 2024/06
529

Transforming Fibromyalgia Care: An Osteopathic Route to Improving Quality of Life
Kurian, A., Schneider, N., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06
530

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06
531

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06
532

A case report of improvement of isolated abducens nerve palsy following osteopathic manipulative treatment
Maddie, N., Keys, J.
The AAO Journal, 2024/06
533

Effects of OMT on Blood Glucose and Insulin Sensitivity in Adult Male Rats
Petrillo, G., Staudt, M., Lobo, S., Cai, W., Keys, J.
The AAO Journal, 2024/06
534

OMT in the 21st century: current use of technologies in manual therapy education and opportunities for innovation
Pietrantoni, D., Krzykwa, E., Broussard, D., Fredrickson, T., Waters, H., Mehra, R.
The AAO Journal, 2024/06
535

Osteopathische Behandlung neuropathischer Nacken- und Beckenbodenschmerzen
(Osteopathic treatment of neuropathic neck and pelvic floor pain)
Peuker, E.
Osteopathische Medizin, 2024/06
536

Osteopathic Manipulative Treatment in Occipital Neuralgia
Ring, A., Llanio, L., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06
537

An Osteopathic Approach to Cervicogenic Vertigo
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2024/06
538

Severe Eczema and Hair Growth Improvements with Osteopathic Manipulative Treatment (OMT) in Pediatric Patient: A Case Study
Sanchez, E., Papadopoulos, D., Yao, S. C., Abu-Sbaih, R.
The AAO Journal, 2024/06
539

An Osteopathic Approach to Temporomandibular Dysfunction Secondary to A Motor Vehicle Accident
Schneider, N., Kurian, A., Widboom, N., Qureshi, Y.
The AAO Journal, 2024/06
540

An Osteopathic Approach to Eyelid Myokymia
Shih, S., Rundquist, L., Qureshi, Y.
The AAO Journal, 2024/06
541

Learning Mindsets and Well-Being and Ill-Being Among Osteopathic Medical Students
Tibbetts, Y., Himmelberger, Z. M., Barron, K. E., Speicher, M. R., Hulleman, C. S.
JAMA Network Open, 2024/06
Free full text
542

Effect of Osteopathic Manipulative Treatment (OMT) for Symptomatic Headache Relief in Long-COVID Patient: A Case Report
Unser, K., Thomas, A., Cornwell, S., Yao, S. C., Keys, J.
The AAO Journal, 2024/06
543

Osteopathic Manipulative Medicine and Disorders: An Overview of Peer-Reviewed Publications 2018-2022
White, C., Xie, Y., Bigham, J., Stanczak, A., Ninan, D., Hu, C. A.
Cureus, 2024/06
Free full text
544

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06
545

Reducing Blood Pressure: Use of Osteopathic Manipulative Treatment (OMT) as Adjunct Therapy in Treating Uncontrolled Hypertension
Voas, A., Wirth, K., Delaney, C., Li, V., Figueroa, J. S.
The AAO Journal, 2024/06
546

Case Study: The Effect of Osteopathic Manipulation on Diabetic Gastroparesis
Yazdi, S. A., Tucker, D., Hwang, G., Majeed, A., Hsubrook, J. H., Penq, N.
The AAO Journal, 2024/06
547

Berücksichtigung sozialer Faktoren in der Patient*innen-Osteopath*innen-Beziehung Eine qualitative Interviewstudie vor der Theorie des Enaktivismus
Mayrl, E.
Unpublished MSc thesis, 2024/06
548

Increased Alertness in Comatose Patient After Osteopathic Manipulative Treatment: A Case Report
Garcia, A. E., Kay, K., Perera, M. X., Martinez, E. S., Onyi, S., Nourani, B., Loveless, B.
The AAO Journal, 2024/06
549

An Alternative Approach to Median Arcuate Ligament Syndrome
Geyer-Roberts, E., Wallace-Ross, J.
The AAO Journal, 2024/06
550

Successful Treatment using OMT for Chronic GERD in a Pediatric Patient
Shams, S., Chohan, M. M., King, A.
The AAO Journal, 2024/06
551

Osteopathic Approach to the Voice
Surve, S.
The AAO Journal, 2024/06
552

Post-surgical Median Arcuate Ligament Syndrome (MALS) Symptom Exacerbation Treated With Osteopathic Manipulative Treatment (OMT): A Case Report
Volokitin, M., Bergman, A.
Cureus, 2024/06
Free full text
553

Der unmittelbare Effekt der Allgemeinen Osteopathischen Behandlung (AOB) auf die posturale Kontrolle bei Patienten/Patientinnen nach Schlaganfall. Eine randomisierte kontrollierte Studie
(The immediate effect of general osteopathic treatment (AOB) on postural control in patients after stroke. A randomized controlled trial)
Brunner, M.
Unpublished MSc thesis, 2024/05
554

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic low back pain: a single-blinded randomized controlled trial
Popovich, J. M., Cholewicki, J., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan, A.
Journal of Osteopathic Medicine, 2024/05
Free full text
555

Interventions to promote medical student well-being: an overview of systematic reviews
Bennett-Weston, A., Keshtkar, L., Jones, M., Sanders, C., Lewis, C., Nockels, K., Solomon, J., Howick, J.
BMJ Open, 2024/05
Free full text
556

Immediate Effects of Integrative Health and Medicine Modalities Among Outpatients With Moderate-To-Severe Symptoms
Rodgers-Melnick, S. N., Srinivasan, R., Rivard, R. L., Adan, F., Dusek, J. A.
Global Advances in Integrative Medicine and Health, 2024/05
Free full text
557

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05
558

Efficacy of Osteopathic Manipulative Treatment for Pain Reduction in Patients With Patellofemoral Pain Syndrome: A Meta-Analysis of Randomized Controlled Trials
Delgadillo, B. E., Bui, A., Debski, A. M., Miller, B., Wu, S. S.
Cureus, 2024/05
Free full text
559

The Effects of Osteopathic Manipulative Treatment (OMT) on Postoperative Length of Stay: A Meta-Analysis
Henwood, L., Le Donne, M. E., Vaughn, A., Kamil, S., Harrington, A., Scott, R.
Cureus, 2024/05
Free full text
560

Effects of Osteopathic Manipulative Treatment Alone or in Combination With Respiratory Training on Chest Wall Expansion, Functional Mobility, and Dyspnea Level in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
American Journal of Respiratory and Critical Care Medicine, 2024/05
561

The Efficacy of Early Osteopathic Therapy in Restoring Proper Sucking in Breastfed Infants: Preliminary Findings from a Pilot Study
Parodi, A., Ruffa, R., De Felice, V., Sartini, M., Cristina, M. L., Martino, B., Bianco, F., Di Stefano, R., Mazzella, M.
Healthcare, 2024/05
Free full text
562

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05
563

Implementing paper-based patient-reported outcome collection within outpatient integrative health and medicine
Srinivasan, R., Rodgers-Melnick, S. N., Rivard, R. L., Kaiser, C., Vincent, D., Adan, F., Dusek, J. A.
PLoS One, 2024/05
Free full text
564

Multi-modal Assessment of Myofascial Trigger Point Response to Osteopathic Manipulation in the Anterior Forearm
Pedapati, C.
Unpublished PhD thesis, 2024/05
565

Manual Therapy of Dysphagia in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
De Marchi, I., Buffone, F., Mauro, A., Bruini, I., Vismara, L.
Medicina, 2024/05
Free full text
566

Effects of osteopathic manipulative treatment on children with plagiocephaly in the context of current pediatric practice: a retrospective chart review study
King, H. H., Mai, J., Morelli Haskell, M. A., Wolf, K., Sweeney, M.
Journal of Osteopathic Medicine, 2024/04
Free full text
567

Effect of osteopathic manipulative treatment and Bio-Electro-Magnetic Energy Regulation (BEMER) therapy on generalized musculoskeletal neck pain in adults
Palmer, G. M., Dominick, N., Kane, M., Bawek, S., Burch, B., Sanders, T., Phrathep, D., Myers, N., Lorenzo, S.
Journal of Osteopathic Medicine, 2024/04
Free full text
568

The effectiveness of an osteopathic manual technique compared with a breathing exercise on vagal tone as indicated by heart rate variability, a crossover study
Cavanagh, M., Cope, T., Smith, D., Tolley, I., Orrock, P., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text
569

Effekte der Osteopathie auf posturale Säuglingsasymmetrien und den Stillprozess
(Effects of osteopathy on infant postural symmetry disorders and the breastfeeding process)
Elsässer, S.
Unpublished MSc thesis, 2024/04
570

Effect of manual osteopathic techniques on the autonomic nervous system, respiratory system function and head-cervical-shoulder complex—a systematic review
Stępnik, J., Czaprowski, D., Kędra, A.
Frontiers in Medicine, 2024/04
Free full text
571

Lumbar Spinal Stenosis: Diagnosis and Management
Webb, C. W., Aguirre, K., Seidenberg, P. H.
American Family Physician, 2024/04
572

Where are the Black men in osteopathic medical schools?
Megafu, M. N.
Journal of Osteopathic Medicine, 2024/04
Free full text
573

Overview of Treatment Options for Mild Traumatic Brain Injury: A Literature Review
Patel, H., Polam, S., Joseph, R.
Cureus, 2024/04
Free full text
574

Quelle est la place de la respiration du·de la patient·e lors d’une consultation ostéopathique chez les ostéopathes pratiquant en Suisse : une étude qualitative phénoménologique
(What is the place of the patient's breathing during an osteopathic consultation among osteopaths practicing in Switzerland: a phenomenological qualitative study?)
Gremaud, L., Guggisberg, F., Marti, J., Morisetti, L.
Unpublished MSc thesis, 2024/04
Free full text
575

How do Australian osteopaths manage migraines? Outcomes from a national practice-based research network
Fleischmann, M., Vaughan, B., Campbell, C., Ekberg, J., Evans, M., Green, M., Ong, A., Pitrone, G., Lane, R., Adams, J.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text
576

Relational clinical practice: A hermeneutic, enactive, intersubjective model of osteopathy
Banton, A., Vogel, S.
International Journal of Osteopathic Medicine, 2024/03
577

A framework for the interpretation of heart rate variability applied to transcutaneous auricular vagus nerve stimulation and osteopathic manipulation
Kania, A., Roufail, J., Prokop, J., Stauss, H. M.
Physiological Reports, 2024/03
Free full text
578

Comparing the remote effects of dry needling and ischemic pressure on pain intensity and threshold of the myofascial trigger points in women: A Single Blinded Randomized Clinical Trial
Ghanavati, T., Adigozali, H., Rezaei, M., Gilani, N., Ahadi, J.
International Journal of Osteopathic Medicine, 2024/03
579

Osteopathic correction in complex rehabilitation of children who have undergone cochlear implantation
(Остеопатическая коррекция в комплексной реабилитации детей, перенесших кохлеарную имплантацию)
Belash, V. O., Revina, M. B.
Russian Osteopathic Journal, 2024/03
580

The effectiveness of manipulation in combination with exercise for patients with coccydynia: Six months follow-up of a randomized controlled trial
Tufekci, O., Yilmaz, K., Gercek, H., Unuvar, B. S.
International Journal of Osteopathic Medicine, 2024/03
581

Osteopathic correction in the complex therapy of children with astigmatism
(Остеопатическая коррекция в комплексной терапии детей с астигматизмом)
Kiryanova, E. V., Gurichev, A. A.
Russian Osteopathic Journal, 2024/03
582

Rehabilitation after severe gaff disease
(Реабилитация после тяжелого течения гаффской болезни)
Lebedeva, D. I., Turovinina, E. F., Marchenko, A. N., Aptekar, I. A., Raspopova, Y. I., Suvorov, A. Y., Bychenko, S. M.
Russian Osteopathic Journal, 2024/03
583

Osteopathic Approach to a Patient with Recurring Low Back Pain following OMT results in Diagnosis of Underlying Gynecological Etiology: A Case Report
Berkowitz, M. R.
The AAO Journal, 2024/03
Free full text
584

The Use of Osteopathic Manipulative Treatment for a Case of Cervical Radiculopathy
Heineman, K.
The AAO Journal, 2024/03
Free full text
585

The effect of complex treatment including osteopathic correction on pain intensity and quality of life in patients with chronic tonsillitis
(Влияние комплексного лечения с включением остеопатической коррекции на интенсивность боли и качество жизни пациентов с хроническим тонзиллитом)
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushkin, S. A.
Russian Osteopathic Journal, 2024/03
586

An osteopathic approach for a patient with sequela after treatment for a cheek squamous cell carcinoma
Wehner, B. L., Calla, R.
The AAO Journal, 2024/03
Free full text
587

The Effects of Patient-specific Sequenced Osteopathic Manipulative Treatment by AGR on Quality of Life
Yang, Y., Stiles, E., Kingery, J.
The AAO Journal, 2024/03
588

Osteopathic techniques and manual rotation of the fetal head successfully resolve mechanical dystocia
Miletić, A. I., Habek, D., Medić, F.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/03
589

Psychische Gesundheit und somatische Symptombelastung von Patient*innen: Eine Fragebogenstudie
(Mental health and somatic symptom burden of patients: A questionnaire study)
Bobrowski, A., Porthun, J.
Osteopathische Medizin, 2024/03
590

Fallbericht einer psychosomatischen Osteopathie
(Case report of psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2024/03
Free full text
591

Osteopathische Behandlungsmöglichkeiten chronisch entzündlicher Darmerkrankungen: Eine qualitative Analyse von Interviews
(Osteopathic treatment options for chronic inflammatory bowel disease: A qualitative analysis of interviews)
Pestonit, J. F., Hesse, T.
Osteopathische Medizin, 2024/03
592

Osteopathisch-manipulative Behandlung bei herzchirurgischen Patient*innen: Eine systematische Übersicht
(Osteopathic-manipulative treatment in cardiac surgery patients: A systematic review)
Rorris, F.P., Skouteli, E.A. T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
Osteopathische Medizin, 2024/03
593

Der Schluckakt
(The act of swallowing)
Sergueef, N.
Osteopathische Medizin, 2024/03
594

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
595

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
596

A Survey Assessment of Neurosurgeons’ Interest in Osteopathic Medicine and Its Integration Into Their Practice.
Kolmetzky, D W, Gooder, D B, Polly, E S, Glisan, S. N., Al-Atrache, Z., Badger, C. A., Yocom, S. S., Turtz, A. R., Allison, D. L.
Cureus, 2024/03
597

Increased circulating microRNA-21 level as a potential indicator for predicting a higher risk of incident fragility fractures
Si, Z.X., Zhou, S.F., Shen, Z.L., Yan, J.L.
Journal of Osteopathic Medicine, 2024/03
Free full text
598

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03
599

Osteopathic manipulative treatment for pediatric Long-COVID headache: A case report
Danto, S. E., Danto, J. B.
International Journal of Osteopathic Medicine, 2024/03
600

Utility of Osteopathic Manipulation Treatment in MTBI Patients With PPCS and Cervicogenic & Vestibuloocular Profiles
Chen, A., Gross, A., Marshall, J., Anilkumar, A., Patel, N., Maes, L., Mulumba, D., Dusenberry, B.
Clinical Journal of Sport Medicine, 2024/03
601

Investigation of Immediate Effects of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S., Matthias, A., Roush, A., Wilson, H., Nicholas, J., Edwards, C., Mangum, K., Pickett, B.
Clinical Journal of Sport Medicine, 2024/03
602

Meta-epidemiologic review: Blinding and sham treatment in clinical trial design for osteopathic manipulative treatment research
Irving, R., Schmidt, E., Stone, M., Fleming, R. K., Xie, J. Y.
International Journal of Osteopathic Medicine, 2024/03
603

Effect of Osteopathic Manipulation in an Autism Spectrum Child With Speech Impairment and Attention Deficit: A Case Report
Sharath, H. V., Raghuveer, R., Qureshi, M. I., Warghat, P. A., Desai, S., Brahmane, N. A.
Cureus, 2024/03
Free full text
604

Effect of physiotherapy on infertility treatment in polycystic ovary syndrome patients
Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jędrzejczyk, S., Jerzak, M., Jerzak, M.
Przegląd Menopauzalny, 2024/03
605

Osteopathic manipulative treatment for autism spectrum disorder: Three case reports
Wolf, K., Widjaja, F., O'Keefe, W., Chen, Y., Breard, M., Parenteau, C., Keys, J., Riemer, R., Hendren, R. L.
International Journal of Osteopathic Medicine, 2024/03
606

Efectividad del abordaje osteopático en pacientes con fibromialgia
(Effectiveness of osteopathic treatment in patients with fibromyalgia)
García Ruiz, P.
European Journal Osteopathy & Related Clinical Research, 2024/03
Free full text
607

Eficacia de las técnicas de osteopatía en la dismenorrea
(Effectiveness of osteopathic techniques in dysmenorrhea)
Romero Rodríguez, T., Ruiz Martínez, A., Fernández Villamarín, E.
European Journal Osteopathy & Related Clinical Research, 2024/03
608

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03
609

Effects of osteopathic manipulative treatment on maternal-fetal hemodynamics in third trimester pregnant women: A prospective study
Arruda Correia, M. L., Peixoto Filho, F. M., Gomes Júnior, S. C., de Jesus, G. R.
PLoS One, 2024/03
Free full text
610

Potential mechanisms for osteopathic manipulative treatment to alleviate migraine-like pain in female rats
Byrd, K., Lund, M., Pan, Y., Chung, B. H., Child, K., Fowler, D., Burns-Martin, J., Sanikommu, M., Henderson, H., Gregory, C., Fleming, R. K., Xie, J. Y.
Frontiers in Pain Research, 2024/02
Free full text
611

Osteopathic approach as an additional therapy of infertility in women with PCOS
Jędrzejczyk, S., Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jerzak, M., Jerzak, M.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/02
612

Osteopathic Manipulative Treatment for Chronic Neck Stiffness After a Motor Vehicle Collision: A Case Report
Jost, J. M., Stoll, V. K., Waters, H. B.
Cureus, 2024/02
Free full text
613

The endogenous oxytocin after manipulative osteopathic treatment in full-term pregnant women
Ragusa, A., Svelato, A., Fogolari, M., Ficarola, F., Plotti, F., De Luca, C., D'Avino, S., Davini, F., De Cesaris, M., Messina, G., Bertolini, A., Marci, R., Angeletti, S., Angioli, R., Terranova, C.
European Review for Medical and Pharmacological Sciences, 2024/02
614

Knowledge Mapping Analysis of Research on Pregnancy-Related Pelvic Girdle Pain (PPGP) from 2002 to 2022 Using Bibliometrics
Xu, L., Li, Y., He, Y., Chen, M., Zhang, Y., Liu, C., Zhang, L.
Journal of Pain Research, 2024/02
Free full text
615

Application Of Osteopathic Treatment for Non-Pain–Related Discomforts of Pregnancy: A Literature Review
Gomperts, J., Carroll, L., Powers, B., Rodriguez, A.
Osteopathic Family Physician, 2024/02
616

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02
617

Osteopathic Approach in the Stimulation of the Endocannabinoid System: A Case Report
Buonomini, C., Bonetti, O., Novelli, E.
Cureus, 2024/02
618

Identified strategies to mitigate medical student mental health and burnout symptoms
Ozan, K. G., McGough, J. E. G., Gabel, J., Snow, M., Michel, N., Cooper, L., Robinson, K.
Journal of Osteopathic Medicine, 2024/02
Free full text
619

Transrectal osteopathic manipulation treatment for chronic coccydynia: feasibility, acceptability and patient-oriented outcomes in a quality improvement project
Nourani, B., Norton, D., Kuchera, W., Rabago, D.
Journal of Osteopathic Medicine, 2024/02
Free full text
620

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text
621

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text
622

Interdisciplinary Approach to Orthodontic Treatment Involving an Osteopath and a Dentist (Protocol)
Aptekar, I. A., Abramova, E. V., Postnikov, M. A., Kopetsky, I. S., Eremin, D. A., Postnikova, E. M., Poluianova, E. B., Aptekar, V. I., Muravyov, I. O.
Bulletin of Russian State Medical University, 2024/02
Free full text
623

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text
624

Osteopathic Manipulative Treatment in Dysmenorrhea: A Systematic Review
Bonner, P. E., Paul, H. A., Mehra, R. S.
Cureus, 2024/01
Free full text
625

Raynaud’s phenomenon
Humpel, O., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/01
Free full text
626

The Effect of the Coronavirus (COVID-19) Pandemic on Gender and Medical School Diversity in Gastroenterology Fellowship Matching
Almujarkesh, M. K., Alsakarneh, S., Almeqdadi, M., Al Ta'ani, O., Mohamad, B., Kinnucan, J.
Gastro Hep Advances, 2024/01
Free full text
627

Wie wirksam ist die osteopathische Behandlung von Kindern?
(How effective is osteopathic treatment for children?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
628

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
629

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
630

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
631

Massage-like stroking produces analgesia in mice
Waarala, Z. M. S., Comins, L., Laumet, S., Folger, J. K., Laumet, G.
Neurobiology of Pain, 2024/01
Free full text
632

Antitumoral Agent-Induced Constipation: A Systematic Review
Calsina-Berna, A., González-Barboteo, J., Llorens-Torromé, S., Julià-Torras, J.
Cancers, 2024/01
Free full text
633

Integrating Osteopathic Principles for Enhanced Dermatological Outcomes: A Literature Review
Ventura, N., Soti, V.
Cureus, 2024/01
Free full text
634

Peut-on protocoliser l’ostéopathie? Doit-on toujours manipuler L5 en cas de sciatalgie type L5?
(Could Osteopathy Be Protocolized? Should We always Manipulate L5 in Case of L5 Sciatica?)
Bœuf, M., Brun, L.
Douleur et Analgesie, 2024/01
635

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12
636

Assessment of Long-term Effects of Adding Osteopathic Manipulative Treatment to Neck Exercises for Individuals With Non-specific Chronic Neck Pain: A Randomized Trial
Groisman, S., da Silva, L., Sanches, T., Rocha, C., Malysz, T., Jotz, G.
Journal of Chiropractic Medicine, 2023/12
637

„Alles im Griff” – Osteopathischer Universalgriff für das Kniegelenk
(“Everything under control“ - Osteopathic universal grip for the knee joint)
Engel, M.
Osteopathische Medizin, 2023/12
638

Osteopathie als Beruf: Zur Praxeologie des osteopathischen Handelns
(Osteopathy as a profession: The praxeology of osteopathic practice)
Kaiser, A. K.
Osteopathische Medizin, 2023/12
639

(Gender competence in medicine and osteopathy)
Wikus, P., Wimpissinger, A.
Osteopathische Medizin, 2023/12
640

Comparison of Prevalence of Chapman’s Points In Subjects With Dysmenorrhea
Naeem, A., Castro, T., Guha, A., Companion, N., Abu-Sbaih, R., Keys, J., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
641

Investigating the current published literature where osteopathic manual therapy is used as an intervention: A scoping review
Ryan, H., Friedlander, T., Anderson, H., Mason, J.
International Journal of Osteopathic Medicine, 2023/12
642

Osteopathic Manipulative Treatment for Chronic Bronchiectasis: A Case Report
Abend, D., Powell, L., Sivanandam, A., Nayar, R.
Osteopathic Family Physician, 2023/12
643

An Osteopathic Approach to Urinary Incontinence Including Biopsychosocial Aspects and Multiple Modalities for a Holistic Approach to Optimize Ongoing Care
Trivelas, N., Slaughter, K., Zaremski, K., Kirila, C.
Osteopathic Family Physician, 2023/12
644

The use of osteopathic correction in the treatment of patients with sciatic neuropathy
(Применение остеопатической коррекции в терапии пациентов с седалищной нейропатией)
Belash, V. O., Frolov, V. A.
Russian Osteopathic Journal, 2023/12
Free full text
645

The effect of general osteopathic treatment on muscle tone according to electromyography data
(Влияние общего остеопатического лечения на тонус мышц по данным электромиографии)
Cherednikova, N. V., Zhang, V. F., Potekhina, Y. P., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/12
Free full text
646

Osteopathic status and quality of life of healthy pregnant women
(Остеопатический статус и качество жизни здоровых беременных)
Davletshina, L. T., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/12
Free full text
647

The physical development of modern children and teenagers of the Nizhny Novgorod region
(Физическое развитие современных детей и подростков Нижегородской области)
Kalyuzhny, E. A., Bogomolova, E. S., Mukhina, I. V., Kurnikova, A. A., Vorobiev, V. G., Mustafin, R. N., Batsevich, V. F., Gorbacheva, A. K., Fedotova, T. K., Khomyakova, I. A.
Russian Osteopathic Journal, 2023/12
Free full text
648

The possibility of reversibility of liver fibrosis under the influence of complex treatment
(Возможность обратимости фиброза печени под влиянием комплексного лечения)
Kozhokina, S. G.
Russian Osteopathic Journal, 2023/12
Free full text
649

Osteopathic Manipulative Treatment for the Management of Irritable Bowel Syndrome: A Case Report
Heineman, K.
The AAO Journal, 2023/12
Free full text
650

An Osteopathic Approach to Vertigo with Galbreath Technique: A Case Report
Hurrle, S., Matz, O., Vo, C., Lewis, D. D.
The AAO Journal, 2023/12
Free full text
651

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text
652

Mental health differences in medical students based on curriculum and gender
Jestin, M., Sharma, S., Jhaveri, D., Mitchell, B., Micciche, D., Venkataraman, V., Lambert, K.
BMC Medical Education, 2023/12
Free full text
653

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12
654

Preliminary Evaluation of an Osteopathic Manipulative Treatment to Prevent Motion Sickness
Thomas, V. A., Kelley, A. M., Lee, A., Fotopoulos, T., Boggs, J., Campbell, J.
Aerospace Medicine and Human Performance, 2023/12
655

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12
656

Analysis of alternate material Onyx™ for total knee arthroplasty instrumentation sets
Gregg, N., Kendrick, A. M., Carter, J. M., Gittins, M. E., MacNeill, S. C.
Journal of Osteopathic Medicine, 2023/12
Free full text
657

Lichen planus pigmentosus inversus: a rare clinical variant
Obeng-Nyarko, C. N., Dazé, R., Dorton, D.
Journal of Osteopathic Medicine, 2023/12
Free full text
658

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/12
Free full text
659

The Influence of Osteopathic Manipulative Treatment (OMT) on Cognitive Performance and Recovery Following a Sport-Related Concussion
Bennett, R., Peart, Z., Brett, J., Posey, A.
Journal of Osteopathic Medicine, 2023/12
660

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12
661

Safety and Efficacy of Osteopathic Manipulative Treatment (OMT) in the Pediatric Oncology Inpatient Setting
Brown, A., Hoffman, L., Eyassu, E., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
Journal of Osteopathic Medicine, 2023/12
662

OMT Alleviated Migraine-Like Pain via Blockade of Trigeminal Activation
Child, K., Fowler, D., Pan, Y., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2023/12
663

Retrospective Study of Osteopathic Manipulative Treatment Use for Pain in Patients with Ehlers Danlos Syndromes and Hypermobility Spectrum Disorder (EDS/HSD)
Chung, M. J., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
664

Investigation of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S. P., Matthias, A., Roush, A. J., VanderMerwe, D., Starr, E. G., Wong, W. J., Parker, L. M., Nicholas, J. M., Wilson, H.
Journal of Osteopathic Medicine, 2023/12
665

Cranial Osteopathic Manipulation Alters Alzheimer’s Disease Phenotype in Wild Type and Transgenic Rats
Hines, D. Y., Tobey, H., Kwaspisz, L., Ingram, A., Duggan, P., Boehringer, S., Piwowarski, J., Ramanathan, A., Anandakrishnan, R.
Journal of Osteopathic Medicine, 2023/12
666

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
667

Use of osteopathic manipulative treatment in management of intractable singultus and associated symptoms
Bloch, R. R., Kempa, M. R., Lippert, J. A.
International Journal of Osteopathic Medicine, 2023/12
668

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12
669

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12
670

The Efficacy of Osteopathic Manipulation Treatment (OMT) on Post-Operative Outcomes: An Abstract
Reddy, P., Santhakumar, K.
Journal of Osteopathic Medicine, 2023/12
671

Assessing Correlation Between Manual Dexterity, Specialty Choice and Desire to Practice OMT in Newly Admitted Osteopathic Medical Students
Rome, V., Brolis, N.
Journal of Osteopathic Medicine, 2023/12
672

Efficacy of Osteopathic Manipulation Therapy in the Treatment of Post-concussive Versus Primary Migraines
Song, J., Hall, T., Waddington, M.
Journal of Osteopathic Medicine, 2023/12
673

Analyzing ChatGPT’s Proficiency In Multiple Choice Osteopathic Manipulative Medicine Questions: Insights and Implications
Sundin, A., Gawash, A., Zia, H., Lo, D. F., Averell, N., King, A., Powell, L.
Journal of Osteopathic Medicine, 2023/12
674

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
Free full text
675

Valid and Invalid Indications for Osteopathic Interventions: A Systematic Review of Evidence-Based Practices and French Healthcare Society Recommendations
Khalaf, Z. M., Margulies, P., Moussa, M. K., Bohu, Y., Lefevre, N., Hardy, A.
Cureus, 2023/11
Free full text
676

Time Until Proof of Credentials Significantly Decreases With the Use of Blockchain Technology and the Document Management System
Tissier, E. A., Berglund, A., Johnson, G. J., Sanzone, Z. A., Goodbread, A. P., Parker, H., Lucas, J., Kashmer, D.
Cureus, 2023/11
Free full text
677

Hat eine osteopathische Behandlung der Membrana obturatoria Einfluss auf die Range-of-Motion des Hüftgelenks? Eine randomisierte kontrollierte Studie
(Does osteopathic treatment of the obturator membrane influence the range of motion of the hip joint? A randomized controlled trial)
Grillnberger, A.
Unpublished MSc thesis, 2023/11
678

Interrater-Reliabilität eines Mobilitätstests der Harnblase bei symptomatischen und asymptomatischen Frauen
(Interrater reliability of a mobility test of the urinary bladder in symptomatic and asymptomatic women)
Hopfner, R.
Unpublished MSc thesis, 2023/11
679

Die Effektivität der osteopathischen Behandlung bei Fibromyalgie: ein systematisches Review
(The effectiveness of osteopathic treatment in Fibromyalgia: a systematic review)
Huber, K. E.
Unpublished MSc thesis, 2023/11
680

Anorexie mentale et médiations somatiques : évaluations croisées de l’ostéopathie et de la psychomotricité sur les préoccupations corporelles
(Osteopathy and Anorexia Nervosa: Cross-evaluations of osteopathy and psychomotricity on bodily concerns)
Mattatia, J., Gaha, N., Cottin, L., Mattatia, D., Morelle, Q., Truong, R., Saussé-Corbière, L., Yi, M.K.
Annales Médico-psychologiques, revue psychiatrique, 2023/11
681

Testung der Interrater Reliabilität bei Verwendung der MED-Skala zur Mobilitätstestung des Diaphragmas abdominale
(Testing of interrater reliability when using the MED scale for mobility testing of the abdominal diaphragm)
Pleterski, L.
Unpublished MSc thesis, 2023/11
682

Der Effekt einer osteopathischen Behandlung verglichen mit einer Scheinbehandlung, auf das autonome Nervensystem, gemessen mit der Herzratenvariabilität, bei Long/Post COVID-19 Patienten mit Fatigue Syndrom: Eine klinische randomisierte kontrollierte Studie
(The effect of osteopathic treatment compared with sham treatment on the autonomic nervous system, as measured by heart rate variability, in long/post COVID-19 patients with fatigue syndrome: A clinical randomized controlled trial)
Pöhlmann, T.
Unpublished MSc thesis, 2023/11
683

Osteopathic Manipulative Treatment on Predominantly African American Hospitalized Coronavirus Disease 2019 Patients during Michigan’s First Wave.
Soni, E., Kattan, M., Jackson, N. M., Mainor, I., Corser, W.
MI Medical Education and Health Bulletin, 2023/11
Free full text
684

Emerging treatment of prurigo nodularis with dupilumab
Humpel, O., Fill, L., Hostoffer, R.
Journal of Osteopathic Medicine, 2023/11
Free full text
685

Osteopathie bei Spannungskopfschmerzen - Eine systematische Übersichtsarbeit
(Osteopathy for tension-type headache - a systematic review)
Gollonitsch, P.
Unpublished MSc thesis, 2023/11
Free full text
686

Ein systematischer Überblick über die Wirkung der Osteopathie auf die Atemfunktion bei gesunden und kranken Erwachsenen
(A Systematic Review on the Effect of Osteopathic Treatment on Respiratory Function in Healthy and Sick Adults)
Haas, E.
Unpublished MSc thesis, 2023/11
687

Der Einfluss des „general osteopathic treatment“ (GOT) auf das Gangbild, die Funktionalität und posturale Kontrolle von Schlaganfallpatient*innen. Eine randomisierte kontrollierte Pilotstudie
(The influence of “general osteopathic treatment“ (GOT) on gait, functionality and postural control in stroke patients. A randomized controlled pilot study)
Mühlbauer, T.
Unpublished MSc thesis, 2023/11
688

Effekte von Osteopathie auf Migräne
(Effects of osteopathy on migraine)
Pöchlauer-Schneck, J.
Unpublished MSc thesis, 2023/11
689

Wirksamkeit osteopathischer Techniken bei Endometriose
(Efficacy of osteopathic techniques in endometriosis)
Schiche, S.
Unpublished MSc thesis, 2023/11
690

Hat eine auf Körperflüssigkeit und Diaphragmen basierende osteopathische Behandlung in Kombination mit Physiotherapie eine bessere Wirkung auf die gesundheitsbezogene Lebensqualität bei ambulant betreuten MS-PatientInnen als ausschließlich physiotherapeutische Behandlung?
(Does body fluid and diaphragm-based osteopathic treatment combined with physical therapy have a better effect on health-related quality of life in outpatients with MS than physical therapy alone?)
Shikha, K.
Unpublished MSc thesis, 2023/11
691

Welchen Einfluss hat eine osteopathische Behandlung auf Stress?
(What is the impact of osteopathic treatment on stress?)
Soika, V.
Unpublished MSc thesis, 2023/11
692

Die Wirksamkeit osteopathischer Interventionen auf die Parameter FEV1 and FVC gemessen mittels Spirometrie
(Effectiveness of osteopathic interventions on the spirometric values FEV1 and FVC)
Söllradl, C.
Unpublished MSc thesis, 2023/11
693

Die Wirksamkeit der osteopathischen Therapie als Komplementärmedizin bei PatientInnen mit einer kardiovaskulären Erkrankung Systematischer Review
(The effectiveness of osteopathic manipulative treatment as complementary medicine for patients with cardiovascular disease A systematic review)
Tänzer, M. C.
Unpublished MSc thesis, 2023/11
Free full text
694

Uterusmobilität – eine Inter-Rater-Reliabilitätsstudie
(Uterine mobility test – an inter-rater-reliability study)
Wuschko, M.
Unpublished MSc thesis, 2023/11
695

Placebo analgesia in physical and psychological interventions: Systematic review and meta-analysis of three-armed trials
Hohenschurz-Schmidt, D., Phalip, J., Chan, J., Gauhe, G., Soliman, N., Vollert, J., Lunde, S. J., Vase, L.
European Journal of Pain, 2023/10
Free full text
696

Pericardial Adhesion and Chronic Non-Specific Neck Pain following Thoracentesis: An Osteopathic Approach
Bordoni, B., Escher, A.
Clinics and Practice, 2023/10
Free full text
697

Osteopathic Manipulative Medicine and Its Role in Psychiatry
Bowes, M. R., Speicher, M. R., Tran, L. T., Santiago, P. N.
Cureus, 2023/10
Free full text
698

Implementation of an enhanced recovery after surgery (ERAS) protocol for total abdominal hysterectomies in the division of gynecologic oncology: a network-wide quality improvement initiative
Ackert, K. E., Bauerle, W., Pellegrino, A. N., Stoltzfus, J., Pateman, S., Graves, D., Graul, A., Taylor, N., Zighelboim, I.
Journal of Osteopathic Medicine, 2023/10
Free full text
699

Effect of acupuncture combined with rehabilitation on Postoperative gastrointestinal dysfunction after abdominal operation
Xing, W.
Clinical Nutrition ESPEN, 2023/10
700

A biopsychosocial approach as a part of an osteopathic intervention in the management of chronic prostatitis/chronic pelvic pain: A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2023/10
701

The Use of Osteopathic Manipulative Treatment for Treatment of Sore Throat, Headache, and Facial Pain: A Case Report
Berkowitz, M. R.
The AAO Journal, 2023/09
Free full text
702

From the Editor: Phenomenology and the Development of Expertise in Osteopathy
Ching, L. M.
The AAO Journal, 2023/09
Free full text
703

Case History #4
Coffey, D.
The AAO Journal, 2023/09
Free full text
704

Diagnosis and Treatment of a Dynamic Strain Vector after a Motor Vehicle Accident
Gustowski, S.
The AAO Journal, 2023/09
Free full text
705

Resolution of Stridor, Gastritis and Cephalgia in an Adolescent with Reflex Sympathetic Dystrophy Following Osteopathic Manipulative Treatment—A Case Report
Habenicht, A. L.
The AAO Journal, 2023/09
Free full text
706

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text
707

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09
708

Osteopathic treatment for cam-type Femoroacetabular impingement syndrome: A case report
Kilic, R. T., Yosmaoglu, H. B., Bayrakci Tunay, V.
International Journal of Osteopathic Medicine, 2023/09
709

Quantitative ultrasound to assess efficacy of treatment for neck somatic dysfunctions: a feasibility study
Tran, A., Ngo, T., Roberts, T., Ko, E., Holmgren, J. G., Edwards, C., Coleman, M., Gao, J.
Journal of Osteopathic Medicine, 2023/09
Free full text
710

The role of manual therapy for osteopaths in the management of temporomandibular disorders: A qualitative study
McComish, N.
Unpublished MSc thesis, 2023/09
Free full text
711

Der Einwärtsgang – Physiologie oder Pathologie?
(The inward gait - physiology or pathology?)
Halasz, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
712

Die Rolle des Menstruationszyklus bei Sportverletzungen
(The role of the menstrual cycle in sports injuries)
Stierl, J. A., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
713

Possibilities of non-drug methods of treatment for chronic pelvic pain syndrome in men (systematic review
(Возможности немедикаментозных методов лечения при синдроме хронической тазовой боли у мужчин (систематический обзор)
Krikunov, A. I., Potekhina, Y. P.
Russian Osteopathic Journal, 2023/09
Free full text
714

Observational study of the effects of an osteopathic treatment for patients with fibromyalgia
(Эффективность остеопатического лечения пациентов, страдающих фибромиалгией (обсервационное исследование)
Laroche, F., Bellan, E., Doléac, M., Meslé, R., Marty, M., Rostaing, S.
Russian Osteopathic Journal, 2023/09
Free full text
715

Change in the clinical status of a patient with dysfunction of the temporomandibular joint after osteopathic correction of somatic dysfunctions
(Изменение клинического статуса пациента с дисфункцией височно-нижнечелюстного сустава после остеопатической коррекции соматических дисфункций)
Nesterov, A. M., Tsymbalov, E. E., Nikulina, M. A., Kantsepolsky, A. N.
Russian Osteopathic Journal, 2023/09
Free full text
716

Study of the possibility of using osteopathic correction for the treatment of patients with non-erosive gastroesophageal reflux disease
(Исследование возможности применения остеопатической коррекции для лечения пациентов с неэрозивной гастроэзофагеальной рефлюксной болезнью)
Pirogov, R. V., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/09
Free full text
717

Drug reaction with eosinophilia and systemic symptoms (DRESS) syndrome
Cho, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2023/09
Free full text
718

Osteopathic Manipulative Therapy (OMT) as an adjunct to postoperative care for patients with gynecologic malignancies (174)
Ettorre, V., Wagreich, A., Meelheim, B., Torres, J.
Gynecologic Oncology, 2023/09
719

Influence of Osteopathic Manipulative Treatment on the Quality of Life and the Intensity of Lumbopelvic Pain in Pregnant Women in the Third Trimester: A Prospective Observational Study
Correia, M. L. A., Peixoto Filho, F. M., Gomes Júnior, S. C.
Healthcare, 2023/09
Free full text
720

Osteopathic Manual Therapy for Infant Colic: A Randomised Clinical Trial
Martínez-Lentisco, M. D. M., Martín-González, M., García-Torrecillas, J. M., Antequera-Soler, E., Chillón-Martínez, R.
Healthcare, 2023/09
Free full text
721

Evaluation of the effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in chronic nonspecific low back pain. A protocol for a randomised controlled trial
Armbrust, D., Fonseca, C. L., Lopes Dumont, A. J., Viegas da Trindade, A. M., Neto, H. P., Oliveira, C. S.
International Journal of Osteopathic Medicine, 2023/09
722

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09
723

The biomechanical links between pelvic floor dysfunction and testicular pain: A clinical review
Jackson, C., Fawcett, L.
Osteopathic Family Physician, 2023/09
724

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text
725

A Novel Approach to Assessing and Conservatively Treating Anterior Cutaneous Nerve Entrapment Syndrome: A Case Study
Newman, D. P., Holkup, S. M., Masi, E. L., Soto, A. T.
Cureus, 2023/09
Free full text
726

Osteopathic Manipulative Treatment for a Chronic Rotator Cuff Tear: A Case Report
Scypinski, L. J., Bonitz, T. J., Lomiguen, C. M., Chin, J.
Cureus, 2023/09
Free full text
727

Gleichgewicht und Propriozeption
(Balance and proprioception)
Barral, J.P.
Osteopathische Medizin, 2023/09
728

Die Schilddrüse aus der Sicht der Osteopathie: Teil 3: Behandlung
(The thyroid gland from the point of view of osteopathy: Part 3: Treatment)
Frühwein, J.
Osteopathische Medizin, 2023/09
729

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09
730

Fallbericht: Phänodynamisch-osteopathische Behandlung eines Hygroms
(Case report: Phenodynamic-osteopathic treatment of a hygroma)
Weber, K.H.
Osteopathische Medizin, 2023/09
731

The process and outcomes of chronic low back pain treatment provided by osteopathic and allopathic physicians: a retrospective cohort study
Licciardone, J. C., Kellerlee, J., Joseph, M., Mohammad, M. B., Kim, K. G., Jain, J., Aryal, S.
Journal of Osteopathic Medicine, 2023/08
Free full text
732

Osteopathic manipulative treatment for concussions and postconcussive syndrome in athletes: a literature review
Thomas, K. D., Lombard, Z. K., Shadiack, A. L.
Journal of Osteopathic Medicine, 2023/08
Free full text
733

Associations of intimate partner violence and maternal comorbidities: a cross-sectional analysis of the Pregnancy Risk Assessment Monitoring System
Hartwell, M., Keener, A., Robling, K., Enmeier, M., Sajjadi, N. B., Greiner, B., Price, J.
Journal of Osteopathic Medicine, 2023/08
Free full text
734

Rotator cuff injuries: improving identification with bedside ultrasound
McGillicuddy, C., Haus, D.
Journal of Osteopathic Medicine, 2023/08
Free full text
735

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text
736

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text
737

Effects of the Fourth Ventricle Compression Technique and Rib Raising Osteopathic Technique on Autonomic Nervous System Activity Measured by Heart Rate Variability in 35 Healthy Individuals
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2023/08
Free full text
738

Awareness and interest in osteopathic manipulative treatment in allopathic medical students
Darby, A., Parascando, J. A., Lipinski, M., Lipinski, C., Mendez-Miller, M., Berg, A., Rabago, D., Oser, T. K.
Journal of Osteopathic Medicine, 2023/08
Free full text
739

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text
740

Peritoneal Adhesions in Osteopathic Medicine: Theory, Part 1
Bordoni, B., Escher, A. R., Girgenti, G. T.
Cureus, 2023/07
Free full text
741

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07
742

Systematic review and meta-analysis showed that complementary and alternative medicines were not effective for infantile colic
Cabanillas-Barea, S., Jiménez-del-Barrio, S., Carrasco-Uribarren, A., Ortega-Martínez, A., Pérez-Guillén, S., Ceballos-Laita, L.
Acta Paediatrica: Nurturing the Child, 2023/07
Free full text
743

Haglund deformity of the posterior heel
Pargeon, M., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2023/07
Free full text
744

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text
745

Effectiveness of Osteopathic Manipulative Treatment in Treating Symptoms of Irritable Bowel Syndrome: A Literature Review
Lotfi, C., Blair, J., Jumrukovska, A., Grubb, M., Glidden, E., Toldi, J.
Cureus, 2023/07
Free full text
746

Cambios físicos y metabólicos desencadenados tras la manipulación osteopática
(Physical and metabolic changes triggered by osteopathic manipulation)
Melo, M., Alberto, R.
Unpublished MSc thesis, 2023/07
Free full text
747

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text
748

Effectiveness of visceral fascial therapy targeting visceral dysfunctions outcome: systematic review of randomized controlled trials
da Silva, F. C., Vieira, L. S., Santos, L V., Gaudreault, N., Cruvinel-Júnior, R H., Santos, G M.
BMC Complementary Medicine and Therapies, 2023/07
Free full text
749

An Osteopathic Approach to Dizziness Secondary to Meniere’s Disease
Grote, J., Perez, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
750

Operative Herangehensweise bei und osteopathische Behandlung nach Hüft-TEP-Implantation
(Operative approach to and osteopathic treatment after hip TEP implantation)
Grasmück, J., Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
751

Der biodynamische Behandlungsansatz in der osteopathischen Praxis – eine qualitative Interviewstudie
(The biodynamic treatment approach in osteopathic practice - a qualitative interview study)
Grasmück, J., Müller, F., Kienzler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
752

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
Free full text
753

Die Lebendigkeit des Selbst – das gesunde Immunsystem
(The vitality of the self - the healthy immune system)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
754

Resolution of a Plica Band Syndrome with Osteopathic Manipulative Treatment
Barr, J., Heller, G.
The AAO Journal, 2023/06
Free full text
755

An Osteopathic Approach to Chronic Inflammatory Demyelinating Polyneuropathy
Baxter, C., Grote, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
756

Osteopathic Management of Pediatric Feeding Disorder, Oral Aversion, and Growth Faltering: A Case Report
Beveridge, E., Magoun, M. A.
The AAO Journal, 2023/06
Free full text
757

Nervous System Under Attack
Blaukovitch, C., Unger, M., Thorsvik, N., Heller, G.
The AAO Journal, 2023/06
Free full text
758

Happy Feet are Dancing Feet, Response to OMT in a Patient with Morphea Profunda: A Case Report
Bomani-Bailey, A., Ettlinger, H.
The AAO Journal, 2023/06
Free full text
759

Comparison of Tone and Stiffness Changes to Lumbar Paraspinal Muscle with Varying Osteopathic Treatment Modalities (254)
Companion, N., Guha, A., Naeem, A., Abu-Sbaih, R., Keys, J., Yao, S.
The AAO Journal, 2023/06
Free full text
760

The Effects of Osteopathic Manipulative Treatment (OMT) on an Infant with Failure to Thrive (FTT); A Case Study
Cornwell, S., Yao, S., Abu-Sbaih, R.
The AAO Journal, 2023/06
Free full text
761

Osteopathic Manipulative Treatment Reduces Pain and Improves Range of Motion in Patients with Chronic Neck Pain
Daly, E., Prodoehl, J., Bolch, C., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2023/06
Free full text
762

Tackling Structure and Function with an Osteopathic Approach: A Patient with a Herniated Lumbar Disc and a Small Hemipelvis
Danto, S. E., Danto, J. B.
The AAO Journal, 2023/06
Free full text
763

Stop Chasing the Pain: An Osteopathic Approach to Treating Migrating Pain Caused by Lumbar Radiculopathy- the Importance of Treating the Cause not the Symptoms
Desai, B., Baxter, C., Widboom, N.
The AAO Journal, 2023/06
Free full text
764

Drug Induced Tibial Nerve Neuropathy in Former Collegiate Baseball Player
Dickey, Z., Turnbull, J., Sharma, N., Aldret, S.
The AAO Journal, 2023/06
Free full text
765

Cranial Osteopathic Manipulative Treatment for Post-COVID Syndrome
Drakeley, C., Shah, R., Waters, H., Mehra, R., Kumaran, N., Johnson, T.
The AAO Journal, 2023/06
Free full text
766

Stalled out: An Osteopathic Approach To A Post-Traumatic Gastroparesis
Fisher, B., Vijayakar, R., Coppinger, J., Motashaw, V.
The AAO Journal, 2023/06
Free full text
767

An Osteopathic Approach to Shoulder Injury Following Post-Hemorrhage Hemiparesis
Geyer-Roberts, E., Helderlein, P., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
768

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06
769

Iliolumbar Ligament Dissection with Motion Testing Emphasizing Osteopathic Relevance
Hartwell, L., Rudberg-Post, L., Matz, O., Gustafson, H., Gubatina, A. Jr., Figueroa, J.
The AAO Journal, 2023/06
Free full text
770

Cranial for Chronic pain: The efficacy of osteopathic manipulative treatment (OMT) in the management of chronic post-traumatic headache (CPTHA)
Helderlein, P., Geyer-Roberts, E., Widboom, N.
The AAO Journal, 2023/06
Free full text
771

Intersegmental sacral dysfunction as primary etiology of low back pain in a college athlete: A case study
Householder, L., Veach, A., Diefenderfer, J.
The AAO Journal, 2023/06
Free full text
772

Treatment of A Pediatric Patient with Right Eye Esotropia using Osteopathic Manipulative Treatment
Inouye, K., Magoun, M. A.
The AAO Journal, 2023/06
Free full text
773

International Overview of Osteopathic Manipulative Treatment in Infants with Nonsynostotic Plagiocephaly: A Scoping Review to Aid in the Inclusion of OMT into the Current Evidence-Based Treatment Guidelines
Jimenez, R., Cao, G., Bomstad, C., Myxter, K., Lozano, A., Tran, M.T., Roettger, V., Gubler, K. D., Brooks, B., Branda, A.
The AAO Journal, 2023/06
Free full text
774

The Effects of Osteopathic Manipulative Treatment (OMT) on Rare Diseases- Gordon Syndrome
Johnson, T. A., Waters, H.
The AAO Journal, 2023/06
Free full text
775

Osteopathic Manipulative Treatment for Enhanced Functional Recovery in Stroke Survivors
Kumaran, N., Drakeley, C., Waters, H., Mehra, R.
The AAO Journal, 2023/06
Free full text
776

Use of Micronized Lipoaspirate with Platelet-rich Plasma Injection and 3D Tenotomy for Treatment of a Longitudinal Peroneal Brevis Tear
Lambert, M., Fremarek, N., Kozar, A.
The AAO Journal, 2023/06
Free full text
777

The 5 Models of Osteopathic Medicine, An Approach to Transgendered Care: A Case Report
Lentz, A., Koehler, T., Caldwell, G., Fremarek, N.
The AAO Journal, 2023/06
Free full text
778

Case Study on the Effect of Osteopathic Manipulation on Gallbladder Ejection Fraction
Lin, E., Montalvo, E., Garcia Garcia, D., Adams, N., Sparks, C., Gibson, J., Seals, R.
The AAO Journal, 2023/06
Free full text
779

Effect of Muscle Energy Technique (MET) on muscle parameters and lower extremity functionality in a Parkinson’s Disease (PD) patient: A case report
Macmillan, G., Radigan, R., Finkelstein, A., Yao, S.
The AAO Journal, 2023/06
Free full text
780

Osteopathic Treatment of Chronic Chest Pain After Trauma
Martini, J., Veach, A.
The AAO Journal, 2023/06
Free full text
781

Effects of OMT on Running Performance and Recovery
Matz, O., Gustafson, H., Hartwell, L., Rudberg-Post, L., Lewis, D.
The AAO Journal, 2023/06
Free full text
782

Osteopathic Manipulative Treatment for Chemotherapy-Induced Abdominal Pain and Anorexia in Glioblastoma Multiforme
McIntire, R., Terry, R., Gebhardt, G.
The AAO Journal, 2023/06
Free full text
783

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study, Part 2
Miranda, E., Feketeova, E., Giza, J.
The AAO Journal, 2023/06
Free full text
784

An Osteopathic Approach to Dysmenorrhea
Paul, H., Bonner, P., Mehra, R.
The AAO Journal, 2023/06
Free full text
785

A Case of Chronic Postoperative Abdominal Wall Pain Successfully Treated with the Fascial Distortion Model
Pelletier, J., Boucher, J.
The AAO Journal, 2023/06
Free full text
786

Osteopathie in Österreich: Wirksamkeit und Sicherheit bei Schmerzen des Bewegungsapparats und Überblick über Ausbildung und Qualitätsanforderungen
(Osteopathy in Austria: Effectiveness and safety in treating pain of the musculoskeletal system and overview of training and quality requirements)
Gassner, L., Hofer, V.
Osteopathische Medizin, 2023/06
Free full text
787

The Effect of OMT on Insulin Sensitivity and Glucose Control in Rodent Models: A Pilot Study
Petrillo, G., Cai, W., Keys, J.
The AAO Journal, 2023/06
Free full text
788

An Osteopathic Approach To Refractory Sternal Pain
Risov, D., Geer, R.
The AAO Journal, 2023/06
Free full text
789

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
Free full text
790

Palpatory tests in manual therapies: an international survey on osteopathic clinical practice
Novelli, E., Molinari, L., Consolo, S., Mingrone, L.
Journal of Complementary and Integrative Medicine, 2023/06
Free full text
791

Das Ligamentum gastrophrenicum: Über die Verbindung vom Zwerchfell zum Magen
(The gastrophenic ligament: About the connection of the diaphragm to the stomach)
Kleimeyer, S.
Osteopathische Medizin, 2023/06
Free full text
792

An Osteopathic Approach to Plagiocephaly in the Absence of Pre-Post Sphenoid Fusion
Rosten, C., Nixon, K., Jons-Cox, L.
The AAO Journal, 2023/06
Free full text
793

Releasing the Restriction: A Study of Myofascial Release to Improve Pain and Range of Motion in Post-Cesarean Section Patients in the Peruvian Amazon
Scott, G., Gordon, T.
The AAO Journal, 2023/06
Free full text
794

Refractory Temporomandibular Joint Pain Resolved with Intraoral Osteopathic Manipulative Treatment
Shah, R., Drakeley, C., Mehra, R.
The AAO Journal, 2023/06
Free full text
795

Ultrasound Assessment of OMT on Diaphragm Motion
Snow, N., DeDi, C., Rathjen, S., Redden, D. T., Kozar, A., Robinson, L.
The AAO Journal, 2023/06
Free full text
796

26.2 Miles: A Case Study of Osteopathic Manipulative Treatment in Marathon Training
Sofka, M., Giovanis, A.
The AAO Journal, 2023/06
Free full text
797

Symptomatic Mitigation of a Rare Case of Chronic Active Epstein-Barr Virus (CAEBV)Disease Using Lymphatic Osteopathic Manipulative Treatment
Song, Y., Waddington, M.
The AAO Journal, 2023/06
Free full text
798

Approaching the barrier: Improved pediatric resident knowledge and confidence in osteopathic manipulative medicine after a resident-led educational intervention
Tyler, S., McMunn, R., Ruedinger, E.
The AAO Journal, 2023/06
Free full text
799

Effects of Osteopathic Manipulative Treatment (OMT) on Functional Impairment in Limb Girdle Muscular Dystrophy Patient: A Case Report (271)
Unser, K., Yao, S.
The AAO Journal, 2023/06
Free full text
800

Faszien als sensorisches und emotionales Organ: Emotionen, Faszien und Immunsystem
(Fasciae as sensory and emotional organ: Emotions, fasciae and immune system)
Schleip, R., Bartsch, K.
Osteopathische Medizin, 2023/06
Free full text
801

Osteopathic Manipulative Medicine as an Adjuvant Treatment for Hemicrania Continua: A Case Study
Van Fossen, E., Kanithi, M., Jelneck, S., Ferguson, D., Tran, J., Bui, N., Hassan, D., Gordon, T.
The AAO Journal, 2023/06
Free full text
802

A Case Study of Osteopathic Manipulative Treatment (OMT) in Deformational Plagiocephaly (DP)
Vega, K., Ettlinger, H.
The AAO Journal, 2023/06
Free full text
803

Banging Out Concussions: The Role of Osteopathic Manipulative Treatment in Post-Concussion Syndrome in Children
Wajid, A., Ettlinger, H.
The AAO Journal, 2023/06
Free full text
804

Osteopathic Manipulative Treatment of Chronic Pelvic Pain due to High-Tone Pelvic Floor Dysfunction
Barnett, M. E., Henderson, K. K., Elliott-Burke, T. L., Heinking, K. P.
Osteopathic Family Physician, 2023/06
805

Incorporation of an osteopathic-focused lecture series into an already established pediatric residency curriculum
Wysong, M., Copenheaver, D., Powers, L., Flaherty, R.
The AAO Journal, 2023/06
Free full text
806

Effect of OMT on post-anoxic brain injury resulting in intractable myoclonus
Zhong, X., Campo, Z., Torrents, M.
The AAO Journal, 2023/06
807

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06
808

Combating poor mental health in emergency responders: Helping Emergency Responders Overcome (HERO) Act
Derynda, B., Gupta, K. A., Bhattacharya, S., Hollar, T. L.
Osteopathic Family Physician, 2023/06
809

Embryologie und Midline
(Embryology and midline)
Wojtowicz, A., Freeman, B., Dijs, P.
Osteopathische Medizin, 2023/06
Free full text
810

Muskulatur im entwicklungs-dynamischen Kontext
(Muscles in the developmental-dynamic context)
Engel, M.
Osteopathische Medizin, 2023/06
811

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06
812

OSCAR (Osteopathic Single CAse Research) – Assessing the effect of standard and biopsychosocial osteopathic management for patients with non-specific low back pain: Protocol for a Single Case Experimental Design (SCED)
Draper-Rodi, J., Abbey, H., Brownhill, K., Vogel, S.
International Journal of Osteopathic Medicine, 2023/06
813

Influence of osteopathic correction on range of motion and quality of life in patients with arthrosis of the shoulder joint of I–II degrees
(Влияние остеопатической коррекции на объем движения и качество жизни у пациентов с артрозом плечевого сустава I–II степени)
Avzaletdinov, B. K., Akhmetov, B. H.
Russian Osteopathic Journal, 2023/06
Free full text
814

Somatic Dysfunction. Clinical Guidelines 2023
(Соматическая дисфункция. Клинические рекомендации 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
Free full text
815

Pressure force on tissues in various osteopathic techniques (pilot study
(Сила давления на ткани при различных остеопатических техниках (пилотное исследование)
Mokhov, D. E., Tregubova, E. S., Potekhina, Y. P., Smirnova, L. M., Kolyshnitsyn, N. Y., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/06
Free full text
816

The influence of general osteopathic treatment on the quality of life of elderly people
(Влияние общего остеопатического лечения на качество жизни людей пожилого возраста)
Usupbekova, B. S., Zhusupbekova, N. E., Shyikymanarov, E. S.
Russian Osteopathic Journal, 2023/06
Free full text
817

The possibilities of osteopathic correction using for the treatment of children with attention deficit hyperactivity disorder
(Возможности применения остеопатической коррекции для лечения детей с синдромом дефицита внимания и гиперактивности)
Zaev, A. I., Stenkova, O. V.
Russian Osteopathic Journal, 2023/06
Free full text
818

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06
819

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
820

Terapia manual y tratamiento osteopático en pacientes con EPOC estable
(Manual therapy and osteopathic treatment in patients with stable COPD)
Diaz Serrano, R., Souto Villar, M. A.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text
821

Eficacia de la terapia combinada con la técnica de inhibición suboccipital y la manipulación del segmento cervical alto en la cefalea tensional
(Effectiveness of combined therapy with suboccipital inhibition technique and upper cervical segment manipulation in tension headache)
Ferrera Suárez, A.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text
822

Mejora en la dorsiflexión de tobillo para prevención de lesiones de rodilla en deportistas
(Improvement in ankle dorsiflexion for the prevention of knee injuries in athletes)
Márquez Romero, A.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text
823

Eficacia del tratamiento osteopático en la dismenorrea
(Effectiveness of osteopathic treatment for dysmenorrhea)
Molina Galera, V.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text
824

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/06
Free full text
825

Accompagner les changements curriculaires vers l’approche par compétences dans les formations en santé : étude d’une stratégie de changement pragmatique portée par un individu-tercéisateur dans un institut de formation en ostéopathie français
(Facilitating curricular changes towards the competency-based approach in health education : study of a pragmatic change strategy supported by a third-party with terceisation function in an osteopathic training institute)
Quesnay, P.
Unpublished PhD thesis, 2023/06
826

Exploring the effects of standardized soft tissue mobilization on the viscoelastic properties, pressure threshold and touch threshold of the caesarean section scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2023/06
827

Utilization and Reimbursement Trends of Osteopathic Manipulative Treatment for Medicare Patients: 2000-2019
Starr, E., Smith, J. F., Hanson, R. B., Woolstenhulme, J. B., Roush, A. J., Sperry, N. B., Wilde, B., Brooks, A., Zapata, I.
Journal of Osteopathic Medicine, 2023/06
Free full text
828

What complementary and alternative medicine therapy recommendations exist across clinical practice guidelines for low back pain? A systematic review
Mohiuddin, U., Ng, J.
Journal of Complementary and Integrative Medicine, 2023/06
829

Efectos del tratamiento osteopático en trastornos neurocognitivos asociados y la calidad de vida relacionada con la salud en el trastorno del espectro alcohólico fetal
(Effects of osteopathic treatment on associated neurocognitive disorders and health-related quality of life in fetal alcohol spectrum disorder)
Cases Solé, R.
Unpublished PhD thesis, 2023/06
Free full text
830

Pharmacology Education, Osteopathic Principles Integration, Osteopathic Manipulation Treatment relations: Osteopathic Graduating Seniors' Perception
Eldeeb, K.
Journal of Pharmacology and Experimental Therapeutics, 2023/06
831

Osteopathy in the Early Diagnosis and Management of Degenerative Cervical Myelopathy: National Survey
Brannigan, J. F. M., Mowforth, O. D., Rogers, M., Wood, H., Karimi, Z., Kotter, M. R. N., Davies, B. M.
JMIR Formative Research, 2023/05
Free full text
832

The Short-Term and Long-Term Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D. Y., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
833

Serological Assessment of the Effectiveness of Osteopathic Manipulative to Augment the Covid-19 Vaccine Immune Response
Martinez, E., Loveless, B., Crone, P., Szurmant, H., Fuchs, S., Sanchez, J.
Journal of Investigative Medicine, 2023/05
834

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
835

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05
836

Evaluation of Osteopathic Manipulative Treatment in Patients with Chikungunya Fever in the Chronic Phase: A Randomized Controlled Trial
Tenorio, L., Mello, K., Maia, M., Valença, A., Duarte, Â., Marques, C.
Journal of Clinical Rheumatology, 2023/05
837

Sleep abnormalities as potential early diagnostic biomarkers for Alzheimer’s disease: A scoping review examining the extent of empirical evidence
Baxter, L.
Unpublished MSc thesis, 2023/05
Free full text
838

Response to “Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine“
Rehman, Y., Kirsch, J., Snider, K. T.
Journal of Osteopathic Medicine, 2023/05
Free full text
839

Effectiveness of the muscle energy technique on postpartum meralgia paresthetica: A randomized controlled trial
El-Din Mahmoud, L. S., El Meligie, M. M., Yehia, R. M.
Journal of Back and Musculoskeletal Rehabilitation, 2023/05
840

Manejo de la espondilolistesis lumbar desde la osteopatía. Una revisión bibliométrica
(Management of lumbar spondylolisthesis from osteopathy. A bibliometric review)
Apolinar Cruz, G. A.
Unpublished MSc thesis, 2023/05
Free full text
841

Effect of a Stress Management Module on First-Year Osteopathic Medical Students’ Stress Levels
Hill, Y. M.
Unpublished PhD thesis, 2023/05
842

Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine
Alvarez, G., Lucas, S., Roura, S.
Journal of Osteopathic Medicine, 2023/05
Free full text
843

Identifying Predictors of Eventual Rural Practice Among Female Osteopathic Medical Students
Kahl, D.
Unpublished Dissertation, 2023/05
844

Osteopathic manipulative treatment of patients with chronic low back pain in the United States: a retrospective cohort study
Licciardone, J. C., Moore, S., Fix, K., Blair, L. G., Ta, K.
Journal of Osteopathic Medicine, 2023/05
Free full text
845

Beyond burnout: a four-year survey of osteopathic medical student mental health and the implications for the development of wellness and mental health programs
Ley, A. F., Han, J. J., Hare, E., Sikorskii, A., Taylor, J. R., Shahed, A., Guro, C.
Journal of Osteopathic Medicine, 2023/05
Free full text
846

Osteopathic Manual Treatment Compared to Kaltenborn-Evjenth Orthopedic Manual Therapy for Chronic Low Back Pain: A Randomized Study
Lizis, P., Kobza, W., Jaszczur-Nowicki, J., Wisniewski, D.
Alternative Therapies in Health and Medicine, 2023/05
847

Efficacy of the Osteopathic Pedal Pump in Reducing Lower Limb Volume in Older Adults with Lymphedema
Parikh, S. H., Adams, J. S., Goodwin, B. J., McLaughlin, M. H., Noll, D. R.
Journal of the American Geriatrics Society, 2023/04
848

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: Randomized controlled trial
Boas Fernandes, W. V., Politti, F., Blanco, C. R., Garcia Lucareli, P. R., Gomes, C. A. F. d. P., Corrêa, F. I., Corrêa, J. C. F.
Journal of Bodywork and Movement Therapies, 2023/04
849

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text
850

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text
851

Superficial spreading melanoma within a nevus spilus
Racanelli, J., Moloney, M., Siegel, L.
Journal of Osteopathic Medicine, 2023/04
Free full text
852

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text
853

Validation of subjective manual palpation using objective physiological recordings of the cranial rhythmic impulse during osteopathic manipulative intervention
Pelz, H., Müller, G., Keller, M., Mathiak, K., Mayer, J., Borik, S., Perlitz, V.
Scientific Reports, 2023/04
Free full text
854

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
855

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text
856

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
857

Osteopathic Findings and Treatment of Patient with Crohn's Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text
858

Method for correcting somatic dysfunctions
(Метод коррекции соматических дисфункций)
Aptekar, I. A.
Russian Osteopathic Journal, 2023/03
Free full text
859

The influence of osteopathic correction on liquorodynamics in patients with tension-type headache
(Влияние остеопатической коррекции на ликвородинамику у пациентов с головной болью напряжения)
Belash, V. O., Starostenko, V. A.
Russian Osteopathic Journal, 2023/03
Free full text
860

Communication strategies in psychologically informed osteopathic practice: A case report
Abbey, H.
International Journal of Osteopathic Medicine, 2023/03
861

Blinding and sham control methods in trials of physical, psychological, and self-management interventions for pain (article I): a systematic review and description of methods
Hohenschurz-Schmidt, D., Draper-Rodi, J., Vase, L., Scott, W., McGregor, A., Soliman, N., MacMillan, A., Olivier, A., Cherian, C. A., Corcoran, D., Abbey, H., Freigang, S., Chan, J., Phalip, J., Nørgaard Sørensen, L., Delafin, M., Baptista, M., Medforth, N. R., Ruffini, N.
Pain, 2023/03
862

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text
863

Die osteopathische Technik – ein Metakonzept
(The osteopathic technique - a meta concept)
Engel, M.
Osteopathische Medizin, 2023/03
864

Covid-19 Fatigue: Diagnosis and Treatment for the Osteopathic Physician
Foss, V. B., Maddie, N., Frankini, E. L., Landman, S., Maccagnano, J., Yao, S. C.
Osteopathic Family Physician, 2023/03
865

Abwertung als Ziel: Über den Artikel „Die Scheinwirkung der Osteopathie” von Edzard Ernst
(Devaluation as a Goal: About the Article “The Sham Effect of Osteopathy“ by Edzard Ernst)
Franke, H.
Osteopathische Medizin, 2023/03
866

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03
867

A Case Study of Postural Imbalance with Lymphatic Congestion Which Responded to OMT
Lockhart, W. C.
The AAO Journal, 2023/03
Free full text
868

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text
869

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03
870

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03
871

Osteopathic Findings and Treatment of Patient with Crohn’s Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text
872

Aus der digitalen Welt: „Find it, fix it and leave it alone”
(From the digital world: “Find it, fix it and leave it alone“)
Sonntag, M.
Osteopathische Medizin, 2023/03
873

Osteopathische Behandlung von Säuglingen mit infantiler Kolik/exzessivem Schreien: Eine prospektive, multizentrische, kontrollierte randomisierte Studie
(Osteopathic treatment of infants with infantile colic/excessive crying: A prospective, multicenter, controlled randomized trial.)
Zimmer, M., Göpfert, J., Laux, P., Langenmair, S.
unpublished D.O. thesis, 2023/03
874

Goniometric effects of an osteopathic technique, active stretching with specific, fixation on the mobility of the Scapular Waist
(Гониометрическая оценка применения остеопатической техники активного вытяжения со специфической точкой фиксации. Влияние на подвижность плечевого пояса)
Campillar, M. A.
Russian Osteopathic Journal, 2023/03
Free full text
875

Results of osteopathic correction according to the stabilography data in patients with lower limb amputation at the transtibial level
(Результаты остеопатической коррекции по данным стабилографии у пациентов с ампутацией нижних конечностей на уровне голени)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2023/03
Free full text
876

Substantiation of the effectiveness of osteopathic correction in the treatment of patients suffering from post-puncture syndrome
(Обоснование эффективности остеопатической коррекции при лечении пациентов, страдающих постпункционным синдромом)
Krivenya, M. S., Gorobets, L. V.
Russian Osteopathic Journal, 2023/03
Free full text
877

Results of the osteopathic treatment of the temporomandibular joint dysfunction (meta-analysis
(Результаты остеопатического лечения дисфункции височно-нижнечелюстного сустава (метаанализ)
Milutka, Y. A., Dyachkova, Y. Y., Evdokimova, A. V.
Russian Osteopathic Journal, 2023/03
Free full text
878

The possibilities of using osteopathic correction for chronic pelvic pain syndrome
(Возможность применения остеопатической коррекции при синдроме хронической тазовой боли)
Sharapov, I. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/03
Free full text
879

Osteopathic rehabilitation of patients after community-acquired pneumonia
(Остеопатическая реабилитация пациентов, перенесших внебольничную пневмонию)
Usupbekova, B. S., Sartmyrzaeva, S. S., Murzakhmetova, S. A.
Russian Osteopathic Journal, 2023/03
Free full text
880

Pathogenetic prerequisites for the use of osteopathic correction in chronic tonsillitis
(Патогенетические предпосылки применения остеопатической коррекции при хроническом тонзиллите)
Vedyashkina, A. S., Potekhina, Y. P., Mokhov, D. E.
Russian Osteopathic Journal, 2023/03
Free full text
881

Therapeutic and stabilization exercises after manual therapy in patients with non-specific chronic neck pain: A randomised clinical trial
Demir, O., Atıcı, E., Torlak, M. S.
International Journal of Osteopathic Medicine, 2023/03
882

Substantiation of the application of osteopathic correction in the complex rehabilitation of patients after anterior cruciate ligament reconstruction surgery
(Обоснование применения остеопатической коррекции в комплексной реабилитации пациентов после операции реконструкции передней крестообразной связки)
Vorobyev, S. V., Dolinina, O. Y., Mokhov, A. D., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/03
Free full text
883

Osteopathic intervention for infants with breastfeeding difficulty: A retrospective case series
Greenwood, K., Engel, R., Grace, S.
International Journal of Osteopathic Medicine, 2023/03
884

Kann mittels Osteopathie der Hormonstatus von infertilen Frauen mit Polyzystischem-Ovarial-Syndrom (PCOS) beeinflusst werden?
(Is it possible to influence the hormone levels of infertile women with polycystic ovarian syndrome (PCOS) by osteopathic treatments?)
Hartl, V.
Unpublished MSc thesis, 2023/03
885

Response to Lo et al. regarding “The role of 3D digital applications in Manual Therapy Education – A scoping review”
Kovanur Sampath, K., Arumugam, A., Jull, G.
International Journal of Osteopathic Medicine, 2023/03
Free full text
886

Letter to the editor, regarding: The role of 3D digital applications in manual therapy education – A scoping review
Lo, C. N.
International Journal of Osteopathic Medicine, 2023/03
887

Evaluation of academic detailing to educate clinicians regarding childhood lead poisoning prevention: a pilot study
Newman, N. C., Knapke, J. M., Kiniyalocts, R., Belt, J., Haynes, E.
Journal of Osteopathic Medicine, 2023/03
Free full text
888

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text
889

Efectividad del tratamiento osteopático manipulativo y fascial en el postoperatorio de cirugía de injerto de derivación de arteria coronaria
(Effectiveness of osteopathic manipulative and fascial treatment in the postoperative period of coronary artery bypass graft surgery)
Bruni, E.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
890

Eficacia de las técnicas osteopáticas en el dolor de rodilla
(Effectiveness of osteopathic techniques in knee pain)
González Ruiz, P. M., Laguna Aranda, A. M., Aranda Guirado, L.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
891

Efectos del tratamiento de osteopatía en pacientes con trastornos de la articulación temporomandibular
(Effects of osteopathic treatment on patients with temporomandibular joint disorders)
Jiménez Sánchez, L., Iglesias Lerma, C. M.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
892

Efecto de la osteopatía en la enfermedad por reflujo gastroesofágico
(Effect of osteopathy on gastroesophageal reflux disease)
Martín Ruiz, M.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
893

Eficacia del tratamiento osteopático en pacientes con patologías respiratorias
(Effectiveness of osteopathic treatment in patients with respiratory conditions)
Ortiz Armiñana, R.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
894

Manejo de las radiculopatías mediante manipulaciones espinales
(Management of radiculopathies through spinal manipulation)
Prado Posada, S.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
895

Efectividad del tratamiento osteopático en el dolor pélvico crónico
(Effectiveness of osteopathic treatment for chronic pelvic pain)
Rivero Rodríguez, S.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
896

Beneficios del tratamiento osteopático en el periodo obstétrico
(Benefits of osteopathic treatment during pregnancy)
Rodríguez Pérez-Serrano, E., Sedeño Vidal, A.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
897

Die klinische Wirksamkeit des Fasziendistorsionsmodells
(Clinical Efficacy of the Fascial Distortion Model)
Honc, C.
Unpublished MSc thesis, 2023/03
Free full text
898

Der Effekt einer Stillpunktinduktion am Sakrum auf das vegetative Nervensystem, im Vergleich zu einer Scheinbehandlung, gemessen anhand der Herzratenvariabilität (HRV)
(The Effect of a sacrum stillpoint induction on the autonomic nervous system compared to a sham treatment, as measured by heart rate variability (HRV))
Franzin, K.
Unpublished MSc thesis, 2023/03
899

Effekt einer Unwinding-Technik des zervikothorakalen Diaphragmas auf die Herzratenvariabilität (HRV) im Vergleich zu einer Scheinbehandlung
(Effect of an unwinding technique of the cervicothoracic diaphragm on the heart rate variability (HRV) compared to a sham treatment)
Gwendolyn, A.
Unpublished MSc thesis, 2023/03
900

Osteopathie bei Frauen mit Blasenentleerungsstörung sowie Blasenspeicherstörungen
(Effect of osteopathy on bladder storage dysfunctions and voiding difficulties in women)
Schwarzenlander, U.
Unpublished MSc thesis, 2023/03
901

Effektivität einer craniosacralen Behandlung bei Multiple-Sklerose-PatientInnen mit Störungen im Urogenitaltrakt im Vergleich zur physiotherapeutischen Behandlung mittels aktiver Beckenbodenübungen
(Effectiveness of a craniosacral treatment on patients with multiple sclerosis with problems of the urogenital system compared with pelvic floor training)
Karner, A.
Unpublished MSc thesis, 2023/03
902

Effektivität von osteopathischen Techniken und Behandlungen bei COPD. Systematisches Review
(Effectiveness of osteopathic techniques and treatments in patients with COPD. A systematic review)
Safran, T.
Unpublished MSc thesis, 2023/03
903

Die Wirksamkeit der Osteopathie auf die Okulomotorik nach einer Gehirnerschütterung
(The effectiveness of osteopathy on oculomotor function after concussion)
Dalder, K.
Unpublished MSc thesis, 2023/03
904

Der Einfluss einer visceralen Behandlungstechnik auf die Beweglichkeit der Halswirbelsäule
(The influence of a visceral treatment technique on the mobility of the cervical spine)
Koch, K.
Unpublished MSc thesis, 2023/03
905

Der Einfluss der Osteopathie auf infantile nicht-synostotische Plagiozephalie
(The Influence of Osteopathy on infantile non-synostotic Plagiocephaly)
Archam, S.
Unpublished MSc thesis, 2023/03
906

Osteopathic Manipulation as a Method of Cortisol Modification: A Systematic Review
Thibaut, D., Santarlas, V., Hoppes, J., Vásquez-Castillo, A., Morrow, A., Oviedo, E., Toldi, J.
Cureus, 2023/03
Free full text
907

Osteopathische Behandlung bei Rückenschmerzen. Akuter, nicht- spezifischer
(Osteopathic Manipulative Treatment for acute, non-specific Low Back Pain)
Jankovic-Preslmayer, M.
Unpublished MSc thesis, 2023/03
908

Die Messung der vertikalen Sprunghöhe bei VolleyballerInnen nach einer osteopathischen Behandlung
(Vertical jump height of volleyball players after an osteopathic treatment)
Archer, K.
Unpublished MSc thesis, 2023/03
909

Weibliche Genitalverstümmelung und Osteopathie
(Female genital mutilation and osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
910

Characteristics of patients presenting at a university outpatient department for com-plementary and integrative medicine
Rotter, G., Binting, S., Teut, M., Ortiz, M., Willich, S. N., Brinkhaus, B.
Complementary Medicine Research, 2023/02
911

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text
912

Impact of COVID-19 on Rocky Vista University medical students' mental health: A cross-sectional survey
Paz, D. C., Bains, M. S., Zueger, M. L., Bandi, V. R., Kuo, V. Y., Payton, M., Ryznar, R. J.
Frontiers in Psychology, 2023/02
Free full text
913

To the Editor: COMLEX-USA vs USMLE? Irrelevant
Terry, R., Lavertue, S.
Journal of Graduate Medical Education, 2023/02
Free full text
914

The Impact of Complementary and Integrative Medicine Following Traumatic Brain Injury: A Scoping Review
Kim, S., Mortera, M. H., Wen, P. S., Thompson, K. L., Lundgren, K., Reed, W. R., Sasson, N., Towner Wright, S., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
The Journal of Head Trauma Rehabilitation, 2023/02
Free full text
915

Abordaje de Manejo de dolor en Niños desde la perspectiva de la Medicina Alternativa
(Approach to Pain Management in Children from an Alternative Medicine Perspective)
Sierra Sánchez, A. P.
Unpublished MSc thesis, 2023/02
Free full text
916

Effectiveness of osteopathic treatment in patients with Lower Urinary Tract Symptoms (LUTS)
Arora, A., Ghosh, T.
Biomedicine, 2023/02
917

Einklemmungsphänomene als Ursache für eine Parese des N. abducens
(Entrapment phenomena as a cause of abducens nerve paresis)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
918

Bedeutung des differenzierten Säuglingsbefunds
(Importance of the differentiated infant finding)
Ginsberg, I.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
919

Fragen und die Existenz verschiedener Wahrheiten
(Questions and the existence of various truths)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
920

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
921

Historical Osteopathic Principles and Practices in Contemporary Care: An Anthropological Perspective to Foster Evidence-Informed and Culturally Sensitive Patient-Centered Care. A Commentary
Zegarra-Parodi, R., Baroni, F., Lunghi, C., Dupuis, D.
Healthcare, 2023/01
Free full text
922

Die Gewebe des Menschen – mehr als nur Baumaterial des Organismus
(The tissues of a human - more than just building material of the organism)
Spohr, G.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
923

Neck pain service utilization and costs: association with timing of non-pharmaceutical services for individuals initially contacting a primary care provider. A retrospective cohort study
Elton, D., Zhang, M.
medRxiv, 2023/01
Free full text
924

An exploration of the experience of osteopaths managing individuals with endometriosis
Zeigler, Z. L.
Unpublished MSc thesis, 2023/01
Free full text
925

“It's all about the story”. Osteopaths' experiences of exploring menopausal symptoms: A qualitative interview study
Gelli, N., Abbey, H.
International Journal of Osteopathic Medicine, 2023/01
926

Factors Leading to Successful Performance on U.S. National Licensure Exams for Medical Students: A Scoping Review
Jeyaraju, M., Linford, H., Bosco Mendes, T., Caufield-Noll, C., Tackett, S.
Academic Medicine, 2023/01
927

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text
928

Leukoderma with perifollicular sparing: a diagnostic clue of cutaneous onchocerciasis
Ambur, A. B., Nyckowski, T. A.
Journal of Osteopathic Medicine, 2023/01
Free full text
929

The US Residency Selection Process After the United States Medical Licensing Examination Step 1 Pass/Fail Change: Overview for Applicants and Educators
Ozair, A., Bhat, V., Detchou, D. K. E.
JMIR Medical Education, 2023/01
Free full text
930

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text
931

Concussion-related visual memory and reaction time impairment in college athletes improved after osteopathic manipulative medicine: a randomized clinical trial
Mancini, J. D., Angelo, N., Abu-Sbaih, R., Kooyman, P., Yao, S.
Journal of Osteopathic Medicine, 2023/01
Free full text
932

Effectiveness of osteopathic manipulative treatment in cardiovascular function: a systematic review protocol
Vanier, C., Johnston, K., DeArmond, M., Salloum, L., Arjmand, S., Toder, E., Ioudina, M.
JBI Evidence Synthesis, 2023/01
Free full text
933

What are the current rehabilitative approaches to ACL recovery post reconstruction surgery that osteopaths may implement?: A scoping review
Caughey, C.
Unpublished MSc thesis, 2023/01
Free full text
934

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Wang, M. Y., Ferguson, H., Bingham, J., Senger, B., Swogger, S. E., Johnston, R., Snider, K. T.
Journal of Osteopathic Medicine, 2023/01
935

Tratamento manipulativo osteopático em comparação com um programa de exercícios em corredores com Síndrome da dor patelofemoral : ensaio controlado randomizado
(Osteopathic manipulative treatment compared with an exercise program in runners with patellofemoral pain syndrome: randomized controlled trial)
Guglielmin, J. Z.
Unpublished PhD thesis, 2023/01
Free full text
936

(Osteopathy as a treatment proposal for patients with temporomandibular disorders: a systematic review)
Pereira de Paula, R., Oliveira da Silva Almeida, D., Garcia de Paula, G., Moreira Alves, L., Oliveira Silva, M., Rodrigues da Cunha, M., Iatecola, A., Ramos Fernandes, V.A., Rodrigues Silva, V., de França, E., Barroso Hirota, V.
Revista Multidisciplinar da Saúde, 2023
Free full text
937

Revisión sistemática: análisis de la terapia osteopática en la tendinitis del manguito rotador
(Analysis of the efficacy of osteopathic therapy in the treatment of rotator cuff tendinitis. A systematic review)
Sanchez, C., Alexandra, Y.
Unpublished MSc thesis, 2023
Free full text
938

The intersection of the two complimentary fields of preventive cardiology and integrative cardiology: A Fellow's voice
Cheung, B.
American Journal of Preventive Cardiology, 2022/12
Free full text
939

Corrigendum to “Treatment of infant colic with craniosacral therapy. A randomized controlled trial“ [Complement Ther Med 71 (2022) 102885]
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/12
Free full text
940

COVID-19 in Patients with Asthma: Review and Implications for Care of Adult Patients with an Osteopathic Component
Frasca, D. J., Wolf, S.
Osteopathic Family Physician, 2022/12
Free full text
941

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12
942

Die Geschichte der Osteopathie in Deutschland
(The history of osteopathy in Germany)
Engel, M.
Osteopathische Medizin, 2022/12
943

Wirksamkeit der osteopathischen Behandlung bei pädiatrischen Beschwerden: Eine systematische Übersichtsarbeit
(Effectiveness of osteopathic manipulative treatment in pediatric complaints: A systematic review)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2022/12
Free full text
944

ObiH – Osteopathie bei infantiler Haltungs asymmetrie und Plagiozephalie (Teil 2)
(ObiH - Osteopathy for infantile postural asymmetry and plagiocephaly (Part 2))
Klemm, S., Spiertz, M., Asche, M.
Osteopathische Medizin, 2022/12
945

Osteopathie als personenzentrierte und integrierende Behandlungsmethode (Teil 2)
(Osteopathy as a person-centered and integrative treatment method (Part 2))
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/12
946

Osteopathische Geriatrie. Teil 2: Behandlung - Prinzipien und Methoden
(Osteopathic geriatrics. Part 2: Treatment - Principles and methods)
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/12
947

The Role of Osteopathic Manipulative Medicine in the Rehabilitation of a Competitive Dancer after a Major Abdominal Surgery
Berenbeim, G., Figueroa, J.
The AAO Journal, 2022/12
Free full text
948

ObiH – Osteopathie bei infantiler Haltungs asymmetrie und Plagiozephalie (Teil 1)
(ObiH - Osteopathy for infantile postural asymmetry and plagiocephaly (Part 1))
Spiertz, M., Asche, M., Klemm, S.
Osteopathische Medizin, 2022/12
949

Effects of osteopathic manipulative treatment associated with pain education and clinical hypnosis in individuals with chronic low back pain: study protocol for a randomized sham-controlled clinical trial
Luchesi, G. L. S., da Silva, A. K. F., Amaral, O. H. B., de Paula, V. C. G., Jassi, F. J.
Trials, 2022/12
Free full text
950

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/12
951

Fascial Distortion Model (FDM) by Stephen Typaldos from the modern research and therapeutic concepts point of view
(Модель фасциальных дисторсий (FDM) Стивена Типальдоса с позиций современных исследований и терапевтических концепций)
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. E., Agasarov, L. G.
Russian Osteopathic Journal, 2022/12
952

Study of the possibility of osteopathic correction inclusion in the complex therapy of pelvic pain syndrome in women at the late postpartum period
(Исследование возможности включения остеопатической коррекции в состав комплексной терапии синдрома тазовой боли у женщин в позднем послеродовом периоде)
Chumakova, I. B., Nasibullina, R. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/12
953

Substantiation of the possibility of using osteopathic correction in the complex treatment of patients with shoulder-shoulder pain syndrome
(Обоснование использования остеопатической коррекции в комплексном лечении пациентов с плечелопаточным болевым синдромом)
Emelyanova, C. K., Zolkova, O. V., Kozlova, N. S.
Russian Osteopathic Journal, 2022/12
954

The use of autoimmunological parameters to evaluate the results of osteopathic correction: pilot study
(Использование аутоиммунологических показателей для оценки результатов остеопатической коррекции: пилотное исследование)
Ikhlef, A., Potekhina, Y. P., Tregubova, E. S., Kurbatov, O. I., Pukhalenko, A. I.
Russian Osteopathic Journal, 2022/12
955

Application of infrared thermography in the study of the osteopathic correction results in patients with amputation defects of the lower extremities
(Инфракрасная термография в исследовании результатов остеопатической коррекции у пациентов с ампутационными дефектами нижних конечностей)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2022/12
956

The possibilities of osteopathic correction using in adolescents with varicocele: a pilot study
(Возможности применения остеопатической коррекции у подростков с варикоцеле: пилотное исследование)
Kutsebo, Y. V., Shchuchkina, E. A., Kozlova, N. S.
Russian Osteopathic Journal, 2022/12
957

Osteopathic correction as part of the complex treatment of temporomandibular disorder
(Остеопатическая коррекция в составе комплексного лечения дисфункции височно-нижнечелюстного сустава)
Nesterov, A. M., Tsymbalov, E. E., Nikulina, M. A., Kantsepolsky, A. N.
Russian Osteopathic Journal, 2022/12
958

Effects of osteopathic correction and the possibility of their study
(Эффекты остеопатической коррекции и возможности их исследования)
Potekhina, Y. P., Tregubova, E. S., Mokhov, D. E.
Russian Osteopathic Journal, 2022/12
959

Osteopathic treatment of cervicalgia in dentists experiencing prolonged professional overloads
(Остеопатическое лечение цервикалгии у врачей-стоматологов, испытывающих продолжительные профессиональные перегрузки)
Usupbekova, B. S., Mombekova, S. A.
Russian Osteopathic Journal, 2022/12
960

Evaluation of Osteopathic Principles in Cadaveric Specimens Using Radiological Assessment
Siddiqi, I., Wang, A., Marino, M., Bowen, I., Miulli, D. E.
Cureus, 2022/12
Free full text
961

The role of 3D digital applications in manual therapy education – A scoping review
Kovanur Sampath, K., Arumugam, A., Jull, G.
International Journal of Osteopathic Medicine, 2022/12
962

Pain and functional recovery from chronic low back pain over 12 months: implications for osteopathic medicine
Licciardone, J. C., Pandya, V.
Journal of Osteopathic Medicine, 2022/12
Free full text
963

A Case Study Examining Women in Leadership at a College of Osteopathic Medicine
Kelley, S.
Unpublished Dissertation, 2022/12
964

Acupuncture and Osteopathic Medicine for Atopic Dermatitis – a Three-armed Randomized Controlled Explorative Clinical Trial
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Clinical and Experimental Dermatology, 2022/12
Free full text
965

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic neck pain: A single-blinded randomized controlled trial
Cholewicki, J., Popovich, J. M., Jr., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/12
966

Reconceptualizing the therapeutic alliance in osteopathic practice: Integrating insights from phenomenology, psychology and enactive inference
Shaw, R., Abbey, H., Casals-Gutiérrez, S., Maretic, S.
International Journal of Osteopathic Medicine, 2022/12
967

The Touch Taboo: Origins for the Prohibition of Touch in Psychiatry and a Rational Osteopathic Approach
Huzij, T.
The AAO Journal, 2022/12
Free full text
968

Preliminary Results from a Randomized Controlled Trial on the Efficacy of Osteopathic Manipulative Medicine in Recovery from Concussions
Benedict, A. B., Torretta, C., Cholewicki, J., DeStefano, L. A., Fitton, N., Saffarian, M., Popovich, J. M., Zatkin, M., Lee, A., Sikorskii, A., Leslie, L., Shiver, Z.
Journal of Osteopathic Medicine, 2022/12
969

Effects of Osteopathic Manipulative Treatment on Primary Dysmenorrhea
Companion, N., Ahmed, E., Keys, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12
970

The Use of Osteopathic Manipulative Treatment (OMT) in the Management of Patients With Post-COVID Symptoms
Foss, V., Kaur, J., Stoukides, G., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12
971

Thomas L. Northup Lecture: Integrating Osteopathic Principles into Patient Care: An Approach for All Specialties
Snider, K.
The AAO Journal, 2022/12
Free full text
972

A Feasibility Study to Assess OMT for NAS
Householder, L., Glynn, B., Wadman, H., Hoffmann, K.
Journal of Osteopathic Medicine, 2022/12
973

Use of Osteopathic Manipulative Medicine in Treating Migraines
Lund, M., Pan, Y., Burns-Martin, J., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2022/12
974

Reduction in Stress Among Frontline Healthcare Workers Receiving Osteopathic Manipulation
Schnautz, R., Eilerman, A., Faherty, M.
Journal of Osteopathic Medicine, 2022/12
975

Impact of Osteopathic Manipulative Techniques on the Management of Dizziness Caused by Neuro-Otologic Disorders: Systemic Review and Meta-Analysis
Senger, B., Rehman, Y., Snider, K. T., Kirsch, J., Wang, M. Y.F., Johnston, R., Bingham, J., Ferguson, H., Swogger, S.
Journal of Osteopathic Medicine, 2022/12
976

Osteopathic Manipulative Treatment Efficacy in Mean HIT-6 Score Reduction in Tension-Type Headaches: A Meta-Analysis
Tran, E., Thomas, C., Zheng, T., Thalody, A., Winegar, A., Torelli, V., Wu, S. S.
Journal of Osteopathic Medicine, 2022/12
977

Efeitos do tratamento manipulativo osteopático nas manifestações musculoesqueléticas da fase crônica da febre Chikungunya : ensaio clínico randomizado
(Effects of osteopathic manipulative treatment on musculoskeletal manifestations in the chronic phase of Chikungunya fever: randomized clinical trial)
Tenório, L. C.
Unpublished MSc thesis, 2022/12
Free full text
978

A Randomized Controlled Trial of Osteopathic Manipulative Therapy to Reduce Cranial Asymmetries in Young Infants with Nonsynostotic Plagiocephaly
Bagagiolo, D., Priolo, C. G., Favre, E. M., Pangallo, A., Didio, A., Sbarbaro, M., Borro, T., Daccò, S., Manzoni, P., Farina, D.
American Journal of Perinatology, 2022/12
979

Diagnosis and management of headache disorders in osteopathic practice: A qualitative study
Tripodi, N., Cordina, J., Jaffre, D., Mason, K., McMahon, G., Xeureb-Graham, B., Yanovsky, R., Wospil, R.
International Journal of Osteopathic Medicine, 2022/12
980

Five challenges for manual therapies trials with placebo controls: A proposal
D'Alessandro, G., Ruffini, N., Iacopini, A., Annoni, M., Kossowsky, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/12
981

Approche somato-psychique de l'image du corps : Impact(s) d'une thérapie manuelle dans la prise en charge clinique de l'anorexie mentale sur les préoccupations corporelles
(Somato-psychic approach to body image: Impact(s) of a manual therapy in the clinical management of anorexia nervosa on bodily concerns)
Mattatia, J.
Unpublished PhD thesis, 2022/11
982

Preliminary Effects of Osteopathic Manipulative Medicine on Reactive Oxygen Species in Parkinson’s Disease: A Randomized Controlled Pilot Study
Docherty, J., Leheste, J. R., Mancini, J, Yao, S.
Cureus, 2022/11
Free full text
983

Physiotherapists and Osteopaths' Attitudes: Training in Management of Temporomandibular Disorders
Saran, S., Saccomanno, S., Petricca, M. T., Carganico, A., Bocchieri, S., Mastrapasqua, R. F., Caramaschi, E., Levrini, L.
Dentistry Journal, 2022/11
Free full text
984

Le toucher en ostéopathie, une ouverture au dialogue et à la relation.
(Touch in osteopathy, an opening to dialogue and relationship)
Beaulieu, A.
Soins Pédiatrie/Puériculture, 2022/11
985

Osteopathic Manipulative Medicine for Chronic Pain in the Setting of Cerebral Palsy
Dixon, D. S., Elwert, N. C., McDermott, G. A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/11
986

Student performance in medical biochemistry and genetics: comparing campus-based versus zoom-based lecture delivery
Faner, M. A., Ritchie, R. P., Ruger, K. M., Waarala, K. L., Wilkins, C. A.
BMC Medical Education, 2022/11
Free full text
987

Osteopathy: effectiveness and safety for musculoskeletal pain and overview of training and quality requirements. AIHTA Project Report No.: 144 2022
Gassner, L., Hofer, V.
HTA Austria – Austrian Institute for Health Technology Assessment GmbH, 2022/11
Free full text
988

Promoting cultural competency and osteopathic medicine awareness among premedical students through a summer premedical rural enrichment program
Kadavakollu, S., Lund, K. S., Swamy, V., Kim, W. D., Llenado, R. A., Nunes, T. F., Qureshi, M., Graneto, J. W., Boyanovsky, B. B.
Journal of Osteopathic Medicine, 2022/11
Free full text
989

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/11
Free full text
990

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11
991

Model-Base Estimation of Non-Invasive Ventilation Weaning of Preterm Infants Exposed to Osteopathic Manipulative Treatment: A Propensity-Score-Matched Cohort Study
Tarantino, A. G., Vismara, L., Buffone, F., Bianchi, G., Bergna, A., Vanoni, M., Tabbi, C., Bresesti, I., Agosti, M.
Healthcare, 2022/11
Free full text
992

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text
993

Osteopathy in the Cranial Field as a Method to Enhance Brain Injury Recovery: A Preliminary Study
Dickerson, M., Murphy, S., Hyppolite, N., Brolinson, P. G., VandeVord, P.
Neurotrauma Reports, 2022/10
Free full text
994

The Benefits of Integrative Medicine in the Management of Chronic Pain: A Review
Trivedi, H., Avrit, T. A., Chan, L., Burchette, M., Rathore, R.
Cureus, 2022/10
Free full text
995

Effect of osteopathic techniques on human resting muscle tone in healthy subjects using myotonometry: a factorial randomized trial
Bohlen, L., Schwarze, J., Richter, J., Gietl, B., Lazarov, C., Kopyakova, A., Brandl, A., Schmidt, T.
Scientific Reports, 2022/10
Free full text
996

Bilateral idiopathic superior ophthalmic vein dilation
Villafuerte, D. B.
Journal of Osteopathic Medicine, 2022/10
Free full text
997

Effects of osteopathic manipulative treatment of the pivots on lower limb function in young professional football players
Thomas, E., Petrucci, M., Barretti, M., Messina, G., Cavallaro, A. R., Bianco, A.
Journal of Bodywork and Movement Therapies, 2022/10
998

Osteopathic manipulative treatment use among family medicine residents in a teaching clinic
Caldwell, G., Zeng, L., Kaufman, J., Bates, J.
Journal of Osteopathic Medicine, 2022/10
Free full text
999

Conservative management of symptomatic degenerative and isthmic spondylolisthesis in adults: A scoping review
Mauch, M.
Unpublished MSc thesis, 2022/10
Free full text
1000

Postoperative Osteopathic Manipulative Treatment in Children with Esophageal Atresia: Potential Benefits on the Anthropometric Parameters
Manzotti, A., Alati, A., Galli, M., Cerritelli, F., Leva, C., Alberti, A., Stizzoli, A., Costanzo, S., Canonica, C. P. M., Destro, F., Zuccotti, G., Calcaterra, V., Pelizzo, G.
Pediatric Reports, 2022/10
1001

Osteopathie in relatie tot menstruatieklachten bij een patiënte die lijdt aan endometriose en adenomyose. Een casestudie
(Osteopathy in relation to menstrual complaints in a patient who is suffering from endometriosis and adenomyosis. A case study)
den Braver- Scherpenzeel, M. R.
unpublished D.O. thesis, 2022/10
Free full text
1002

Effectiveness of cranial osteopathy therapy on nociception in equine back as evaluated by pressure algometry
Vokietytė-Vilėniškė, G., Nagreckienė, S., Duliebaitė, I., Žilaitis, V.
Acta Veterinaria Brno, 2022/10
Free full text
1003

Effect of Visceral Mobilization on Abdomino-Phrenic Dyssynergia in Irritable Bowel Syndrome Patients
Hammam, E. E. E.D., Sayed, A. A., Abdelkader, F., El-Moatasem, A. M.
The Egyptian Journal of Hospital Medicine, 2022/10
Free full text
1004

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1005

Chronischer Reizhusten in der osteopathischen Praxis
(Chronic dry cough in osteopathic practice)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1006

Traumasensible Vorgehensweise in der osteopathischen Praxis
(Trauma-sensitive approach in osteopathic practice)
Heuer, I., Tann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1007

Die Rolle der Osteopathie im Geburtsprozess – eine qualitative Studie
(The role of osteopathy in the birth process - a qualitative study)
Janisz, M., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1008

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie – Teil 2
(Positional plagiocephaly: The role of brainstem sensitization in the pathophysiology of positional plagiocephaly - Part 2)
Zweedijk, R.
Osteopathische Medizin, 2022/09
1009

Andrew Taylor Still lebt: Ent-wicklungslinien der osteopathischen Forschung und Lehre
(Andrew Taylor Still is alive: Lines of development of osteopathic research and teaching)
Levin, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1010

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text
1011

Efectividad del tratamiento osteopático en la plagiocefalia
(Effectiveness of osteopathic treatment for plagiocephaly)
Gamarra Herraiz, L.
European Journal Osteopathy & Related Clinical Research, 2022/09
Free full text
1012

Zirkumventrikuläre Organe und phänodynamische Osteopathie
(Circumventricular organs and phenodynamic osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1013

Osteopathic status in people who have had a new coronavirus infection, 3–6 months after the disease
(Остеопатический статус лиц, перенесших новую коронавирусную инфекцию, через 3–6 мес после заболевания)
Aptekar, I. A., Abramova, E. V.
Russian Osteopathic Journal, 2022/09
1014

Piriformis syndrome
(Синдром грушевидной мышцы)
Belash, V. O., Petrova, E. A.
Russian Osteopathic Journal, 2022/09
1015

Justification of the use of osteopathic correction in the planned preparation of patients for general anesthesia with tracheal intubation
(Обоснование использования остеопатической коррекции при плановой подготовке больных к общей анестезии с интубацией трахеи)
Kurnoskin, V. L., Kurbatov, O. I.
Russian Osteopathic Journal, 2022/09
1016

Study of the effectiveness of osteopathic correction of the Ist toe valgus deformity of the I–II degree
(Исследование эффективности остеопатической коррекции вальгусной деформации I пальца стопы I–II степени)
Minakova, A. L., Ustinov, A. V.
Russian Osteopathic Journal, 2022/09
1017

Modern approaches to osteopathic diagnostics, its theoretical and practical foundations
(Современные подходы к остеопатической диагностике, её теоретические и практические основы)
Mokhov, D. E., Potekhina, Y. P., Gurichev, A. A.
Russian Osteopathic Journal, 2022/09
1018

The impact of osteopathic correction on the life quality of pregnant women
(Влияние остеопатической коррекции на качество жизни беременных)
Nenashkina, E. N.
Russian Osteopathic Journal, 2022/09
1019

Multidisciplinary approach in the treatment of chronic tension headache on the background of COVID-19
(Мультидисциплинарный подход при лечении хронической головной боли напряжения на фоне COVID-19)
Novikov, Y. O., Akopian, A. P., Amigues, F. A.
Russian Osteopathic Journal, 2022/09
1020

Effects of Balanced Ligamentous Osteopathic Technique over LV in low back pain
(Влияние остеопатической техники сбалансированного лигаментозного натяжения (BLT) на LV при люмбалгии)
Schenone, L. E.
Russian Osteopathic Journal, 2022/09
1021

Substantiation of the economic efficiency of the author′s manual repositioning method of the shoulder joint
(Обоснование экономической эффективности авторской мануальной методики вправления вывиха плеча)
Slabospitskii, M. A., Mokhov, D. E., Limarev, V. V., Tkachenko, P. V., Tkachenko, A. N., Mansurov, D. S., Khaydarov, V. M.
Russian Osteopathic Journal, 2022/09
1022

The Portuguese osteopaths attitudes towards a biomechanical or biopsychosocial model in the approach of chronic low back pain – A cross-sectional questionnaire-based survey
Dinis, M., Silva, C., Cruz, R., Esteves, J., Nunes, A.
International Journal of Osteopathic Medicine, 2022/09
1023

Case Report on Visceral Manipulation in Adolescent Idiopathic Scoliosis
Chahab, M., Donnet, P., Hernandez, D.
International Journal of Therapeutic Massage and Bodywork, 2022/09
1024

Interaktion zwischen Gehirn und Herz: Modifikation der Interaktion zwischen Gehirn und Herz bei chronischen Schmerzen durch osteopathische Behandlung
(Interaction between brain and heart: modification of brain-heart interaction in chronic pain by osteopathic treatment)
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Osteopathische Medizin, 2022/09
1025

Osteopathie als personenzentrierte und integrierende Behandlungsmethode – Teil 1
(Osteopathy as a person-centered and integrative treatment method - Part 1)
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/09
1026

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09
1027

Osteopathische Geriatrie: Teil 1: Grundlagen, Ziele
Osteopathic geriatrics - Part 1: Basics, goals
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/09
1028

Osteopathische Behandlung von Patienten mit episodischer Migräne. Prospektive, multizentrische, kontrollierte randomisierte Studie
(Osteopathic treatment of patients with episodic migraine. Prospective, multicenter, controlled randomized study)
Stolzmann, K., Ziller, M., Britz, I., de Braganca, L., Thielen, F.
Unpublished D.O. thesis, 2022/09
1029

Die Behandlung der idiopathischen Asymmetrie und lagebedingten Plagiozephalie bei Säuglingen im ersten Lebensjahr. Eine systematische Literaturrecherche
(The treatment of idiopathic asymmetry and positional plagiocephaly in infants in the first year of life. A systematic literature review)
Daake, B.
Unpublished D.O. thesis, 2022/09
1030

Osteopathische Behandlung von Frauen mit Beckengürtelschmerz post partum (PPGP). Randomisierte kontrollierte Studie
(To evaluate the effectiveness of custom tailored osteopathic treatment in women suffering from pelvic girdle pain after childbirth.)
Richterink, J., Bruns, A.
Unpublished D.O. thesis, 2022/09
1031

Lassen sich durch osteopathische Behandlungen von Patienten mit gastroösophagealem Reflux zusätzlich zur medikamentösen Standardbehandlung die Symptome verbessern? Randomisierte kontrollierte Studie
(Osteopathic treatment in addition to medical standard therapy in patients with Gastroesophageal Reflux Disease (GERD). A randomized controlled trial.)
Dannmeyer, A., Severin, F., Stisser, C.
Unpublished D.O. thesis, 2022/09
1032

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text
1033

Comparing In-person vs. Live-streamed Osteopathic Manual Medicine Lab Instruction
Ellis, M., Finneran, K., Jie, C., Lewis, D.
The AAO Journal, 2022/09
Free full text
1034

Osteopathic Manipulative Treatment for Optic Pathway Glioma
Gordon, S., Hagopian, S.
The AAO Journal, 2022/09
Free full text
1035

The content of micro and macroelements in the oral fluid at different intensity of dental caries
(Содержание микро и макроэлементов в ротовой жидкости при разной интенсивности кариеса зубов)
Uspenskaya, O. A., Zhdanova, M. L., Kostrova, E. L., Potekhina, Y. P.
Russian Osteopathic Journal, 2022/09
1036

Treatment of infant colic with craniosacral therapy. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/09
Free full text
1037

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text
1038

Effectiveness of Osteopathic Manipulation Treatment in the Rehabilitation of Post-External Immobilization for a Supracondylar Fracture of the Distal Humerus: A Case Report
Paiva, A., Bruntmyer, H. C.
The AAO Journal, 2022/09
Free full text
1039

Efectividad del tratamiento osteopático en pacientes con migraña
(Effectiveness of osteopathic treatment in patients with migraine)
Insausti, P. J.
European Journal Osteopathy & Related Clinical Research, 2022/09
Free full text
1040

Thoracic outlet syndrome due to first rib subluxation in a 69-year-old woman
Deveze, E., Daligault, M., Ammi, M., Picquet, J.
Annals of Vascular Surgery - Brief Reports and Innovations, 2022/09
Free full text
1041

Investigating the safety and feasibility of osteopathic medicine in the pediatric oncology outpatient setting
Belsky, J. A., Stanek, J. R., Rose, M. J.
Journal of Osteopathic Medicine, 2022/08
Free full text
1042

Effectiveness of osteopathic interventions in patients with non-specific neck pain: A systematic review and meta-analysis
Dal Farra, F., Buffone, F., Risio, R. G., Tarantino, A. G., Vismara, L., Bergna, A.
Complementary Therapies in Clinical Practice, 2022/08
1043

Reasons Office-Based Physicians in the United States Recommend Common Complementary Health Approaches to Patients: An Exploratory Study Using a National Survey
Stussman, B. J., Nahin, R. L., Barnes, P. M., Scott, R., Feinberg, T., Ward, B. W.
Journal of Integrative and Complementary Medicine, 2022/08
Free full text
1044

“What you feel under your hands“: exploring professionals' perspective of somatic dysfunction in osteopathic clinical practice-a qualitative study
Arcuri, L., Consorti, G., Tramontano, M., Petracca, M., Esteves, J. E., Lunghi, C.
Chiropractic & Manual Therapies, 2022/08
Free full text
1045

Response to “Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine“
Marshall, S.
Journal of Osteopathic Medicine, 2022/08
Free full text
1046

Osteopathic Treatment for Gastrointestinal Disorders in Term and Preterm Infants: A Systematic Review and Meta-Analysis
Buffone, F., Monacis, D., Tarantino, A. G., Farra, F., Bergna, A., Agosti, M., Vismara, L.
Healthcare, 2022/08
Free full text
1047

The Role of Osteopathic Care in Gynaecology and Obstetrics: An Updated Systematic Review
Ruffini, N., D', Alessandro, G., Pimpinella, A., Galli, M., Galeotti, T., Cerritelli, F., Tramontano, M.
Healthcare, 2022/08
Free full text
1048

The Main Changes in Pregnancy - Therapeutic Approach to Musculoskeletal Pain
Fiat, F., Merghes, P. E., Scurtu, A. D., Almajan Guta, B., Dehelean, Cristina A., Varan, N., Bernad, E.
Medicina, 2022/08
Free full text
1049

Thoracic Manual Therapy Improves Pain and Disability in Individuals With Shoulder Impingement Syndrome Compared With Placebo: A Randomized Controlled Trial With 1-Year Follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/08
1050

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text
1051

Cranial osteopathic techniques and electroencephalogram (EEG) alpha power: a controlled crossover trial
Cella, M., Acella, E., Aquino, A., Pisa, V.
Journal of Osteopathic Medicine, 2022/08
Free full text
1052

Effectiveness of Osteopathic Treatment on the Spinal Column as Measured by the Spinal Mouse®: A Case Series
Colati, R., Pagano, A.
Cureus, 2022/08
Free full text
1053

Thoracic manual therapy improves pain and disability in individuals with shoulder impingement syndrome compared to placebo: a randomised controlled trial with one year follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/08
1054

Osteopathic Manipulative Treatment and the Management of Headaches: A Scoping Review
Jara Silva, C. E., Joseph, A. M., Khatib, M., Knafo, J., Karas, M., Krupa, K., Rivera, B., Macia, A., Madhu, B., McMillan, M., Burtch, J., Quinonez, J., Albert, T., Khanna, D.
Cureus, 2022/08
Free full text
1055

Effect of visceral manipulation on menstrual complaints in women with polycystic ovarian syndrome
Yosri, M. M., Hamada, H. A., Yousef, A. M.
Journal of Osteopathic Medicine, 2022/08
Free full text
1056

Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine
Sookaromdee, P., Wiwanitkit, V.
Journal of Osteopathic Medicine, 2022/08
Free full text
1057

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08
1058

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07
1059

Idiopathic linear IgA bullous dermatosis with mucosal involvement
Ambur, A. B., Nyckowski, T. A.
Journal of Osteopathic Medicine, 2022/07
Free full text
1060

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text
1061

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text
1062

Osteopathic Manipulative Treatment for Pediatric Conditions: An Update of Systematic Review and Meta-Analysis
Posadzki, P., Kyaw, B. M., Dziedzic, A., Ernst, E.
Journal of Clinical Medicine, 2022/07
Free full text
1063

Interventions non-pharmacologiques et syndrome de l’intestin irritable: revue de la littérature et méthodologie des essais thérapeutiques pour l’évaluation de l’efficacité de l’ostéopathie
(Nonpharmacological interventions and irritable bowel syndrome: review of the literature and methodology of therapeutic trials for the evaluation of the effectiveness of osteopathy)
Amsallem, F.
Unpublished PhD thesis, 2022/07
Free full text
1064

Response to “Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects”
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2022/07
Free full text
1065

Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects
Gawrys, S. P., Bradshaw, J. T., Parker, L. M.
Journal of Osteopathic Medicine, 2022/07
Free full text
1066

Review of medication-assisted treatment for opioid use disorder
Ghanem, N., Dromgoole, D., Hussein, A., Jermyn, R. T.
Journal of Osteopathic Medicine, 2022/07
Free full text
1067

Osteopathic practice in the United Kingdom: A retrospective analysis of practice data
Plunkett, A., Fawkes, C., Carnes, D.
PLoS One, 2022/07
Free full text
1068

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07
1069

Successful Osteopathic Manipulative Treatment of Foot Drop
Tafler, L., Katz, V., Kolesnikov, V., Singh, R.
Cureus, 2022/07
Free full text
1070

Reduction and Resolution of a Hiatal Hernia Using Osteopathic Manipulative Treatment: A Case Report
Volokitin, M., Song, A., Peck, M. T., Milani, S.
Cureus, 2022/07
Free full text
1071

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07
1072

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07
1073

Resolution of rosacea-associated persistent facial edema with osteopathic manipulative treatment
Jay, R., Rodger, J.
JAAD Case Reports, 2022/07
Free full text
1074

Effectiveness of osteopathic manipulative treatment for pediatric conditions: A systematic review
Franke, H, Franke, J.D., Fryer, G.
Journal of Bodywork and Movement Therapies, 2022/07
1075

Cervical cancer screening among women with comorbidities: a cross-sectional examination of disparities from the behavioral risk factor surveillance system
Austin, J., Delgado, P., Gatewood, A., Enmeier, M., Frantz, B., Greiner, B., Hartwell, M.
Journal of Osteopathic Medicine, 2022/07
Free full text
1076

Response to “Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects“
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2022/07
Free full text
1077

Wirkung osteopathischer Behandlungen im 1. Lebensjahr
(Effect of osteopathic treatments in the 1st year of life)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
1078

Hüft-Totalendoprothese
(Total hip replacement)
Grasmück, J., Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
1079

Técnicas osteopáticas para la liberación emocional: Monografía
(Osteopathic Techniques for Emotional Release: Monograph)
Vallecia Barragán, L. J.
Unpublished MSc thesis, 2022/07
Free full text
1080

Osteopathic Manipulative Treatment for Refractory Gastroesophageal Reflux Disease (GERD)
Yassin, K., Mutter, C., Waters, H., Mehra, R.
The AAO Journal, 2022/06
Free full text
1081

Holistic osteopathic approach to the care of veterans with post-traumatic stress disorder: Case report
Lovy, A., Berkowitz, M. R.
The AAO Journal, 2022/06
Free full text
1082

The Effect of Osteopathic Manipulative Treatment in Pregnancy on Labor Duration: A Meta-Analysis
Zak, A., Streeter, E., Tran, N., Wales, A., Yep, M., Rowane, M.
The AAO Journal, 2022/06
Free full text
1083

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie –Teil 1
(Positional plagiocephaly: the role of brainstem sensitization in the pathophysiology of positional plagiocephaly -Part 1)
Zweedijk, R.
Osteopathische Medizin, 2022/06
1084

Reply to Kudus, A.L. Comment on “Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845“
Brandl, A., Egner, C., Schleip, R.
Life (Basel), 2022/06
Free full text
1085

Efectividad del tratamiento osteopático en el estrés
(Effectiveness of osteopathic treatment for stress)
Ramírez López, A.
European Journal Osteopathy & Related Clinical Research, 2022/06
Free full text
1086

Efectividad del tratamiento osteopático en pacientes con reflujo gastroesofágico
(Effectiveness of osteopathic treatment in patients with gastroesophageal reflux)
Díaz Villalba, A.
European Journal Osteopathy & Related Clinical Research, 2022/06
Free full text
1087

Efectividad de la terapia manual en cervicalgias asociadas a trastornos temporomandibulares
(Effectiveness of manual therapy in neck pain associated with temporomandibular disorders)
Vera Serrano, F. J.
European Journal Osteopathy & Related Clinical Research, 2022/06
1088

Osteopathic treatment of newborns and infants: efficiency and associated risks (a systematic review of literature in English and in French
(Остеопатическое лечение новорожденных и грудных младенцев: эффективность и связанные с ним риски (систематический обзор англоязычной и франкоязычной литературы)
Maroye, L., Klein, P., Dethier, C., Dugailly, P.M.
Russian Osteopathic Journal, 2022/06
1089

The use of osteopathic correction in the complex rehabilitation of patients with acute cerebrovascular accident
(Применение остеопатической коррекции в комплексной реабилитации пациентов с острым нарушением мозгового кровообращения)
Belash, V. O., Gritsay, E. O., Musina, T. S.
Russian Osteopathic Journal, 2022/06
1090

A Holistic Approach to Physical and Mental Health: Associations Between Chronic Disease and Psychiatric Conditions
Patel, P., Mancuso, A.
Psychology Health & Medicine, 2022/06
1091

Osteopathic status of maternity patients after spinal anesthesia and the possibility of its correction
(Остеопатический статус родильниц после спинномозговой анестезии и возможности его коррекции)
Bobrova, A. S., Shkryabina, A. M., Khatkevich, A. K., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/06
1092

Comment on Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845
Kudus, A. L.
Life (Basel), 2022/06
Free full text
1093

Osteopathy and physiotherapy compared to physiotherapy alone on fatigue in long COVID: Study protocol for a pragmatic randomized controlled superiority trial
Certain Curi, A. C., Antunes Ferreira, A. P., Calazans Nogueira, L. A., Mello Meziat Filho, N. A., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2022/06
Free full text
1094

Study of cervico-oral synergies in patients undergoing orthodontic treatment
(Исследование цервико-оральных синергий у пациентов, проходящих ортодонтическое лечение)
Milutka, Y. A., Basieva, E. V., Tarasov, N. A., Silin, A. V., Mokhov, D. E.
Russian Osteopathic Journal, 2022/06
1095

The possibility of osteopathic correction methods in the treatment of facial pain
(Возможность применения остеопатических методов коррекции в терапии лицевой боли)
Popov, A. S.
Russian Osteopathic Journal, 2022/06
1096

The influence of cultural philosophies on clinical practice of spinal manipulation: A comparison in Chinese manipulative therapy versus New Zealand osteopathy for the treatment of musculoskeletal disorders
Zhao, Y.
Unpublished MSc thesis, 2022/06
1097

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06
1098

Osteopathic Evaluation and Positional Plagiocephaly: A Descriptive Study on a Population of Children with ASD
Di Renzo, M., Laurenti, A., Di Castelbianco, F. B., Vanadia, E., Petrillo, M., D’Errico, S., Ferrara, R., Racinaro, L., Rea, M.
American Journal of Pediatrics, 2022/06
Free full text
1099

Comparison of the Effect of Osteopathic Manipulations and Exercises on the Myoelectric Activity of the Pelvic Floor: A Randomized Controlled Trial
Arcanjo, G. N., Pires, Jlvr, Jacinto, M. E. M., Colares, J. M., Belo, L. M. C., Lima, P. O. P., Vilaça-Alves, J.
Journal of Chiropractic Medicine, 2022/06
1100

Komplementäre und integrative Medizin (CIM) in der Kinderheilkunde: Untersuchung zur Bereitschaft und zum Wunsch der Eltern, CIM als Selbstzahlerleistung in Anspruch zu nehmen
(Complementary and integrative medicine (CIM) in pediatrics: survey of parents' willingness and desire to use CIM as a self-pay service.)
Anheyer, Dennis
Osteopathische Medizin, 2022/06
1101

Adjunctive osteopathic therapy for hospitalized COVID-19 patients: A feasibility-oriented chart review study with matched controls
Lennon, R. P., Dong, H., Zgierska, A. E., Demetriou, T., Croad, J., Livelsberger, C., Hodge, L., Mendez-Miller, M., Darby, A., Rabago, D.
International Journal of Osteopathic Medicine, 2022/06
1102

Impact of timing of preoperative gabapentin administration on postoperative somnolence
Ghaith, S., Quillen, J. K., Mead-Harvey, C., Buras, M. R., Wasson, M. N.
Journal of Osteopathic Medicine, 2022/06
Free full text
1103

Tongue stretching: technique and clinical proposal
Buscemi, A., Coco, M., Rapisarda, A., Frazzetto, G., Di Rosa, D., Feo, S., Piluso, M., Presente, L. P., Campisi, S. S., Desirò, P.
Journal of Complementary and Integrative Medicine, 2022/06
Free full text
1104

Psychosocial Interventions for the Treatment of Functional Abdominal Pain Disorders in Children: A Systematic Review and Meta-analysis
Gordon, M., Sinopoulou, V., Tabbers, M., Rexwinkel, R., de Bruijn, C., Dovey, T., Gasparetto, M., Vanker, H., Benninga, M.
JAMA Pediatrics, 2022/06
Free full text
1105

Effect of Physique on Medical Students’ Perceived Physical Ability to Perform Osteopathic Manipulative Treatment (OMT)
Than, S., Santos, L., Lin, X., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text
1106

The Successful Use of Osteopathic Manipulative Treatment (OMT) for Positional Plagiocephaly: Now He's an Ambi-turner!
Harris, Z., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
1107

To the Editor: Limitations and Alternative Solutions to a USMLE COMLEX-USA Concordance
Jurich, D., Liu, C., Clauser, A.
Journal of Graduate Medical Education, 2022/06
Free full text
1108

To the Editor: Response to: Limitations and Alternative Approaches to a USMLE COMLEX-USA Concordance
Sandella, J., Boulet, J., Barnum, S., Tsai, T. H., Wang, Y.
Journal of Graduate Medical Education, 2022/06
Free full text
1109

Abnormal Foot Progression Angle Kinematics in Cervical Dystonia Improved After Osteopathic Manipulative Medicine: A Prospective Case Series
Mancini, J., Oliff, Z., Abu-Sbaih, R., Simone, J., LaRosa, A., Mody, S., Li, T. S., Leder, A.
Cureus, 2022/06
Free full text
1110

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text
1111

A long COVID patient and their experience of osteopathic care: A case report
Monro, M.
International Journal of Osteopathic Medicine, 2022/06
1112

Relevance of historical osteopathic principles and practices in contemporary care: Another perspective from traditional/complementary and alternative medicine
Vogel, S., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2022/06
Free full text
1113

An Osteopathic Manipulative Treatment (OMT) Evaluation and Treatment Protocol to Improve Gastrointestinal Function
Heineman, K.
The AAO Journal, 2022/06
Free full text
1114

Study of the osteopathic correction effectiveness of pectalgic syndrome in students
(Исследование эффективности остеопатической коррекции пекталгического синдрома у студентов)
Valiullova, L. V., Gilmutdinova, G. R., Safiullina, A. A.
Russian Osteopathic Journal, 2022/06
1115

Comparative analysis of osteopathic correction and standard comprehensive rehabilitation of patients with posttraumatic contractures of the upper limb joints
(Сравнительный анализ остеопатической коррекции и стандартной комплексной реабилитации пациентов с посттравматическими контрактурами суставов верхней конечности)
Zamanov, A. R., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2022/06
1116

Osteopathic Manipulation of Pelvic Floor Muscle Dysfunction Improves Chronic Lower Back Pain
Torres, J.
The AAO Journal, 2022/06
Free full text
1117

A study of consumer expectations and requirements for the quality of osteopathic services in parents of minor patients
(Исследование потребительских ожиданий и требований к качеству услуг по остеопатии у родителей несовершеннолетних пациентов)
Vinitskaya, T. V.
Russian Osteopathic Journal, 2022/06
1118

Response to Osteopathic Manipulative Treatment in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
Bomani-Bailey, A., Xu, T., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
1119

Variations in Average Cranial Rhythmic Impulse Rates
Crider, T., Grimm, J., Kozar, A., Tobey, A. H.
The AAO Journal, 2022/06
Free full text
1120

An Osteopathic Approach to Secondary Enuresis and Encopresis: Recovering Autonomic Stability
Goodman, F., Ammons, R., Gebhardt, G., Largent, J.
The AAO Journal, 2022/06
Free full text
1121

Transverse colon adenocarcinoma with direct cutaneous extension: complex multidisciplinary surgical management
Snow, Z. A., Marshall, B. N., Dreher, P., Parikh, S. N., Walchak, A., Cahn, D. B.
Journal of Osteopathic Medicine, 2022/06
Free full text
1122

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
1123

SCIWORA: A Pediatric Case
Masterson, C., Byrd, A., Gebhardt, G.
The AAO Journal, 2022/06
Free full text
1124

The effect of longitudinal osteopathic experiences on family medicine resident confidence and utilization of osteopathic manipulative treatment
Matsushita, S., Lee, E., Pipitone, O., Vester, A.
The AAO Journal, 2022/06
Free full text
1125

Nurturing the Breath of Life: A Retrospective Analysis of the Effect of Osteopathic Manipulative Treatment on Patients Ventilated for COVID-19
Murphy, S., Mercer, A., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
1126

A Randomized Pilot Study Comparing Bilirubin Levels of Newborns Treated with Osteopathic Manipulative Treatment (OMT) Versus Routine Newborn Care Alone
Stephenson, C. M., Fremarek, N., Lentz, A., Klene-Bowns, A., Boeve, M., Brinsky, K., Chatterley, L., Yarling, C., Caldwell, G., Grundwaldt, D.
The AAO Journal, 2022/06
Free full text
1127

Picking Apples and Somatic Dysfunctions: A Case Study of Osteopathic Manipulative Treatment in the Farmworker Community
Ackerman, K., Gavin, K., Johnson, D.
The AAO Journal, 2022/06
1128

The Effects of a Novel Virtual Reality Osteopathic Manipulative Medicine Program on First Year Practical Exam Scores
Ahmed, E., Jose, J., Stout, R., Yao, S. C.
The AAO Journal, 2022/06
Free full text
1129

Augmentation of Immune Response to COVID-19 mRNA Vaccination Through Osteopathic Manipulative Treatment
Ahn, B., Martinez, E., Hadiprodjo, H., Jackson, C., Gutierrez, M., Crone, P., Loveless, B., Fuchs, S., Szurmant, H., Sanchez, J.
The AAO Journal, 2022/06
Free full text
1130

Utilizing Osteopathic Manipulative Techniques to Mitigate Fall Risk Among Hospitalized Elderly Patients: A Literature Review
Arshad, U., Baum, B., Carter, R., Gustowski, S.
The AAO Journal, 2022/06
Free full text
1131

Upper Cross Syndrome and a Guarded Heart: Posture in a Case of Depression
Benzell, J. A., Abend, D., Bailey, J., Cooley, D., King Channell, M.
The AAO Journal, 2022/06
Free full text
1132

Osteopathic Manipulative Treatment of Individual with Intractable Singultus
Bloch, R., Kempa, M., Lippert, J.
The AAO Journal, 2022/06
Free full text
1133

SOAP Note Review: Evaluating Osteopathic Principles and Practice in Clinical Education
Budny, B., Gigliotti, D., Diggs, B., Fotopoulos, T., Johns, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text
1134

An Osteopathic Approach to Chronic Pelvic Pain
Cameron, D. L., Mainville, M., Wallace-Ross, J.
The AAO Journal, 2022/06
Free full text
1135

Effects of Osteopathic Manipulative Treatment (OMT) on Anosmia and Ageusia in Post-COVID-19 Patient: A Case Report
Companion, N., Ventimiglia, M., Yao, S. C.
The AAO Journal, 2022/06
Free full text
1136

An Uncommon Cause of Common Peroneal Nerve Paresthesia: The Effect of Osteopathic Manipulative Treatment on Ganglion Cyst-Induced Common Peroneal Nerve Paresthesia
Cortes, M., Shah, N., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
1137

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
1138

Relief of Post-COVD-19 Burning Mouth Syndrome (BMS) with OMM- A case study
Frankini, E. L., Leder, A., Yao, S. C.
The AAO Journal, 2022/06
Free full text
1139

Body-Mind-Spirit Connection as an Approach to Treatment of Spasmodic Torticollis
Haley, L., Clark, M., Litman, R., Heller, G.
The AAO Journal, 2022/06
Free full text
1140

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
1141

Osteopathic Manipulative Treatment may be a Cost-Effective Approach to Reducing Pain Associated with Acute Flare of Interstitial Cystitis
Hermann, S. J., Barnett, M. E., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
1142

Effects of Osteopathic Manipulative Therapy on Temporomandibular Joint Disorders
Honeyman, J., Robke, B., Reed, G., Jacob, L., O'Donnell, M., Lynch, W. D., Moore, W.
The AAO Journal, 2022/06
Free full text
1143

Out of Place: An Osteopathic Approach to Recurrent Shoulder Dislocations in an Ehlers Danlos Patient
Lambros, S., Tuyn, D., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
1144

Effect of Medical School Experiences on Perceived Likelihood of Performing Osteopathic Manipulative Treatment (OMT) in Future Practice
Lin, X., Santos, L., Than, S., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text
1145

Managing Muscle Rigidity: An Osteopathic Approach to the Treatment of Stiff Person Syndrome
Mainville, M., Cameron, D. L., Barry, P.
The AAO Journal, 2022/06
Free full text
1146

Osteopathic Manipulative Treatment of the Deep Fascia for the Treatment of Chronic Trauma-induced Somatic Dysfunction
Nelson, C., Henderson, J., Kim, C., Le, B., Mintier, K.
The AAO Journal, 2022/06
Free full text
1147

The Soft Tissue Clinic Experience (SCTE): A sustainable way for early medical students to develop patient interaction and manipulative treatment skills
Ouyang, Z., Murphy, R., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
1148

An Osteopathic Approach to Childhood Scoliosis and Leg Length Inequality in a Pediatric Patient with Chiari I Malformation
Schultz, R., Baig, Y., Henderson, K. K., Heinking, K. P.
The AAO Journal, 2022/06
Free full text
1149

Establishing OMT as a Key Treatment Modality in Injury Rehabilitation: Teres Major Tear
Shah, N., Cortes, M., Posey, A.
The AAO Journal, 2022/06
Free full text
1150

Novel Lymphatic Counterstrain (LC) in a Case of Low Ankle Sprain
Trinh, D., Henderson, J., Goering, E.
The AAO Journal, 2022/06
Free full text
1151

Uncovering Trigger Points Masked by Lumbar Radiculopathy
Tuyn, D., Lambros, S., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
1152

“Skateboard to the Head” A Case of Persistent Headaches Following Blunt Eye Trauma
Williams, D., Richie, C.
The AAO Journal, 2022/06
Free full text
1153

Restricted Shoulder Range of Motion: A Neglected Component That May Surprise You
Williams, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text
1154

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text
1155

Complementary medicine visits by palliative care patients: a cross-sectional survey
Steel, Amie, Schloss, Janet, Diezel, Helene, Palmgren, Per J., Maret, Jean Baptiste, Filbet, Marilène
BMJ Supportive and Palliative Care, 2022/05
1156

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text
1157

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text
1158

The Importance of Pelvic and Leg Length Assessment in the Setting of Postpartum Lower Back Pain
Tafler, L., Wilson, D., Tafler, P.
Cureus, 2022/05
1159

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text
1160

Effect of osteopathic manipulation of the sacroiliac joint vs electrotherapy on pain and functional disability in patients with low back pain: A pilot study
Rodríguez-Pastor, J. A., Caro-Puértolas, B., Caña-Pino, A., Sánchez-Preciado, A. M., Garrido-Ardila, E. M., Apolo-Arenas, M. D.
Journal of Back and Musculoskeletal Rehabilitation, 2022/05
1161

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05
1162

Association of sleep quality and chronification of musculoskeletal pain in an older adult: A case report
Westendorp, R., Thaker, V., Srbely, J.
International Journal of Osteopathic Medicine, 2022/05
1163

Upgrade rate of percutaneously diagnosed pure flat epithelial atypia: systematic review and meta-analysis of 1,924 lesions
Ferre, R., Kuzmiak, C. M.
Journal of Osteopathic Medicine, 2022/05
Free full text
1164

Effects of osteopathic manipulative treatment vs. osteopathic cranial manipulative medicine on Parkinsonian gait
Terrell, Z. T., Moudy, S. C., Hensel, K. L., Patterson, R. M.
Journal of Osteopathic Medicine, 2022/05
Free full text
1165

Evaluation de la qualité de la prise en charge ostéopathique de patientes souffrant de douleurs chroniques pelviennes dues à l'endométriose : une série de cas
(Assessing the quality of osteopathic management of patients with chronic pelvic pain due to endometriosis: a case series)
Litzistorf, S., Pires, N.
Unpublished MSc thesis, 2022/04
Free full text
1166

An updated brief overview on post-traumatic headache and a systematic review of the non-pharmacological interventions for its management
Argyriou, A. A., Mitsikostas, D. D., Mantovani, E., Litsardopoulos, P., Panagiotopoulos, V., Tamburin, S.
Expert Review of Neurotherapeutics, 2022/04
Free full text
1167

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text
1168

Exploring the Effects of Standardized Soft Tissue Mobilization on the Viscoelastic Properties, Pressure Pain Thresholds, and Tactile Pressure Thresholds of the Cesarean Section Scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Integrative and Complementary Medicine, 2022/04
Free full text
1169

Osteopathy as a complementary/alternative medicine for breast cancer: a Canadian case study and comprehensive review
Fortin, J., Beaupré, A., Thamar Louis, L. A., Roy, C.A., Bourque, M. A., Cappeliez, S., Fadhlaoui, A.
Breast Cancer Management, 2022/04
Free full text
1170

Incidence Rate of Somatic Dysfunction in Previously Undiagnosed Spotted Fever Rickettsiosis: A Case Report
Unger, M. D., Palmer, J. L., Thorsvik, N. M.
Cureus, 2022/04
Free full text
1171

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text
1172

The effect of osteopathic manipulative treatment on anaerobic performance and lactate clearance in male athletes: a double-blind, randomized, sham-controlled, crossover study
Akkaş, M. B., Belviranli, M., Okudan, N.
The Journal of Sports Medicine and Physical Fitness, 2022/04
1173

Osteopathic management of dysmenorrhea: A qualitative snapshot of New Zealand women’s experiences
Leys, A. E.
Unpublished MSc thesis, 2022/04
Free full text
1174

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text
1175

Comparative assessment of osteopathy technique with manual therapy associated with biofeedback in patients with the lumbar spine pain.
Mańko, G., Jekiełek, M., Sosulska, A., Pieniążek, M., Jaszczur-Nowicki, J.
Medical Rehabilitation, 2022/04
Free full text
1176

Improving practice patterns in patients with newly diagnosed bladder masses treated with transurethral resection
Wilson, J., Drach, D., Zanghi, J., Siegert, J.
Journal of Osteopathic Medicine, 2022/04
Free full text
1177

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) residency curriculum guidelines to meet Accreditation Council for Graduate Medical Education (ACGME) milestones
Balyakina, E. S., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2022/04
Free full text
1178

Retention of tissue texture change after cervical muscle energy and high velocity low amplitude intervention: implications for treatment intervals
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2022/04
Free full text
1179

Clinical evaluation and management of calcific tendinopathy: an evidence-based review
Catapano, M., Robinson, D. M., Schowalter, S., McInnis, K. C.
Journal of Osteopathic Medicine, 2022/04
Free full text
1180

A Review of Glymphatics and the Impact of Osteopathic Manipulative Treatment in Alzheimer's Disease, Concussions, and Beyond
Marino, M. A., Petrova, S., Sweiss, R., Duong, J., Miulli, D. E.
Cureus, 2022/03
Free full text
1181

Eficacia del tratamiento osteopático en el estreñimiento crónico
(Effectiveness of osteopathic treatment for chronic constipation)
Cabello Romero, E.
European Journal Osteopathy & Related Clinical Research, 2022/03
Free full text
1182

Efectividad del tratamiento manipulativo osteopático en pacientes con Dismenorrea Primaria
(Effectiveness of osteopathic manipulative treatment in patients with primary dysmenorrhea)
Chiarelli, R.
European Journal Osteopathy & Related Clinical Research, 2022/03
Free full text
1183

Efectos de la osteopatía en pacientes con fibromialgia
(Effects of osteopathy on patients with fibromyalgia)
Hormigo Navarro, R.
European Journal Osteopathy & Related Clinical Research, 2022/03
Free full text
1184

Osteopathie bei Atopischer Dermatitis - eine randomisiert kontrollierte monozentrische explorative Studie
(Osteopathy in Atopic Dermatitis - a randomised controlled monocentric exploratory trial)
Ahnert, M. W.
Unpublished PhD thesis, 2022/03
Free full text
1185

Efectividad del tratamiento del cólico del lactante a través de técnicas osteopáticas
(Effectiveness of osteopathic techniques in treating infant colic)
Prada González, I.
European Journal Osteopathy & Related Clinical Research, 2022/03
Free full text
1186

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text
1187

The effectiveness of rehabilitation of patients after covid pneumonia with osteopathic methods
(Эффективность реабилитации пациентов после перенесенной ковид-пневмонии методами остеопатии)
Belyaev, A. F., Fotina, O. N., Kharkovskaya, T. S., Yurchenko, A. A.
Russian Osteopathic Journal, 2022/03
Free full text
1188

Long-term results of combined use of speech therapy and osteopathic correction in 5–6 year old children with dysarthria
(Отдаленные результаты совместного применения логопедической и остеопатической коррекции у детей 5–6 лет с дизартрией)
Bychkova, E. Y., Sandakov, A. V., Kuzmina, Y. O.
Russian Osteopathic Journal, 2022/03
Free full text
1189

Investigation of the osteopathic correction effectiveness in the treatment of pediatric patients with idiopathic scoliosis of the first degree
(Исследование эффективности остеопатической коррекции в лечении пациентов детского возраста с идиопатическим сколиозом I степени)
Kamaletdinov, V. L., Kamaletdinova, O. V., Safin, R. F.
Russian Osteopathic Journal, 2022/03
Free full text
1190

Instrumental methods and technical means for assessing the results of osteopathic correction in patients after lower limb amputation
(Инструментальные методы и технические средства для оценки результатов остеопатической коррекции у пациентов после ампутации нижних конечностей)
Kolyshnitsyn, N. Y., Mokhov, D. E.
Russian Osteopathic Journal, 2022/03
Free full text
1191

Study of the combined use of osteopathic correction and EEG-biofeedback training in children with attention deficit hyperactivity disorder
(Исследование сочетанного применения остеопатической коррекции и ЭЭГ-БОС-тренингов у детей с синдромом дефицита внимания и гиперактивности)
Kudryashova, V. G., Chetverikova, N. A.
Russian Osteopathic Journal, 2022/03
Free full text
1192

Effects of osteopathic techniques of balancing SEB and separating the front-ethmoid suture in children with narrow palate
(Эффекты остеопатических методов уравновешивания сфенобазилярного синхондроза и разделения переднерешетчатого шва у детей с узким нёбом)
Quesada, B. M.
Russian Osteopathic Journal, 2022/03
Free full text
1193

Possibility of using osteopathic methods of correction in the treatment of myofascial pain syndrome
(Возможность применения остеопатических методов коррекции в терапии миофасциального болевого синдрома)
Safiullina, A. A., Safiullina, G. I.
Russian Osteopathic Journal, 2022/03
Free full text
1194

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text
1195

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text
1196

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
1197

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03
1198

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text
1199

Patellofemoral pain syndrome: a review of the literature with osteopathic emphasis
Balint, T., Jones, J., Paquette, M., Amalfitano, J.
The AAO Journal, 2022/03
Free full text
1200

Osteopathic Approach to Treatment of Radial Head Dysfunction: The Radial Head Range of Motion Technique
Ellis, M. M., Lewis, D. D.
The AAO Journal, 2022/03
Free full text
1201

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text
1202

Efficacy and Feasibility of an Osteopathic Intervention for Neurocognitive and Behavioral Symptoms Usually Associated With Fetal Alcohol Spectrum Disorder
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., García-Algar, Ó.
Frontiers in Behavioral Neuroscience, 2022/03
Free full text
1203

Active learning in osteopathic education: Evaluation of think-pair-share in an undergraduate pathology unit
Wong, D.
International Journal of Osteopathic Medicine, 2022/03
1204

Results of osteopathic correction in children and adolescents with undifferentiated connective tissue dysplasia
(Результаты остеопатической коррекции у детей и подростков с недифференцированной дисплазией соединительной ткани)
Valiev, K. R., Vildanov, I. K., Zyatdinov, R. R., Gainullin, I. R.
Russian Osteopathic Journal, 2022/03
Free full text
1205

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
1206

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
1207

In bestimmter Weise auf jemanden wirken …
(To affect someone in a certain way...)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
1208

Nebennierendysfunktion als Schlüssel bei therapieresistentem Zervikalsyndrom: Ein Fallbericht
(Adrenal gland dysfunction as a key in therapy-resistant cervical syndrome: a case report.)
Ebner, M.
Osteopathische Medizin, 2022/03
1209

Vom Selbsterleben osteopathischer Praxis im Wirk-Bündnis der Tastwelt: Phänomenologisch-anthropologischer Bericht einer tastenden Praxis
(From the self-perception of osteopathic practice in the active alliance of the world of touch: Phenomenological-anthropological report of a practice of touching)
Kaiser, A. K.
Osteopathische Medizin, 2022/03
1210

Osteopathische Diagnostik und Behandlung funktioneller Gallenblasendyskinesien: Eine qualitative Interviewstudie
(Osteopathic diagnosis and treatment of functional gallbladder dyskinesia: A qualitative interview study)
Roth, P., Belz, S.
Osteopathische Medizin, 2022/03
1211

Die Einstellung von Medizinstudierenden zur Komplementärmedizin: Ergebnisse einer Querschnittsstudie
(The attitude of medical students towards complementary medicine: Results of a cross-sectional study)
Rotter, G., Jerzynski, L., Hinse, M., Binting, S., Brinkhaus, B.
Osteopathische Medizin, 2022/03
1212

Efeitos da abordagem osteopática em neonatos com dificuldade na biomecânica da amamentação: ensaio clínico randomizado
(Effects of the osteopathic approach in neonates with difficulties in the biomechanics of breastfeeding: a randomized clinical trial)
Barros, R. C. T., Vilagra, J. M., Taglietti, M., Tori, F.S., Cagnini, T. L., Camilo, J.M., Grando, F., Abico, R. M., Abico, S. T.
Research, Society and Development, 2022/03
Free full text
1213

Efficacy of muscle energy technique on forward head posture and cervical mobility in visually impaired children: A randomized controlled trial
Wagdy, E., Elserty, N., Zaghloul, H. M. S., Fayez, M. M.
Current Pediatric Research, 2022/02
Free full text
1214

Medical students' perceptions of understanding skills needed in treating cardiac patients through simulation-based encounters in a clinical skills curriculum
Mann, B. G., Obisesan, O.
Journal of Osteopathic Medicine, 2022/02
Free full text
1215

Osteopathische Medizin in vier chronischen muskuloskeletalen Schmerzerkrankungen: Eine Beobachtungsstudie mit Follow-up.
Osteopathic Medicine in Four Chronic Musculoskeletal Pain Diseases: An Observational Trial with Follow-Up
Rotter, G., Binting, S., Tissen-Diabaté, T., Ortiz, M., Brinkhaus, B.
Complementary Medicine Research, 2022/02
Free full text
1216

Sticky Floor, Broken Ladder, and Glass Ceiling in Academic Obstetrics and Gynecology in the United States and Canada
Kim, K. Y., Kearsley, E. L., Yang, H. Y., Walsh, J. P., Jain, M., Hopkins, L., Wazzan, A. B., Khosa, F.
Cureus, 2022/02
Free full text
1217

Inflammatory Biochemical Mediators and Their Role in Myofascial Pain and Osteopathic Manipulative Treatment: A Literature Review
Leicht, B. T., Kennedy, C., Richardson, C.
Cureus, 2022/02
Free full text
1218

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02
1219

Alimentación y osteopatía: el papel de la alimentación en el funcionamiento del sistema fascial. Revisión sistemática
(Diet and Osteopathy: The role of diet in the functioning of fascial system. Systematic Review)
Mora Mora, S. N.
Unpublished MSc thesis, 2022/02
Free full text
1220

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text
1221

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text
1222

Advances in the therapeutic approach of pudendal neuralgia: a systematic review
Murer, S., Polidori, G., Beaumont, F., Bogard, F., Polidori, E., Kinne, M.
Journal of Osteopathic Medicine, 2022/01
Free full text
1223

The rationale for including osteopathic manipulative treatment in the management of infections: a hermeneutic review
Lesho, E., McKeown, A., Laguio-Vila, M.
Expert Review of Anti-Infective Therapy, 2022/01
Free full text
1224

International Overview of Somatic Dysfunction Assessment and Treatment in Osteopathic Research: A Scoping Review
Tramontano, M., Tamburella, F., Farra, F., Bergna, A., Lunghi, C., Innocenti, M., Cavera, F., Savini, F., Manzo, V., D', Alessandro, G.
Healthcare, 2022/01
Free full text
1225

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text
1226

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text
1227

Effects of Adding Respiratory Training to Osteopathic Manipulative Treatment on Exhaled Nitric Oxide Level and Cardiopulmonary Function in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
The American Journal of Cardiology, 2022/01
1228

Inhibiting the Musculoskeletal Pathological Processes in Post-knee Replacement Surgery With Osteopathic Manipulative Treatment: A Systematic Review
Zhou, Y., Chin, J., Evangelista, A., Podger, B., Wan, P. J., Lomiguen, C. M.
Cureus, 2022/01
1229

Neurogenic Bowel Dysfunction Changes after Osteopathic Care in Individuals with Spinal Cord Injuries: A Preliminary Randomized Controlled Trial
Tamburella, F., Princi, A. A., Piermaria, J., Lorusso, M., Scivoletto, G., Masciullo, M., Cardilli, G., Argentieri, P., Tramontano, M.
Healthcare, 2022/01
Free full text
1230

The immediate effect of thoracolumbar manipulation and diaphragmatic release on inspiratory muscle strength in healthy smokers: A randomized clinical trial
Albarrati, A., Taher, M., Nazer, R., Alshameri, T.
Journal of Back and Musculoskeletal Rehabilitation, 2022/01
1231

Relationship between osteopathic manipulative treatment of the temporomandibular joint, molar shim and the orthostatic position: A randomized, controlled and double blinded study
Detoni, R., Heartz, C. S., Fusatto, E. L., Bicalho, E., Nacimento-Moraes, K. S. G., Rizzatti-Barbosa, C. M., Lopes, F. O. T.
Journal of Bodywork and Movement Therapies, 2022/01
Free full text
1232

Osteopathic treatment in addition to standard care in patients with Gastroesophageal Reflux Disease (GERD) – A pragmatic randomized controlled trial
Lynen, A., Schömitz, M., Vahle, M., Jäkel, A., Rütz, M., Schwerla, F.
Journal of Bodywork and Movement Therapies, 2022/01
1233

Cranial manipulation affects cholinergic pathway gene expression in aged rats
Anandakrishnan, R., Tobey, H., Nguyen, S., Sandoval, O., Klein, B. G., Costa, B. M.
Journal of Osteopathic Medicine, 2022/01
Free full text
1234

A novel movement system screen for primary care providers: a multisite, observational study
Kettle, C., McKay, L., Cianciolo, A. M., Kareha, S. M., Ruggeri, C. E.
Journal of Osteopathic Medicine, 2022/01
Free full text
1235

Lymphatic osteopathic manipulative treatment reduces duration of deltoid soreness after Pfizer/BioNTech COVID-19 vaccine
Marshall, S., Winter, S., Capobianco, J. D.
Journal of Osteopathic Medicine, 2022/01
Free full text
1236

Significant cognitive impairment likely associated with COVID-19 infection with relatively nonsevere symptoms
Reeves, R. R., Willoughby, S. G.
Journal of Osteopathic Medicine, 2022/01
Free full text
1237

Temporomandibulargelenk: Diskusverlagerung nach anterior
(Temporomandibular joint: disc displacement anteriorly)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
1238

Effects of visceral manipulation associated with pelvic floor muscles training in women with urinary incontinence: A randomized controlled trial
De Marco, M., Arbieto, E. R. M., Da Roza, T. H., Resende, A. P. M., Santos, G. M.
Neurourology and Urodynamics, 2022/01
Free full text
1239

Osteopathische Behandlungsaspekte bei COVID-19
(Aspects of osteopathic treatment for COVID-19)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
1240

The Effect of Pedal Pump Lymphatic Technique Versus Passive Recovery Following Maximal Exercise: A Randomized Cross-Over Trial
DiFrancisco-Donoghue, J., Chan, T., Jensen, A. S., Docherty, J. E. B., Grohman, R., Yao, S. C.
Sports Medicine - Open, 2022/01
Free full text
1241

Anxiety among Adults Undergoing Elective Lumbar Spine Surgery at University of California – San Diego Medical Center – La Jolla
Rusinov, V.
Unpublished Dissertation, 2022/01
Free full text
1242

Results of a feasibility randomised controlled trial of osteopathy on neck-shoulder pain in computer users
Santiago, R. J., Esteves, J. E., Baptista, J. S., Magalhães, A., Costa, J. T.
Complementary Therapies in Clinical Practice, 2022/01
Free full text
1243

A New Zealand osteopathic perspective on the choice of working in an integrated care environment alongside other regulated health care providers: A qualitative descriptive study
Cox, V.
Unpublished MSc thesis, 2022
Free full text
1244

O papel das citocinas no apoio à monitorização e diagnóstico das condições alvo ao tratamento osteopático: Revisão sistemática da literatura
(The role of cytokines in supporting the monitoring and diagnosis of conditions targeted for osteopathic treatment: A systematic review of the literature)
Coelho, D.
Unpublished thesis, 2022
Free full text
1245

Kognitive Fähigkeiten und Berufsrollen von Osteopath*innen nach A.T. Still: Teil 2: Die osteopathischen Berufsgruppen
Krause, K. C., Engel, M.
Osteopathische Medizin, 2021/12
1246

‘A Mindful ACT’- testing the feasibility and acceptability of a brief psychosocial intervention designed to accompany osteopathy treatment for people who live with persistent pain
Jäger, M., Terry, J., Rance, J.
International Journal of Osteopathic Medicine, 2021/12
1247

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text
1248

Letter to the Editor - Osteopathic manipulative techniques for management of Huntington's disease
Rohani, B., Newland, H., Agustines, D.
International Journal of Osteopathic Medicine, 2021/12
1249

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12
1250

Osteopathic Manipulation of the Sphenopalatine Ganglia Versus Sham Manipulation, in Obstructive Sleep Apnoea Syndrom: A Randomised Controlled Trial
Attali, V., Jacq, O., Martin, K., Arnulf, I., Similowski, T.
Journal of Clinical Medicine, 2021/12
Free full text
1251

The effectiveness of orthodontic and osteopathic correction in patients with dental anomalies and musculoskeletal dysfunction of the temporomandibular joint in the presence of concomitant somatic dysfunctions and without it
(Эффективность ортодонтической и остеопатической коррекции у пациентов с зубочелюстными аномалиями и мышечно-суставными дисфункциями височно-нижнечелюстного сустава при наличии сопутствующих соматических дисфункций и без них)
Basieva, E. V., Milutka, Y. A., Tarasov, N. A., Silin, A. V., Mokhov, D. E.
Russian Osteopathic Journal, 2021/12
1252

Combined use of osteopathic correction and transcranial micropolarization of the brain in the treatment of children with attention deficit hyperactivity disorder
(Сочетанное применение остеопатической коррекции и транскраниальной микрополяризации головного мозга в лечении детей с синдромом дефицита внимания и гиперактивностью)
Belash, V. O., Bayer, D. V., Kostousov, V. V.
Russian Osteopathic Journal, 2021/12
1253

The effect of osteopathic correction on the function of external respiration in patients after COVID-19 coronavirus pneumonia
(Влияние остеопатической коррекции на функцию внешнего дыхания у пациентов, перенесших коронавирусную пневмонию COVID -19)
Belyaev, A. F., Kharkovskaya, T. S., Fotina, O. N., Yurchenko, A. A.
Russian Osteopathic Journal, 2021/12
1254

Investigation of the possible effectiveness of osteopathic correction in the complex treatment of children in the first year of life with hip dysplasia
(Исследование возможной эффективности остеопатической коррекции в составе комплексного лечения детей первого года жизни с дисплазией тазобедренных суставов)
Fabristova, N. A., Gainullin, I. R.
Russian Osteopathic Journal, 2021/12
1255

Possibilities of osteopathic methods of diagnosis and correction in gallbladder dyskinesia
(Возможности применения остеопатических методов диагностики и коррекции при дискинезии желчного пузыря)
Panaseiko, Y. N.
Russian Osteopathic Journal, 2021/12
1256

Immediate alteration of the lumbar intervertebral foramen during the so-called osteopathic locking technique: A preliminary analysis on healthy subjects
Dugailly, P.M., Dethier, C., Salem, W.
International Journal of Osteopathic Medicine, 2021/12
1257

Epidemiology, common diagnoses, treatments and prognosis of shoulder pain: A narrative review
Hodgetts, C., Walker, B.
International Journal of Osteopathic Medicine, 2021/12
1258

Effects of Visceral Manipulation Treatment on Women with Infertility and Adults with Low Back Pain
Parker, A.
Unpublished Dissertation, 2021/12
1259

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: Protocol for systematic review and meta-analysis
Rehman, Y., Kirsch, J., Bhatia, S., Johnston, R., Bingham, J., Senger, B., Swogger, S., Snider, K. T.
International Journal of Osteopathic Medicine, 2021/12
1260

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) Residency Curriculum Guidelines to meet ACGME Milestones
Balyakina, E., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2021/12
1261

OMM alters chronic ethanolinduced changes to VTA GABA neurons, NAc DA release and measures of withdrawal in rats
Bills, K., Small, C., Otteson, D., Jones, G., Steffensen, S.
Journal of Osteopathic Medicine, 2021/12
1262

Therapeutic Effects of Lymphatic Pump Treatment on Lymphangiogenesis and Inflammatory Cytokines in Lymph Nodes of Rats with Adjuvant-Induced Arthritis
Blucher, K. M., Jain, S., Weber, D., Gober, C., Zanotti, B., Incrocci, R., Del Toro, R., Swanson-Mungerson, M., Volin, V. V.
Journal of Osteopathic Medicine, 2021/12
1263

Serum osteocalcin in the osteopathic treatment for motor function in Parkinson’s Disease
Gupta, S., Lamba, S., Yao, S. C., Mancini, J.
Journal of Osteopathic Medicine, 2021/12
1264

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12
1265

Understanding medical student perspectives in virtual osteopathic manipulative medicine education during the COVID pandemic
Liu, T., Torrents, M., Sharma, S., Burke, D., Giovanis, A.
Journal of Osteopathic Medicine, 2021/12
1266

Assessing usage and perceptions of osteopathic manipulative treatment (OMT) and self-identity among osteopathic physicians
Mangla, M., Asif, S., Asif, S., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12
1267

A Pilot Study to Examine Medical Students’ Perception of their Osteopathic Manipulative Therapy Education
Mazzi, J., Leavitt, N., Kisby, G.
Journal of Osteopathic Medicine, 2021/12
1268

Patient Perception of Clinical Trials With and Without Osteopathic Manipulative Treatment During the COVID-19 Pandemic
Nikakis, J., Singh Arora, U., Wang, L., Abramowitz, C., Malkov, D., Cohen, T. J.
Journal of Osteopathic Medicine, 2021/12
1269

Decreasing Headache Pain Secondary to a Subarachnoid Hemorrhage with the use of Osteopathic Manipulative Medicine
Barnes, P. L, Haas, H., Beck, B.
The AAO Journal, 2021/12
Free full text
1270

Correction: Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/12
Free full text
1271

An Osteopathic Approach to Complex Regional Pain Syndrome (CRPS)
Deol, N., Nuño, V., Schuman, M., Contreras, C.
The AAO Journal, 2021/12
Free full text
1272

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text
1273

A comparative study of the effectiveness of an osteopathic primary care sports medicine led intervention on performance in men's collegiate lacrosse players
Rao, N. C., Zwibel, H., Berezanskaya, J., Pena, P., Jung, M. K.
Journal of Osteopathic Medicine, 2021/11
Free full text
1274

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text
1275

Effect of joint manipulation and muscle energy technique in patients with Chronic Obstructive Pulmonary Disease: A review
Bains, D., Goyal, M., Chahal, A., Shaphe, M. A.
Annals of Clinical and Analytical Medicine, 2021/11
Free full text
1276

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11
1277

Fast improvements in functional status after osteopathic manipulative treatment based on myofascial release in patients with moderate or severe fibromyalgia: a retrospective study
Farra, F., Chiesa, A., Risio, R. G., Vismara, L., Bergna, A.
Journal of Complementary and Integrative Medicine, 2021/11
Free full text
1278

Effect of osteopathic manipulation on gait asymmetry
Hill, C. N., Romero, M., Rogers, M., Queen, R. M., Brolinson, P. G.
Journal of Osteopathic Medicine, 2021/11
Free full text
1279

Der Einfluss der Osteopathie auf den Schmerz und die Beweglichkeit nach einer Rotatorenmanschettenrekonstruktion
(The influence of osteopathy on pain and mobility after rotator cuff reconstruction)
Schrempf, I.
Unpublished MSc thesis, 2021/11
1280

Die Auswirkungen einer allgemein osteopathischen Behandlung bei Patientinnen/Patienten mit rheumatoider Arthritis
(The effects of general osteopathic treatment on patients with rheumatoid arthritis)
Sommeregger, B. M.
Unpublished MSc thesis, 2021/11
1281

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11
1282

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11
1283

Les bienfaits de l’ostéopathie sur la constipation
(The benefits of osteopathy on constipation)
Pitel, C., Rojot, A.
Pratiques en Nutrition, 2021/11
1284

Response to Alvarez et al
Coste, J., Medkour, T., Maigne, J. Y., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/11
Free full text
1285

The ACAMTO study—impact of add-on osteopathic treatment on adolescent patients with anorexia nervosa: study protocol for a randomized controlled trial
Letranchant, A., Montebello, Y., Dugré-Le bigre, C., Wagner, A., Curt, F., Silva, J., Nicolas, I., Votadoro, P., Kalindjian, N., Korchonnoff, A., Gutierre, A., Novelli, Ana B., Pham-Scottez, A., Corcos, M.
Trials, 2021/11
Free full text
1286

Wirksamkeit osteopathischer Behandlungen von Craniomandibulärer Dysfunktion bei Tinnitus Systematsiches Review
(Efficacy of osteopathic treatments for craniomandibular dysfunction in tinnitus. A Systematic Review)
Pollak, E.
Unpublished MSc thesis, 2021/11
1287

Der Einfluss von osteopathischen Behandlungen auf die Beschwerdesymptomatik bei Patienten mit CPPS als Ergänzung zur konventionellen Therapie
(The influence of osteopathic treatments on symptomatology in patients with CPPS as an addition to conventional therapy)
Nezaj, B.
Unpublished MSc thesis, 2021/11
1288

Osteopathie bei chronischen Beckenschmerzen
(Osteopathic treatment in patients with chronic pelvic pain)
Koza, M.
Unpublished MSc thesis, 2021/11
1289

Effektivität osteopathischer Behandlungen der Osteitis pubis bei männlichen Amateurfußballspielern im Vergleich zum Goldstandard
(Effectiveness of osteopathic treatments of osteitis pubis in male amateur soccer players in comparison to the gold standard)
Klima, C
Unpublished MSc thesis, 2021/11
1290

Effekt sakraler Mobilisationen auf die Herzratenvariabilität bei Patienten mit einem milden bis hohen Stressempfinden. Eine randomisierte, kontrollierte Einzelblindstudie
(Effect of sacrum mobilizations on the heart rate variability in patients with a moderate to high perceived stress score. A single blind randomized controlled study)
Chaumont, Y.
Unpublished MSc thesis, 2021/11
1291

Effectiveness of myofascial release on pain, sleep, and quality of life in patients with fibromyalgia syndrome: A systematic review
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P.
Complementary Therapies in Clinical Practice, 2021/11
1292

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text
1293

Association Between the Modalities of Complementary and Alternative Medicine Use and Cost-Related Nonadherence to Medical Care Among Older Americans: A Cohort Study
Zhang, J. X., Meltzer, D. O.
The Journal of Alternative and Complementary Medicine, 2021/10
1294

Most common infant health concerns in osteopathic practices in Germany. A survey
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2021/10
1295

Spinal Manipulative Therapy for Acute Neck Pain: A Systematic Review and Meta-Analysis of Randomised Controlled Trials
Chaibi, A., Stavem, K., Russell, M. B.
Journal of Clinical Medicine, 2021/10
Free full text
1296

Osteopathy as a method of correction and prevention of the formation of somatic dysfunctions of the musculoskeletal system in office workers
(Остеопатия как метод коррекции и профилактики формирования соматических дисфункций опорно-двигательного аппарата у офисных работников)
Aptekar, I. A., Abramova, E. V.
Russian Osteopathic Journal, 2021/10
Free full text
1297

Evaluation of the clinical effectiveness of the osteopathic correction in children with chronic bronchitis in a sanatorium
(Оценка клинической эффективности остеопатической коррекции у детей с хроническим бронхитом в условиях санатория)
Belash, V. O., Khaibullina, G. A.
Russian Osteopathic Journal, 2021/10
Free full text
1298

Experience in the use of kinesio taping for the relief of algomenorrhea in adolescent girls in a children′s rehabilitation hospital
(Опыт применения кинезиотейпирования для купирования альгоменореи у девочек-подростков в условиях детского реабилитационного стационара)
Vasilevich, S. V., Petrov, S. S.
Russian Osteopathic Journal, 2021/10
Free full text
1299

Study of the effectiveness of osteopathic correction in the complex treatment of patients with operated primary open-angle glaucoma
(Исследование эффективности остеопатической коррекции в комплексном лечении больных с прооперированной первичной открытоугольной глаукомой)
Zubkov, O. V., Smirnova, E. A., Kramar, V. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2021/10
Free full text
1300

Effects of osteopathic approach in infants with deformational plagiocephaly: an outcome research study
Gasperini, M., Vanacore, N., Massimi, L., Consolo, S., Haass, C., Scapillati, M. E., Petracca, M.
Minerva Pediatrics, 2021/10
1301

Stimulating the Use of OMT in Primary Care Offices Via Point-of-Care Reminders
Agcopra, A., Collins, P., Jha, S., Mancuso, A.
Osteopathic Family Physician, 2021/10
1302

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10
1303

Wirksamkeit der Osteopathie bei Depressionen als Begleitsymptom chronischer Erkrankungen: Systematic Review
(The Effect of Osteopathy on Comorbid Depression in Chronic Disease: Systematic Review)
Zajicek, M.
Unpublished MSc thesis, 2021/10
Free full text
1304

Osteopathy in Germany: attitudes, beliefs and handling among general practitioners - results of a nationwide cross-sectional questionnaire survey
Schmid, G. L., Kluge, J., Deutsch, T., Geier, A. K., Bleckwenn, M., Unverzagt, S., Frese, T.
BMC Family Practice, 2021/10
Free full text
1305

Osteopathic Treatment and Evaluation in the Clinical Setting of Childhood Hematological Malignancies
Barbieri, M., Zardo, W., Frittoli, C., Rivolta, C., Valdata, V., Bouquin, F., Passignani, G., Maggiani, A., Jankovic, M., Cossio, A., Biondi, A., Balduzzi, A., Lanfranconi, F.
Cancers, 2021/10
Free full text
1306

Osteopathic Treatment of Infants in Their First Year of Life: A Prospective Multicenter Observational Study (OSTINF Study)
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Complementary Medicine Research, 2021/10
Free full text
1307

Geist-Körper-Interdependenz in der osteopathischen Behandlung
(Mind-body interdependence in osteopathic treatment)
Liem, T., Van Den Heede, P.
Osteopathische Medizin, 2021/09
1308

Osteopathische Überlegungen zur Begleitung der Therapie des Mammakarzinoms
(Osteopathic considerations to support the therapy of breast carcinoma)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
1309

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
1310

Behandlung bei posttraumatischer Belastungsstörung
(Treatment for post-traumatic stress disorder)
Treu, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
1311

General Osteopathic Treatment (GOT) – ein Überblick
(General Osteopathic Treatment (GOT) - an overview)
Schiller, B.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
1312

Efficacy of osteopathic manipulative treatment in patients with Parkinson's disease: a narrative review
Li, R., Jose, A., Poon, J., Zou, C., Istafanos, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/09
Free full text
1313

Exploring the Utility of Motion Analysis in Osteopathic Clinical Trials; a School-Based Pilot Study on Jaw and Cervical Range of Motion
Bagory, T., Vaucher, P., Mhadhbi, H., Ménard, M.
International Journal of Osteopathic Medicine, 2021/09
1314

Effects of myofascial release applied to neck muscles and craniocervical flexor training in patients with chronic myofascial TMD: A single arm study
Calixtre, L. B., Rezende, M. A., Kamonseki, D. H., Beatriz de Oliveira, A.
International Journal of Osteopathic Medicine, 2021/09
1315

Osteopaths’ Perspectives on Patient Adherence to Self-Management Strategies: A Qualitative Content Analysis
Tripodi, N., Krajina, T., Lea, N., Giudice, H., Eskaf, S., Ojea, M., D&rsquo, Souza, T., McLeod, G., Feehan, J.
International Journal of Osteopathic Medicine, 2021/09
1316

Osteopathic Cranial Manipulation for a Patient With Whiplash-Associated Disorder: A Case Report
Parravicini, G., Ghiringhelli, M.
Journal of Chiropractic Medicine, 2021/09
1317

Pain and symptom management in a case of cervical dystonia with comorbid generalized joint hypermobility using prolotherapy with osteopathic manipulative medicine
Mancini, J., Whitfield, D.
Movement Disorders, 2021/09
1318

Gait Analysis in Anterior Cruciate Ligament Reconstruction & Controls Across Different Levels of Visual Feedback
Bennison, J. C.
Unpublished MSc thesis, 2021/09
Free full text
1319

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09
1320

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09
1321

Kognitive Fähigkeiten und Berufsrollen von Osteopath*innen nach A.T. Still: Teil 1: Philosophisch-ethischer Hintergrund
(Cognitive skills and professional roles of osteopaths according to A.T. Still - Part 1: Philosophical-ethical background)
Engel, M., Krause, K. C.
Osteopathische Medizin, 2021/09
1322

Nebenwirkungen nach einer osteopathischen Behandlung. Eine quantitative Fragebogenstudie
(Adverse Events After Osteopathic Treatment. A Quantitative Questionnaire Study)
Kloibhofer, M.
Unpublished MSc thesis, 2021/09
1323

Effects of Osteopathic Manipulation and Other Manual Manipulative Treatments on Cystic Fibrosis
Ball, K. T., Kraft, D. E., Snider, K. T.
The AAO Journal, 2021/09
Free full text
1324

Single Osteopathic Manipulative Treatment Session Eliminates Percutaneous Coronary Intervention-Induced Upper Thoracic Pain in Elderly Male
Hoffman, P., Belogorodsky, D., Noto-Bell, L.
The AAO Journal, 2021/09
Free full text
1325

Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/09
Free full text
1326

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study
Miranda, E., Giza, J., Feketeova, E., Castro-Nunez, C., Vieux, U., Huynh, M.D.
The AAO Journal, 2021/09
Free full text
1327

Wertesysteme in der osteopathischen Palpation – Gespräche mit OsteopathInnen über subjektive Wertesysteme in der osteopathischen Befundung und Behandlung
(Value systems in osteopathic palpation – Interviews with osteopaths about subjective value systems in osteopathic diagnosis and treatment)
Müller, F.
Unpublished MSc thesis, 2021/09
Free full text
1328

Wie stellt sich die Gesundheitsstörung der idiopathischen Asymmetrie und lagebedingten Plagiozephalie bei Säuglingen im ersten Lebensjahr in Bezug auf die Therapie dar? Eine systematische Literaturrecherche
(How does the health disorder of idiopathic asymmetry and posi-tional plagiocephaly in infants in the first year of life relate to therapy? A systematic literature review)
Daake, B.
Unpublished MSc thesis, 2021/09
1329

A Systematic Review of Musculoskeletal Mobilization and Manipulation Techniques Used in Veterinary Medicine
Haussler, K. K., Hesbach, A. L., Romano, L., Goff, L., Bergh, A.
Animals, 2021/09
Free full text
1330

(Osteopoathic medical treatment of pediatric patient)
Angersbach, N.
Unpublished MSc thesis, 2021/09
1331

Osteopatia na atenção primária à saúde: resultados parciais de uma experiência de educação permanente e alguns efeitos iniciais.
Osteopathy in primary health care: partial results of continuing education experience and some initial outcomes
Schneider, L. M., Tesser, C. D.
Ciencia & Saude Coletiva, 2021/09
Free full text
1332

Erratum: Vertigo and balance disorders - The role of osteopathic manipulative treatment: A systematic review (Complementary Medicine Research (2020) DOI: 10.1159/000512673)
Tramontano, M., Consorti, F., Morone, G., Lunghi, C.
Complementary Medicine Research, 2021/08/01
1333

Osteopathic Manipulative Treatment for Chronic Low Back Pain
Licciardone, J. C.
JAMA Internal Medicine, 2021/08
1334

Osteopathic Manipulative Treatment for Chronic Low Back Pain—Reply
Nguyen, C., Zegarra-Parodi, R., Boutron, I.
JAMA Internal Medicine, 2021/08
1335

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08
1336

Osteopathic interventions via telehealth in a pediatric population: a retrospective case series
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2021/08
Free full text
1337

Patient-centered care or osteopathic manipulative treatment as mediators of clinical outcomes in patients with chronic low back pain
Licciardone, J. C., Aryal, S.
Journal of Osteopathic Medicine, 2021/08
Free full text
1338

Vertigo and Balance Disorders-The Role of Osteopathic Manipulative Treatment: A Systematic Review
Tramontano, Marco, Consorti, Giacomo, Morone, Giovanni, Lunghi, Christian
Complementary Medicine Research, 2021/08
1339

The Lymphatic System: An Osteopathic Review
Hruby, R. J., Martinez, E. S.
Cureus, 2021/07
Free full text
1340

Osteopathie bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom
(Osteopathy for chronic prostatitis/chronic pelvic pain syndrome)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
1341

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
1342

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07
1343

Modulation of vestibulo-ocular reflex gain-symmetry induced by osteopathic manipulations on the fascial system in young healthy subjects: A three-arm randomized controlled trial
Romagnoli, M., Ntino, A. T., Galli, M., Origo, D.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2021/07
1344

Effects of myofascial release or self-myofascial release and control position exercises on lower back pain in idiopathic scoliosis: A systematic review
López-Torres, O., Mon-López, D., Gomis-Marzá, C., Lorenzo, J., Guadalupe-Grau, A.
Journal of Bodywork and Movement Therapies, 2021/07
1345

Secondary dysmenorrhea and dyspareunia associated with pelvic girdle dysfunction: A case report and review of literature
Origo, D., Piloni, S., Tarantino, A. G.
Journal of Bodywork and Movement Therapies, 2021/07
1346

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text
1347

Estimation of the efficiency of treatment of somatic dysfunctions of the pelvis bones using the technology of computer stabilography with biological feedback
(Оценка эффективности лечения соматических дисфункций костей таза с применением компьютерной стабилографии с биологической обратной связью)
Andreev, V. V., Sychev, A. I.
Russian Osteopathic Journal, 2021/07
Free full text
1348

Possibility of osteopathic correction in the complex therapy of patients with Parkinson′s disease
(Возможность применения остеопатической коррекции в комплексной терапии пациентов с болезнью Паркинсона)
Belash, V. O., Batenina, A. M., Machulina, A. I.
Russian Osteopathic Journal, 2021/07
Free full text
1349

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text
1350

Assessment of the quality of life of respondents working on a rotational basis in the Far North (on the example of the Khanty-Mansiysk Autonomous Okrug — Ugra
(Оценка качества жизни респондентов, работающих вахтовым методом в условиях Крайнего Севера (на примере Ханты-Мансийского автономного округа — Югра)
Ivanova, E. G., Makarova, E. V.
Russian Osteopathic Journal, 2021/07
Free full text
1351

Knowledge of osteopathic manipulative medicine and osteopathic physicians in a New York South Asian community
Lee, J., Maung, C., Espares, J., Chen, J., Yip, F., Lin, W., Zhao, L., Li, T. S.
Journal of Osteopathic Medicine, 2021/07
Free full text
1352

Possibility of osteopathic correction inclusion in the complex treatment of anal incontinence in teenagers
(Возможность включения остеопатической коррекции в комплексное лечение недостаточности анального сфинктера у подростков)
Kovalchuk, T. S., Enaleev, R. R., Kuzmina, Y. O.
Russian Osteopathic Journal, 2021/07
Free full text
1353

Simulation technologies in the modern paradigm of medical education: from general principles to use in teaching osteopathy
(Симуляционные технологии в современной парадигме медицинского образования: от общих принципов к использованию в преподавании остеопатии)
Makhonin, D. A., Lopatin, Z. V., Tregubova, E. S.
Russian Osteopathic Journal, 2021/07
Free full text
1354

Effectiveness of osteopathic care in the treatment of infant positional posterior plagiocephaly
(Эффективность остеопатического подхода в лечении задней плагиоцефалии позиционного происхождения у грудного ребенка)
Marangelli, G., Adouard, J., Josse, B., Ducourneau, J., Chastagner, A.S., Messien, C.
Russian Osteopathic Journal, 2021/07
Free full text
1355

Study of the peculiarities of the osteopathic status in patients with planovalgus deformity of the feet in combination with a history of placement torticollis and without such a combination
(Исследование особенностей остеопатического статуса у пациентов с плосковальгусной деформацией стоп в сочетании с установочной кривошеей в анамнезе и без такого сочетания)
Mukhammadieva, Y. R., Alshina, A. N., Gainetdinov, I. I., Safin, R. F.
Russian Osteopathic Journal, 2021/07
Free full text
1356

Possibility of using of osteopathic methods of correction in the therapy of symphysiopathy in pregnant women
(Возможность применения остеопатических методов коррекции в терапии симфизиопатии у беременных)
Nenashkina, E. N., Belash, V. O.
Russian Osteopathic Journal, 2021/07
Free full text
1357

Validity of retrospective patient reported assessment of pre-surgical hip pain and disability following hip arthroscopy
Wain, M. J. T.
Unpublished MSc thesis, 2021/07
Free full text
1358

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07
1359

The efficacy of complementary and alternative medicine methods for chronic epilepsy in pediatric patients: A prisma systematic review and meta-analysis
Johnson, B.
Unpublished MSc thesis, 2021/07
Free full text
1360

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text
1361

Osteopathic empirical research: a bibliometric analysis from 1966 to 2018
Morin, C., Gaboury, I.
BMC Complementary Medicine and Therapies, 2021/07
Free full text
1362

Perceptions and experiences of a manual therapy trial: a qualitative study of people with moderate to severe COPD
Baxter, D. A., Shergis, J. L., Hill, C. J., Worsnop, C., Coyle, M. E.
Chiropractic & Manual Therapies, 2021/07
Free full text
1363

Conceptions de la santé et de la pratique des manipulations vertébrales d’étudiants en ostéopathie au cours de leur formation
(Conceptions of health and spinal manipulation practice of osteopathic students during their training)
Javerliat, P.
Unpublished PhD thesis, 2021/06
Free full text
1364

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06
1365

Non-surgical management and return to play of an anterior cruciate ligament rupture: A case report
Bibby, L., Tripodi, N.
International Journal of Osteopathic Medicine, 2021/06
1366

Туннельная невропатия локтевого нерва: влияние остеопатической коррекции на снижение болевого синдрома
(Cubital tunnel neuropathy: Impact of osteopathic manipulative treatment on pain syndrome relief)
Belyaev, A. F., Belomestnov, P. V.
Russian Journal of Pain, 2021/06
Free full text
1367

Establishing osteopathic assessments to fulfill osteopathic recognition standards: a model for dermatology and other subspecialties
Mahlberg, S. J., Liou, Y. L., Lloyd, J.
Journal of Osteopathic Medicine, 2021/06
Free full text
1368

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 2: Diagnostik und Therapie
(Positional plagiocephaly and its osteopathic intervention. Part 2: Diagnostics and therapy)
Engel, M.
Osteopathische Medizin, 2021/06
1369

Spinale Chiropraktische Manipulation (spinale HVLAM): Ein integrativer osteopathischer Ansatz
Spinal chiropractic manipulation (spinal HVLAM): An integrative osteopathic approach
Muntinga, E.
Osteopathische Medizin, 2021/06
1370

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06
1371

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text
1372

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text
1373

Crochet the Pain Away: A Case Study of Osteopathic Manipulation for Cervical Rib Induced Thoracic Outlet Syndrome
Herring, J. A., Soto, G. N., Silver, S.
The AAO Journal, 2021/06
Free full text
1374

Integrating Osteopathic Evaluation and Treatment in a Case of Opioid-Induced Hyperalgesia
Rosendahl, N. O.
The AAO Journal, 2021/06
Free full text
1375

Craniosacral Therapy Use in Normal Pressure Hydrocephalus
Park, Y., Kabariti, J., Tafler, L.
Cureus, 2021/05
Free full text
1376

Osteopathic Manipulative Treatment of Herpes Zoster Ophthalmicus/Postherpetic Neuralgia
Volokitin, M., Izadi, N., Myers, R., Kane Diaw, N., Milani, S.
Cureus, 2021/05
Free full text
1377

The importance of epistemological consideration in the reporting of evidence for osteopathic care in Covid-19 papers
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/05
Free full text
1378

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05
1379

Effect of Osteopathic Manipulative Treatment vs Sham Treatment on Activity Limitations in Patients With Nonspecific Subacute and Chronic Low Back Pain: A Randomized Clinical Trial
Nguyen, C., Boutron, I., Zegarra-Parodi, R., Baron, G., Alami, S., Sanchez, K., Daste, C., Boisson, M., Fabre, L., Krief, P., Krief, G., Lefèvre-Colau, M.M., Rannou, F.
JAMA Internal Medicine, 2021/05
1380

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
1381

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
1382

The usage of multidisciplinary physical therapies at the Rio de Janeiro 2016 Olympic Summer Games: an observational study
Grant, M. E., Steffen, K., Palmer, D.
Brazilian Journal of Physical Therapy, 2021/05
Free full text
1383

Gnathological and osteopathic treatments with digital evaluations before and after therapies: a case report of a patient with ehlers-danlos syndrome
Di Giacomo, P., Cerignoli, E., D'Ermes, V., Ferrato, G., Polimeni, A., Di Paolo, C.
La Clinica Terapeutica, 2021/05
Free full text
1384

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05
1385

Obstructed defecation syndrome associated with paradoxical puborectalis contraction: osteopathic treatment versus anal biofeedback. Results of a pilot study
Ascanelli, S., Portinari, M., Canella, M., Solari, S., Dall&rsquo, Omo, F., Danese, S., De Troia, A., Carcoforo, P.
Techniques in Coloproctology, 2021/05
1386

Effects of Osteopathic Manipulative Treatment on Parkinsonian Gait: A Statistical Parametric Mapping Analysis
Terrell, Z. T.
Unpublished MSc thesis, 2021/05
1387

Beeinflussung abdominaler Adhäsionen durch osteopathische oder manuelle Techniken
(Influencing abdominal adhesions through osteopathic or manual techniques: A systematic review)
Kreuzer, M.
Unpublished MSc thesis, 2021/05
Free full text
1388

Direct and mediated effects of treatment context on low back pain outcome: a prospective cohort study
Bishop, F., Al-Abbadey, M., Roberts, L., MacPherson, H., Stuart, B., Carnes, D., Fawkes, C., Yardley, L., Bradbury, K.
BMJ Open, 2021/05
Free full text
1389

The use of osteopathic manipulative treatment in the newborn nursery and its effect on health in the first six months of life: A retrospective observational case-control study
Mills, M. V.
Complementary Therapies in Clinical Practice, 2021/05
Free full text
1390

Evaluation du rôle de l'ostéopathie dans la prévention et la prise en charge de la sarcopénie chez les personnes de plus de 65 ans
(Evaluation of the role of osteopathy in the prevention and management of sarcopenia in people over 65 years of age)
Gonthier, M., Jordan, L.
Unpublished MSc thesis, 2021/04
Free full text
1391

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text
1392

Die Phänomenologie als wissenschaftliche Grundlage der Osteopathie
(Phenomenology as the scientific basis of osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/04
1393

Evidence-based assessment of potential therapeutic effects of adjunct osteopathic medicine for multidisciplinary care of acute and convalescent COVID-19 patients
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/04
Free full text
1394

Effects of Osteopathic T9-T10 Vertebral Manipulation in Tonsillitis: A Randomized Clinical Trial
Luceño-Mardones, A., Luceño-Rodríguez, I., Rodríguez-López, E. S., Oliva-Pascual-Vaca, J., Rosety, I., Oliva-Pascual-Vaca, Á
Healthcare, 2021/04
Free full text
1395

Osteopathic manual therapy in heart failure patients: A randomized clinical trial
Thomaz, S. R., Teixeira, F. A., de Lima, Acgb, Cipriano Junior, G., Formiga, M. F., Cahalin, L. P.
Journal of Bodywork and Movement Therapies, 2021/04
1396

Assessment of Studies Evaluating Spinal Manipulative Therapy and Infectious Disease and Immune System Outcomes: A Systematic Review
Chow, N., Hogg-Johnson, S., Mior, S., Cancelliere, C., Injeyan, S., Teodorczyk-Injeyan, J., Cassidy, J. D., Taylor-Vaisey, A., Cote, P.
JAMA Network Open, 2021/04
Free full text
1397

The effect of dry needling & muscle energy technique separately and in combination in patients suffering shoulder impingement syndrome and active trigger points of infraspinatus
Jalilipanah, P., Okhovatian, F., Serri, R. A., Bagban, A. A., Zamani, S.
Journal of Bodywork and Movement Therapies, 2021/04
1398

Telemanagement of Home-Isolated COVID-19 Patients Using Oxygen Therapy With Noninvasive Positive Pressure Ventilation and Physical Therapy Techniques: Randomized Clinical Trial
Adly, A. S., Adly, M. S., Adly, A. S.
Journal of Medical Internet Research, 2021/04
Free full text
1399

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
1400

Direct measurement of the rhythmic motions of the human head identifies a third rhythm
Rasmussen, T. R., Meulengracht, K. C.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text
1401

Evaluation of dynamic MRI data in patients with herniated intervertebral discs after the complex treatment including osteopathic correction
(Оценка данных динамического МРТ-обследования пациентов с грыжами межпозвонковых дисков на фоне комплексного лечения, включавшего остеопатическую коррекцию)
Adrianova, S. M., Akhmetov, B. H.
Russian Osteopathic Journal, 2021/04
Free full text
1402

Osteopathic manipulative medicine in the management of headaches associated with postconcussion syndrome
Esterov, D., Thomas, A., Weiss, K.
Journal of Osteopathic Medicine, 2021/04
Free full text
1403

Possibilities of osteopathic correction methods using in the treatment of dorsopathy at the cervicothoracic level
(Возможности применения остеопатических методов коррекции в терапии дорсопатии на шейно-грудном уровне)
Belash, V. O., Nenashkina, E. N.
Russian Osteopathic Journal, 2021/04
Free full text
1404

Perceptions of nonopioid treatment for pain in a homeless population
Fraser, K. A., Nguyen, H., Kim, S., Park, F., Bernal, J., Westberg, A. D., Podawiltz, A.
Journal of Osteopathic Medicine, 2021/04
Free full text
1405

Possibilities of correction of the statodynamic stereotype violations in patients with dorsopathy at the cervical-thoracic level
(Возможности коррекции нарушения статодинамического стереотипа у пациентов с дорсопатией на шейно-грудном уровне)
Belash, V. O., Vorobyova, A. E., Vasyukovich, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
1406

Results of the inclusion of osteopathic correction in the complex therapy of patients with chronic gastritis
(Результаты включения остеопатической коррекции в состав комплексной терапии пациентов с хроническим гастритом)
Fazlyakhmetov, R. T., Safiullin, R. R., Ustinov, A. V.
Russian Osteopathic Journal, 2021/04
Free full text
1407

Effects of the release technique by pressing on the latent myofascial trigger point of the upper trapezius muscle: random controlled clinical trial
(Эффект техники освобождения при помощи давления на латентную миофасциальную триггерную точку в верхней части трапециевидной мышцы: рандомизированное контролируемое клиническое исследование)
Ferreira Faria, M. A., Bautista Aguirre, F.
Russian Osteopathic Journal, 2021/04
Free full text
1408

The effectiveness of the osteopathic correction in the complex treatment of adult patients with gastroesophageal reflux disease
(Эффективность остеопатической коррекции в комплексном лечении взрослых пациентов с гастроэзофагеальной рефлюксной болезнью)
Naletova, T. P., Udintsev, E. P., Oreshko, A. Y., Chusovitina, O. A.
Russian Osteopathic Journal, 2021/04
Free full text
1409

Dynamic carpal tunnel syndrome: pathophysiology, features of osteopathic diagnosis and treatment
(Динамический туннельный синдром запястного канала: патофизиология, особенности остеопатической диагностики и лечения)
Stefanidi, A. V., Balabanova, N. V.
Russian Osteopathic Journal, 2021/04
Free full text
1410

Results of osteopathic correction of myopia and accommodation spasm in children: systematic review using meta-analysis
(Результаты остеопатической коррекции при миопии и спазме аккомодации у детей: систематический обзор с применением метаанализа)
Vedyashkina, A. S., Milutka, Y. A., Lomakina, Y. N., Potekhina, Y. P.
Russian Osteopathic Journal, 2021/04
Free full text
1411

Substantiation of the possibility of osteopathic correction inclusion in the measures complex for the preoperative preparation of patients planned for extended abdominal surgery
(Обоснование возможности включения остеопатической коррекции в комплекс мер по предоперационной подготовке пациентов, планируемых на расширенные абдоминальные операции)
Volkov, P. A., Litvinov, N. I., Bolotov, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
1412

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text
1413

The Effects of Osteopathic Manipulation Techniques on the Lymphatic System
Parker, M.
Unpublished MSc thesis, 2021/04
1414

A Closer Look into the Association between the Sacroiliac Joint and Low Back Pain
Wieczorek, A., Campau, E., Pionk, E., Gabriel-Champine, M. E., Rios-Bedoya, C. F.
Spartan Medical Research Journal, 2021/04
Free full text
1415

Osteopathic medicine for fibromyalgia: a sham-controlled randomized clinical trial
Coste, J., Medkour, T., Maigne, J., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/04
Free full text
1416

Effektivität der Osteopathie im zentralnervösen/-neurologischen Bereich, Eine systematische Übersichtsarbeit
(Effectiveness of osteopathic manual treatments in the central nervous/ -neurological area, A Systematic review of the literature)
Pflügler, S.
Unpublished MSc thesis, 2021/04
Free full text
1417

Effektivität einer osteopathischen Behandlung der Nieren bei Leistenschmerz von Sportlern – eine einfach verblindete randomisierte Studie
(Effectiveness of an osteopathic kidney treatment for groin pain in athletes – a single blinded randomized trial)
Pakosta, M.
Unpublished MSc thesis, 2021/04
Free full text
1418

Auswirkungen eines auf dem Fasziendistorsionsmodell basierenden osteopathischen Interventionsprogramms auf die Hüftmobilität und subjektiv empfundene Lebensqualität von Coxarthrosepatienten im Vergleich zur physiotherapeutischen Standardbehandlung Eine randomisiert kontrollierte Studie
(A randomized controlled trial on the effects of an osteopathic treatment method according to the Fascial Distortion Model on the hip mobility and subjectively perceived quality of life of coxarthrosis patients)
Holzer-Jüttner, S.
Unpublished MSc thesis, 2021/04
1419

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text
1420

Osteopathic manipulative treatment to improve exclusive breast feeding at 1 month
Danielo Jouhier, M., Boscher, C., Roze, J. C., Cailleau, N., Chaligne, F., Legrand, A., Flamant, C., Muller, J. B.
Archives of Disease in Childhood. Fetal and Neonatal Edition, 2021/04
1421

Mentors’ experiences in an osteopathic medical student research program
Hamby, T., Bowman, W. P., Wilson, D. P., Basha, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
1422

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text
1423

Osteopathic Manipulative Treatment to Optimize the Glymphatic Environment in Severe Traumatic Brain Injury Measured With Optic Nerve Sheath Diameter, Intracranial Pressure Monitoring, and Neurological Pupil Index
Kashyap, S., Brazdzionis, J., Savla, P., Berry, J. A., Farr, S., Patchana, T., Majeed, G., Ghanchi, H., Bowen, I., Wacker, M. R., Miulli, D. E.
Cureus, 2021/03
Free full text
1424

Das benigne Prostatasyndrom im Kontext der Osteopathie
(Benign prostate syndrome in the context of osteopathy)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1425

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 1: Die Grundlagen
(Positional plagiocephaly and its osteopathic intervention. Part 1: Basics)
Engel, M.
Osteopathische Medizin, 2021/03
1426

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Expert*inneninterviews – Teil 2: Qualitative empirische Daten
(The osteopathic treatment of interosseous lesions: A qualitative content analysis of experts' interviews - Part 2: Qualitative empirical data)
Stecker, D.
Osteopathische Medizin, 2021/03
1427

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1428

Osteopathische Behandlung bei Vulvodynie
(Osteopathic treatment for vulvodynia)
Morgentau, M. J., Reinartz, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1429

Randomisierte kontrollierte Studien zur osteopathischen Behandlung des Ganglion pterygopalatinum
(Randomized controlled trials for osteopathic treatment of the pterygopalatine ganglion.)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1430

Efectividad del uso de las técnicas de alta velocidad en el tratamiento del dolor lumbo-pélvico en el embarazo, en comparación con el uso de otras técnicas osteopáticas
(Effectiveness of high-speed techniques in the treatment of lumbar-pelvic pain during pregnancy, compared to other osteopathic techniques)
Dorado Román, R.
European Journal Osteopathy & Related Clinical Research, 2021/03
Free full text
1431

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1432

Eficacia del tratamiento osteopático en bebés con disfunciones para la lactancia materna
(Effectiveness of osteopathic treatment in infants with breastfeeding difficulties)
García Rodríguez, A. E.
European Journal Osteopathy & Related Clinical Research, 2021/03
Free full text
1433

Osteopathic model of the development and prevention of occupational musculoskeletal disorders
Price, J. W.
Journal of Osteopathic Medicine, 2021/03
Free full text
1434

Efectividad de la terapia manual osteopática en el manejo de la enfermedad pulmonar obstructiva crónica
(Effectiveness of osteopathic manual therapy in the management of chronic obstructive pulmonary disease)
Ortega Castillo, M.
European Journal Osteopathy & Related Clinical Research, 2021/03
Free full text
1435

Developing a psychologically-informed pain management course for use in osteopathic practice: The OsteoMAP cohort study
Abbey, H., Nanke, L., Brownhill, K.
International Journal of Osteopathic Medicine, 2021/03
1436

Effects of osteopathic manipulative treatment and bio-electromagnetic energy regulation therapy on lower back pain
Auger, K., Shedlock, G., Coutinho, K., Myers, N. E., Lorenzo, S.
Journal of Osteopathic Medicine, 2021/03
Free full text
1437

Support for osteopathic manipulative treatment inclusion in chronic pain management guidelines: a narrative review
Franzetti, M., Dries, E., Stevens, B., Berkowitz, L., Yao, S. C.
Journal of Osteopathic Medicine, 2021/03
Free full text
1438

Teaching and use of cervical high-velocity, low-amplitude manipulation at colleges of osteopathic medicine
Hu, A., Motyka, T., Gish, E., Dogbey, G.
Journal of Osteopathic Medicine, 2021/03
Free full text
1439

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03
1440

Manual treatment for kidney mobility and symptoms in women with nonspecific low back pain and urinary infections
Lo Basso, F., Pilzer, A., Ferrero, G., Fiz, F., Fabbro, E., Oliva, D., Cazzarolli, C., Turrina, A.
Journal of Osteopathic Medicine, 2021/03
Free full text
1441

The use of 3D printing for osteopathic medical education of rib disorders
Moriles, K., Ramnot, A., Lai, M., Jacobs, R. J., Qureshi, Y.
Journal of Osteopathic Medicine, 2021/03
Free full text
1442

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03
1443

New clinical research urgently needed for adjunctive OMT treatment in elderly patients hospitalized with COVID-19 pneumonia
Vanacore, N.
Journal of Osteopathic Medicine, 2021/03
Free full text
1444

Impact of different types of revision materials on the learning of musculoskeletal techniques
Launay, F., Ménard, M., Bourgin, M., Mhadhbi, H., Sutre, F., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2021/03
1445

Effekt der Osteopathie auf Patientinnen mit Dysmenorrhoe - Ein Systematischer Review
(Effectiveness of Osteopathy in Patients with Dysmenorrhea - A systematic review)
Thurner, C.
Unpublished MSc thesis, 2021/03
Free full text
1446

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text
1447

Der tiefsitzende Beckenschmerz: Ein osteopathischer Behandlungsalgorithmus in sieben Schritten
(The chronic pelvic pain: An osteopathic treatment algorithm in seven steps)
Liedtke, H.
Osteopathische Medizin, 2021/03
1448

Proprioceptive Coherence: An Expanded View of the Mechanics Behind the Indirect Method and the Introduction of an Innovative Variation
Lockwood, M. D.
The AAO Journal, 2021/03
Free full text
1449

Complementary and alternative medicine use by pediatric oncology patients before, during, and after treatment
Lüthi, E., Diezi, M., Danon, N., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
BMC Complementary Medicine and Therapies, 2021/03
1450

Osteopathic Cranial Manipulation and Myofascial Release of Anterior Fascia to Improve Respiratory Dynamics in Obstructive Sleep Apnea Syndrome: A Case Series
Torres, J. W.
The AAO Journal, 2021/03
Free full text
1451

An Osteopathic Approach to Neck Pain
Zona, J. C., Cranor, M.
American Family Physician, 2021/03
1452

A splenic cyst causing a viscerosomatic reflex in the thoracic spine. A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2021/03
1453

Osteopathic manipulative treatment and the Spanish flu: a historical literature review
Baroni, F., Mancini, D., Tuscano, S. C., Scarlata, S., Lunghi, C., Cerritelli, F., Haxton, J.
Journal of Osteopathic Medicine, 2021/02
Free full text
1454

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text
1455

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
1456

Predictors of emotional wellbeing in osteopathic medical students in a COVID-19 world
Jacobs, R., Lanspa, M., Kane, M., Caballero, J.
Journal of Osteopathic Medicine, 2021/02
Free full text
1457

Characteristics and treatment of geriatric patients in an osteopathic neuromusculoskeletal medicine clinic
King, A. A., Cox, J., Bhatia, S., Snider, K. T.
Journal of Osteopathic Medicine, 2021/02
Free full text
1458

A mixed treatment comparison of selected osteopathic techniques used to treat acute nonspecific low back pain: a proof of concept and plan for further research
Price, J. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
1459

Effect of occipitoatlantal decompression on cerebral blood flow dynamics as evaluated by Doppler ultrasonography
Roberts, B., Makar, A. E., Canaan, R., Pazdernik, V., Kondrashova, T.
Journal of Osteopathic Medicine, 2021/02
Free full text
1460

Auswirkung einer Behandlung des lateralen Triggerbandes des Oberschenkels nach Prinzipien des Fasziendistorsionsmodells auf die Hüftbeweglichkeit
(Effect of a treatment of the lateral trigger band of the thigh according to the principles of the fascia distortion model by Dr. Stephen Typaldos on hip mobility)
Schulz, K.
Unpublished MSc thesis, 2021/02
Free full text
1461

Supportive care and osteopathic medicine in pediatric oncology: perspectives of current oncology clinicians, caregivers, and patients
Belsky, J. A., Stanek, J., Skeens, M. A., Gerhardt, C. A., Rose, M. J.
Supportive Care in Cancer, 2021/02
Free full text
1462

Effektivität der Osteopathischen Behandlung auf den Blutdruck - Eine Literaturübersichtsarbeit
(The effectiveness of the osteopathic treatment on blood pressure - A systematic review)
Vorreiter, A.
Unpublished MSc thesis, 2021/02
Free full text
1463

Osteopathische Behandlung bei Erwachsenen mit Zerebralparese - Wirkung eines osteopathischen Behandlungsprotokolls im Vergleich zur Vojta-Therapie auf Lungenfunktionsstörungen bei Erwachsenen mit Zerebralparese
(Osteopathic treatment of adults with cerebral palsy – Effects of an osteopathic treatment protocol compared with Vojta-therapy on impaired lung function in adults with cerebral palsy)
Walter, U.
Unpublished MSc thesis, 2021/02
1464

Pediatric Osteopathic Manipulative Medicine: A Scoping Review
DeMarsh, S., Huntzinger, A., Gehred, A., Stanek, J. R., Kemper, K. J., Belsky, J. A.
Pediatrics, 2021/02
1465

Effects of dynamic stabilization exercises and muscle energy technique on selected biopsychosocial outcomes for patients with chronic non-specific low back pain: a double-blind randomized controlled trial
Ahmed, U. A., Maharaj, S. S., Van Oosterwijck, J.
Scandinavian Journal of Pain, 2021/02
1466

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text
1467

The role of touch in osteopathic practice: A narrative review and integrative hypothesis
Baroni, F., Ruffini, N., D'Alessandro, G., Consorti, G., Lunghi, C.
Complementary Therapies in Clinical Practice, 2021/02
1468

Einfluss der Osteopathie auf das Hormon Cortisol
(The Effects of an Osteopathic Treatment on Cortisol Levels)
Lederbauer, C.
Unpublished MSc thesis, 2021/02
Free full text
1469

Einfluss einer osteopathischen Behandlung auf chemotherapeutisch induzierte Nausea und Vomiting (CINV) und auf die gesundheitsbezogene Lebensqualität während emetogen wirkender Chemotherapie
(The Influence of Osteopathic Treatment on Chemotherapy Induced Nausea and Vomiting (CINV) and Health Related Quality of Life (QoL) in Patients with Cancer treated with Emetogenic Chemotherapy)
Aranya-Mayr, J.
Unpublished MSc thesis, 2021/02
1470

Osteopathic neuromuscular rehabilitation: A novel approach to treat spasticity following systemic illness, brain tumour, and traumatic brain injury in general population
Ali, I.
Unpublished PhD thesis, 2021/02
Free full text
1471

Osteopathische Behandlung bei Plagiozephalie
(Osteopathic treatment of plagiocephaly)
Kenner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1472

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1473

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1474

Ist kraniale Osteopathie zuverlässig und wirksam?
(Is cranial osteopathy reliable and effective?)
Reißmann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1475

Gut Microbiome Changes with Osteopathic Treatment of Constipation in Parkinson's Disease: A Pilot Study
Mancini, J. D., Yao, S., Martinez, L. R., Shakil, H., Li, T. S.
Neurology (ECronicon), 2021/01
Free full text
1476

The Effect of Manual Therapy on Lower Extremity Joint Kinematics during Running: A single-subject case study
Drapeaux, A., Carlson, K.
Journal of Bodywork and Movement Therapies, 2021/01
1477

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01
1478

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01
1479

Pilot study assessing the effect of osteopathic manipulative treatment (OMT) on length of stay in neonates after therapeutic hypothermia
Bendixen, K., Beinlich, A., Beck, B., Hashmi, N., Craig, A.
Journal of Osteopathic Medicine, 2021/01
1480

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text
1481

Osteopathic manipulative treatment (OMT) use among osteopathic physicians in the United States
Healy, C. J., Brockway, M. D., Wilde, B. B.
Journal of Osteopathic Medicine, 2021/01
Free full text
1482

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text
1483

Investigating the current literature comprising osteopathic manual therapy (OMT) as an intervention: A scoping review
Ryan, H.
Unpublished MSc thesis, 2021/01
Free full text
1484

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text
1485

Effectiveness of osteopathic interventions in chronic non-specific low back pain: A systematic review and meta-analysis
Dal Farra, F., Risio, R. G., Vismara, L., Bergna, A.
Complementary Therapies in Medicine, 2021/01
Free full text
1486

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text
1487

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text
1488

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text
1489

Inanspruchnahme osteopathischer Medizin bei chronisch und Langzeit-Erkrankten
(Use of osteopathic medicine for chronic and long-term patients)
Beer, A.M., Kiseier, P., Weber, H.
Journal für Pharmakologie und Therapie, 2021
Free full text
1490

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1491

Das osteopathische Labor: Erfahrung ermöglichen
(The osteopathic laboratory: Enabling experience)
Levin, P., Strebel, W.
Osteopathische Medizin, 2020/12
1492

The Effect of Osteopathic Manipulative Treatment (OMT) on Proprioception in Adults: A Pilot Study
Hoevemeyer, K., Teng, K. Y., Mehner, T., McMunn, R., Figueroa, J., Jie, C.
The AAO Journal, 2020/12
Free full text
1493

La prise en charge des grands syndromes cranio-maxillo-faciaux en ostéopathie pédiatrique : Treatment of major cranio-maxillo-facial syndromes in pediatric osteopathy
(Treatment of major cranio-maxillo-facial syndromes in pediatric osteopathy)
Lalauze-Pol, R.
Unpublished PhD thesis, 2020/12
1494

The influence of an osteopathic treatment on pregnant women on expected date of delivery on the course of parturition and the subjective well-being: A Pilot Study
Tauch, A.
European Journal of Osteopathic Research, 2020/12
Free full text
1495

Efectividad del tratamiento osteopático en los síndromes de dolor pélvico crónico
(Effectiveness of osteopathic treatment in chronic pelvic pain syndromes)
Valls Úbeda, R.
European Journal Osteopathy & Related Clinical Research, 2020/12
Free full text
1496

The importance of rigour in the reporting of evidence for osteopathic care in Covid-19 papers
Draper-Rodi, J., Vaucher, P., Thomson, O. P.
Explore (NY), 2020/12
Free full text
1497

Characteristics and Management of Pregnant Patients From a Neuromusculoskeletal Medicine/Osteopathic Manipulative Medicine Clinic
Frank, L. D., Bhatia, S., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1498

Osteopathic Approach to the Treatment of a Patient With Idiopathic Iliohypogastric Neuralgia
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1499

CRI over MRI: A Cranial Approach to Dizziness
Qureshi, Y., Patel, U., Mercer, A.
The AAO Journal, 2020/12
Free full text
1500

Wissenschaftlich fundiert oder fragwürdiger Mythos?: Osteopathische Behandlungserfolge im Vergleich zur Schulmedizin während der Spanischen Grippe in den USA
(Scientifically substantiated or questionable myth?: Comparison between osteopathic treatment successes and conventional medicine during the Spanish flu in the USA)
Schwerla, F., Franke, H.
Osteopathische Medizin, 2020/12
1501

Der Milchglasblick oder das Lächeln der Mona Lisa
(The frosted glass look or the smile of Mona Lisa)
Sibbing, D.
Osteopathische Medizin, 2020/12
1502

The Use of Osteopathic Manipulative Medicine in the Management of Recurrent Mastitis
Jackson, C., Loveless, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1503

Crying Unsettled and disTressed Infants Effectiveness Study of osteopathic care (CUTIES trial): Pragmatic randomised superiority trial protocol
Carnes, D., Bright, P., Brownhill, K., Carroll, K., Engel, R., Grace, S., Vogel, S., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/12
1504

Upper airway stabilization by osteopathic manipulation of the sphenopalatine ganglion versus sham manipulation in OSAS patients: a proof-of-concept, randomized, crossover, double-blind, controlled study
Jacq, O., Arnulf, I., Similowski, T., Attali, V.
BMC Complementary and Alternative Medicine, 2020/12
Free full text
1505

Brain Connectivity Changes after Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tramontano, M., Cerritelli, F., Piras, F., Spanò, B., Tamburella, F., Piras, F., Caltagirone, C., Gili, T.
Brain Sciences, 2020/12
Free full text
1506

Results of complex treatment with the inclusion of osteopathic correction of somatic dysfunctions in perinatal CNS lesions in children of the first year of life
(Результаты комплексного лечения с включением остеопатической коррекции соматических дисфункций при перинатальном поражении ЦНС у детей первого года жизни)
Abramova, E. V., Aptekar, I. A., Aptekar, V. I., Yudina, A. A.
Russian Osteopathic Journal, 2020/12
Free full text
1507

Comparative study of the effectiveness of standard therapy and the complex therapy with inclusion of osteopathic correction, in patients with discogenic SI radiculopathy
(Сравнительное исследование эффективности стандартной и комплексной, включающей остеопатическую коррекцию, терапии пациентов с дискогенной SI радикулопатией)
Adrianova, S. M., Akhmetov, B. H.
Russian Osteopathic Journal, 2020/12
Free full text
1508

Reflexology in the treatment of patients with dorsopathy
(Рефлексотерапия в лечении пациентов с дорсопатией)
Belash, V. O., Agasarov, L. G.
Russian Osteopathic Journal, 2020/12
Free full text
1509

Osteopathic correction in the complex therapy of patients with hemispasm
(Остеопатическая коррекция в комплексной терапии пациентов с гемиспазмом)
Belash, V. O., Guzhina, E. Y.
Russian Osteopathic Journal, 2020/12
Free full text
1510

Cranial Manipulation Affects Neuronal Gene Expression, Explaining the Improved Cognitive Ability in an Animal Model of Age-related Cognitive Decline
Anandakrishnan, R.
The Journal of the American Osteopathic Association, 2020/12
1511

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12
1512

Training Osteopathic Medical Students for Drastic 2021 Health Record Documentation Policy Changes
Bains, R., Gill, A., Singh, J., Antos, A., Lim, S., Molga, H., Malik, A., St. Pierre, S., Davis, G., Warner, M.
The Journal of the American Osteopathic Association, 2020/12
1513

The effect of osteopathic medicine on pain in musicians with nonspecific chronic neck pain: a randomized controlled trial
Rotter, G., Fernholz, I., Binting, S., Keller, T., Roll, S., Kass, B., Reinhold, T., Willich, S. N., Schmidt, A., Brinkhaus, B.
Therapeutic Advances in Musculoskeletal Disease, 2020/12
Free full text
1514

The Effect of Osteopathic Manipulative Treatment on Stiff Person Syndrome
Bazzi, M. O., Vemuri, A., Downing, M. A., Barry, P. E.
The Journal of the American Osteopathic Association, 2020/12
1515

The Use of Osteopathic Manipulation to Facilitate Bone Remodeling in a Postmenopausal Osteoporotic Woman
Grabie, Y., Jamil, N., Habib, N., Simone, J. J.
The Journal of the American Osteopathic Association, 2020/12
1516

Levels of Resilience & Coping of Osteopathic Medical Students during COVID-19: Implications for Mental Health Innovations for Physicians in Training
Lanspa, M. E., Jacobs, R. J., Patel, K. C.
The Journal of the American Osteopathic Association, 2020/12
1517

The Effects of Osteopathic Manipulative Treatment on HbA1c in Type 2 Diabetes and Pre-diabetes: A Randomized-Control Clinical Trial
Sureshbabu, S., Sheflin, K., Li, T. S., Heller, M., Yusupov, E., Krishnamachari, B., Allera, A., Rivera-Martinez, S.
The Journal of the American Osteopathic Association, 2020/12
1518

Comparison of the effects of a Mitchell’s myotensive technique and the strain-shortening technique on passive axial rotation of the cervical spine
(Сравнение влияния миотензивной техники Митчелла и так называемой техники укорочения с сопротивлением на пассивную осевую ротацию шейного отдела позвоночника)
Dehiles, R., Salem, W., Klein, P.
Russian Osteopathic Journal, 2020/12
Free full text
1519

Utilizing Osteopathic Manipulative Treatment as a Non-Surgical Approach to Severs Disease in a Growing Adolescent
Madhu, B., Goldenhart, A.
Southern Medical Journal, 2020/12
1520

Comparison of manual therapy and pharmacotherapy effectiveness in the treatment and rehabilitation of patients with piriformis syndrome
(Сравнение эффективности мануальной терапии и фармакотерапии в лечении и реабилитации пациентов с синдромом грушевидной мышцы)
Frolov, V. A., Akopyan, M. S., Berezin, V. V.
Russian Osteopathic Journal, 2020/12
Free full text
1521

The influence of osteopathic correction to the level of stress in patients with cervicobrachialgia
(Влияние остеопатической коррекции на уровень стресса у пациенток с цервикокраниалгией)
Korman, D. V., Yushmanov, I. G.
Russian Osteopathic Journal, 2020/12
Free full text
1522

The Effect of Osteopathic Manipulative Treatment on Lower Limb Muscle Rigidity in a Parkinson's Patient
Vemuri, A., Xu, E., Downing, M., Widboom, N.
Southern Medical Journal, 2020/12
1523

Osteopathic correction as part of the complex treatment of primary biliary cholangitis
(Остеопатическая коррекция в составе комплексного лечения первичного билиарного холангита)
Lebedev, D. S., Nizamova, A. H.
Russian Osteopathic Journal, 2020/12
Free full text
1524

Possibilities and organizational problems of diagnostics and treatment of patients with the syndrome of temporomandibular joint pain dysfunction
(Возможности и организационные проблемы диагностики и лечения пациентов с синдромом болевой дисфункции височно-нижнечелюстного сустава)
Milutka, Y. A., Fortin, A. E.
Russian Osteopathic Journal, 2020/12
Free full text
1525

The effect of tongue and suprahyoid muscles release in the treatment of chronic non-specific neck pain: Study protocol for a randomized controlled trial
Silva, A. C., Godinho, M. M., Biasotto Gonzalez, D. A., Politti, F.
International Journal of Osteopathic Medicine, 2020/12
1526

Die Brustdrüse aus osteopathischer Sicht: Teil 2: Praktische Anwendung
(The mammary gland from an osteopathic point of view - Part 2: Practical application)
Frühwein, J.
Osteopathische Medizin, 2020/12
1527

Einzelfallstudie über den Einfluss einer osteopathischen Behandlung eines Mannes mit unerfülltem Kinderwunsch
(Single Case Study on the Influence of an Osteopathic Treatment of One Man with the Unfulfilled Desire To Have a Child)
Mayrhofer, M.
Unpublished MSc thesis, 2020/12
Free full text
1528

An Osteopathic Modular Approach to Asthma: A Narrative Review
Schend, J., Rowane, M., Sanan, N., Hostoffer, S. R.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1529

Somatic Dysfunctions of Hip and Pelvis Overlooked in a Case of Vulvodynia
Giovanis, A., Zeszutek, S.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1530

The clinical management of neck pain of novice and experienced Australian osteopaths: a secondary analysis of a nationally representative sample
Fleischmann, M., McLaughlin, P., Hayes, A., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2020/11
1531

Ultrasonography to Assess the Efficacy of Osteopathic Manipulative Treatment for Lumbar Spine Asymmetry
Winter, J., Kimber, A., Montenegro, S., Gao, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1532

Neurophysiologische Aspekte der osteopathischen Palpation gemessen mit der Herzratenvariabilitätsmessung
(Neurophysiological aspects of osteopathic palpation measured with the heart rate variability measurement)
Strohmaier, B.
Unpublished MSc thesis, 2020/11
Free full text
1533

Osteopathische Anwendung bei Aufmrksamkeits - Defizit - Syndrom
(Osteopathic application in case of lack of concentration)
Werth, B.
Unpublished MSc thesis, 2020/11
1534

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text
1535

Osteopathic manipulative treatment in a general pediatric setting: An account of reflective practice
Mills, M. V.
Complementary Therapies in Clinical Practice, 2020/11
1536

Osteopathic Approach to Treatment of Carpal Dysfunction: The Carpal Mobilization Technique
Mehner, T. R., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1537

Die Sicherheit von Osteopathie bei Schwangeren anhand der Auswirkung auf das mögliche Risiko von Komplikationen vor, während und nach der Geburt
(The safety of osteopathy in pregnant women based on its impact on the risk of complications before, during, and after childbirth)
Kleindessner, A.
Unpublished MSc thesis, 2020/11
Free full text
1538

Chronisch-funktionelle Obstipation bei Kindern – Eine fallkontrollierte Studie Ist Osteopathie effektiver als die medizinische Standardbehandlung?
(Functional Constipation in Childhood – A Case Controlled Study Is osteopathic treatment more effective than medicinal standard treatment?)
Eisenschenk, R.
Unpublished MSc thesis, 2020/11
Free full text
1539

Einfluss einer osteopathischen Behandlung der Halswirbelsäule bei Schulterschmerzen
(Influence of an osteopathic treatment on shoulder pain)
Albrecht, J. M.
Unpublished MSc thesis, 2020/10
Free full text
1540

Osteopathic Manipulative Treatment in Individuals With Vertigo and Somatic Dysfunction: A Randomized, Controlled, Comparative Feasibility Study
Fraix, M., Badran, S., Graham, V., Redman-Bentley, D., Hurwitz, E. L., Quan, V. L., Yim, M., Hudson-McKinney, M., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1541

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text
1542

Cranial osteopathic treatment and stress-related effects on autonomic nervous system measured by salivary markers: A pilot study
Abenavoli, A., Badi, F., Barbieri, M., Bianchi, M., Biglione, G., Dealessi, C., Grandini, M., Lavazza, C., Mapelli, L., Milano, V., Monti, L., Seppia, S., Tresoldi, M., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2020/10
1543

Cerebral tissue oxygenation during cranial osteopathic CV4 procedure in newborns
Malak, R., Kozłowska, Z., Owsiańska, Z., Sikorska, D., Andrusiewicz, M., Szymankiewicz-Bręborowicz, M., Samborski, W., Szczapa, T.
Advances in Clinical and Experimental Medicine, 2020/10
Free full text
1544

Effektivität von Osteopathie bei Patient/en/innen mit gastrointestinalen Erkrankungen; Eine systematische Übersichtsarbeit
(Effectiveness of Osteopathy in Patients with Gastrointestinal Diseases - A Systematic Review)
Schönberger, B.
Unpublished MSc thesis, 2020/10
Free full text
1545

Communication Skills of Grandview/Southview Medical Center General Surgery Residents
Johnson, W., Ngo, A., Elrod, M.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1546

Wie reliabel ist die Identifikation der somatischen Dysfunktion in der Osteopathie?
(Is there a reliability in the identification of the somatic dysfunktion in osteopathy?)
Soika, S.
Unpublished MSc thesis, 2020/10
1547

Osteopathic Medical Licensing Compliance With the Americans With Disabilities Act of 1990
Lincoln, K. A., Wagner, B. E.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1548

Osteopathie bei PatientInnen mit Knochenmarködemen im Kniegelenksbereich - Eine nicht kontrollierte Interventionsstudie
(Osteopathy related to patients with bone marrow edema – A non-controlled intervention study)
Taferner, W.
Unpublished MSc thesis, 2020/10
Free full text
1549

A phenomenological investigation into the influences on the development of professional identity in novice osteopaths
Razon, C. J.
Unpublished MSc thesis, 2020/10
Free full text
1550

A Pilot Study of Jugular Compression (Queckenstedt maneuver) for Cranial Movement Perception
Abenavoli, A., Pisa, S., Maggiani, A.
The Journal of the American Osteopathic Association, 2020/10
1551

The Role of Musculoskeletal Disorders in Chronic Disease: A Narrative Review
Asahi, M. G., Briganti, D., Cam, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1552

Osteopathic Manipulative Treatments for Pediatric Conditions
Raines, S. G. M., Ramey, A. L.
Osteopathic Family Physician, 2020/10
Free full text
1553

A Case of Resolved Vincristine-Induced Constipation Following Osteopathic Medicine in a Patient With Infantile Fibrosarcoma
Belsky, J. A., Wolf, K., Setty, B. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1554

Osteopathic Manipulative Treatment for a Recognizable Pattern of Somatic Dysfunction Following Laparoscopic Cholecystectomy
Mills, M., Sevensma, K., Serrano, J.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1555

La fascia desde la medicina osteopática
(Fascia from the perspective of osteopathic medicine)
Stambulie Padilla, E. A.
Unpublished MSc thesis, 2020/10
Free full text
1556

Treating Complex Regional Pain Syndrome Using Counterstrain: A Novel Approach
Schranz, K., Meitz, D., Powers, B., Ables, A.
Cureus, 2020/10
Free full text
1557

Osteopathie bei umschriebenen Entwicklungsstörungen
(Osteopathy for specific developmental disorder)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1558

Auswirkungen von osteopathischen Behandlungen im Vergleich zur Anwendung eines Entspannungsverfahrens auf die Lebensqualität von Endometriose-Patientinnen
(Effects of Osteopathic Treatments in Comparison to a Relaxation-Method on the Quality of Life of Endometriosis Patients)
Kremen-Pilz, I.
Unpublished MSc thesis, 2020/10
Free full text
1559

Osteopathie bei epileptischen Anfällen
(Osteopathy for epileptic disorder)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1560

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht Teil 2: Was wirkt im Wirk-Bündnis der Osteopathie?
(Who and what constitutes connection within osteopathic treatment? A medical-philosophical contribution from the osteopathic point of view. Part 2: What works in the active alliance of osteopathy?)
Kaiser, A. K.
Osteopathische Medizin, 2020/09
1561

Die kranio-kaudale Bewegung im Articulatio tibiofibulare proximalis bei einer Dorsalextension und Plantarflexion im Articulatio talocruralis
(The cranial and caudal movement of the Art. Tibiofibularis proximalis during dorsalextension and plantarflexion)
Bernhardt, M.
Unpublished MSc thesis, 2020/09
Free full text
1562

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text
1563

Self-management behaviour and knowledge of patients with musculoskeletal complaints attending an Australian osteopathy clinic: A consecutive sampling design
Vaughan, B., Grant, M., Moroz, J., Ngawaka, C., Mulcahy, J.
International Journal of Osteopathic Medicine, 2020/09
1564

Osteopathic manipulative techniques for migraine treatment - Letter to the editor
Yuh, C. I., Agustines, D.
International Journal of Osteopathic Medicine, 2020/09
1565

The Immediate, Intermediate, and Long-Term Effects of Osteopathic Manipulative Treatment on Pulmonary Function in Adults with Asthma
Kasten, K. M., Tyler, S. K., Johnson, A. R., Kolakowski, E. R., Pickos, J., Heineman, K., Jie, C.
The AAO Journal, 2020/09
Free full text
1566

Osteopathische Behandlung des Larynx
(Osteopathic treatment of the larynx)
Liem, T.
Osteopathische Medizin, 2020/09
1567

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09
1568

Severe Viscerosomatic Neck Pain from Refractory Gastroesophageal Reflux
Uhrig, J., Rettos, J.
The AAO Journal, 2020/09
Free full text
1569

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Experteninterviews – Teil 1: Theorie und Forschungsstand
(The osteopathic treatment of interosseous lesions. A qualitative content analysis of experts' opinion - Part 1: Theory and state of research)
Stecker, D.
Osteopathische Medizin, 2020/09
1570

Spinal Manipulation and Select Manual Therapies: Current Perspectives
Hinkeldey, N., Okamoto, C., Khan, J.
Physical medicine and rehabilitation clinics of North America, 2020/09
1571

What Makes an Osteopathic Treatment Effective From a Patient's Perspective: A Descriptive Phenomenological Study
Consorti, G., Marchetti, A., De Marinis, M. G.
Journal of Manipulative and Physiological Therapeutics, 2020/09
1572

The rationale for the combined use of osteopathic methods of correction and reflexology in the complex treatment of patients with dorsopathy at the cervico-thoracic level
(Обоснование сочетанного применения остеопатических методов коррекции и рефлексотерапии в комплексной терапии пациентов с дорсопатией на шейно-грудном уровне)
Belash, V. O., Urazgalieva, L. R., Fayzullina, R. I., Agasarov, L. G.
Russian Osteopathic Journal, 2020/09
Free full text
1573

Assessing the feasibility of a therapy package application on reducing psychological and physiological stress in women: a pilot study
Taylor, V. J.
Unpublished MSc thesis, 2020/09
Free full text
1574

Assessing the feasibility of a therapy package application on reducing psychological and physiological stress in men: a pilot study
Rahier, A.
Unpublished MSc thesis, 2020/09
Free full text
1575

Fascial distortion model (FDM-therapy). Principles of diagnosis and treatment (literature review
(Модель фасциальных дисторсий (FDM-терапия). Принципы диагностики и лечения (обзор литературы)
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. I.
Russian Osteopathic Journal, 2020/09
Free full text
1576

The structure of somatic dysfunctions in women with a nodular form of uterine myoma
(Структура соматических дисфункций у женщин с узловой формой миомы матки)
Chebotaeva, G. N., Lebedev, D. S.
Russian Osteopathic Journal, 2020/09
Free full text
1577

„Der Dampf des Lebens“: Das Blut im Kontext der (klassischen) Osteopathie
“The steam of life“: The blood in the context of (classical) osteopathy
Engel, M.
Osteopathische Medizin, 2020/09
1578

Effects of a General Osteopathic treatment on asthmatic children
(Влияние общего остеопатического лечения на функцию внешнего дыхания детей, страдающих астмой)
Ernoult, B., Job, H.
Russian Osteopathic Journal, 2020/09
Free full text
1579

Rationale for the use of osteopathic correction methods in patients with Sudeck syndrome
(Обоснование применения методов остеопатической коррекции у пациентов с синдромом Зудека)
Mikhnov, G. I., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/09
Free full text
1580

Possibilities of applying of osteopathic correction methods in the treatment of pain syndrome in nephroptosis
(Возможности применения остеопатических методов коррекции в лечении болевого синдрома при нефроптозе)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/09
Free full text
1581

The application of physical therapy and balneology of the patients with non-specific low back pain (literature review
(Применение физио- и бальнеотерапии у пациентов с неспецифической болью в нижней части спины (обзор литературы)
Novikov, A. Y., Shaiakhmetov, A. R., Novikov, Y. O.
Russian Osteopathic Journal, 2020/09
Free full text
1582

Instrumentation used to assess pain in osteopathic interventions: A critical literature review
Santiago, R. J., Esteves, J., Baptista, J. S., Marques, A. T., Costa, J. T.
International Journal of Osteopathic Medicine, 2020/09
1583

Recognizing Postoperative Nutritional Complications of Bariatric Surgery in the Primary Care Patient: A Narrative Review
Chamberlain, C., Terry, R., Shtayyeh, T., Martinez, C.
The Journal of the American Osteopathic Association, 2020/09
Free full text
1584

Opioid Use in the Postpartum Period: Are We Prescribing Too Much?
Prentice, D., Berry, A., Stewart, L., Wilkins, H., Ural, S., Deiter, R.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1585

Does Osteopathic Manipulative Treatment Induce Autonomic Changes in Healthy Participants? A Thermal Imaging Study
Cerritelli, F., Cardone, D., Pirino, A., Merla, A., Scoppa, F.
Frontiers in Neuroscience, 2020/08
Free full text
1586

Osteopathic Considerations for the Pregnant Patient with COVID-19
Gray, K. M., Murphy, L., Buckner, B.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1587

Effectiveness of Osteopathic Manipulative Medicine vs Concussion Education in Treating Student Athletes With Acute Concussion Symptoms
Yao, S. C., Zwibel, H., Angelo, N., Leder, A., Mancini, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1588

Osteopathic Manipulative Treatment for Inhaled Rib Somatic Dysfunction
Koch, J., Tsui, C., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1589

Treatment Modalities for Notalgia Paresthetica Including OMT
Cooley, D., McAree, M., Joshi, N., Peerzada, W.
Osteopathic Family Physician, 2020/08
Free full text
1590

Telemedicine During a Pandemic with Osteopathic Considerations
Rhoads, A.
Osteopathic Family Physician, 2020/08
Free full text
1591

Effects of Osteopathic Manipulative Treatment on Sleep Quality in Student Athletes After Concussion: A Pilot Study
Mazzeo, S., Silverberg, C., Oommen, T., Moya, D., Angelo, N., Zwibel, H., Mancini, J., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1592

Rib Somatic Dysfunction Among General Surgical Patients
Baltazar, G. A., Kolwitz, C. E., Florek, M. G.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1593

Clinical Efficacy of Mesenteric Lift to Relieve Constipation in Traumatic Brain Injury Patients
Berry, J. A. D., Ogunlade, J., Kashyap, S., Berry, D. K., Wacker, M., Miulli, D. E., Saini, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1594

Use of Osteopathic Manipulation for Treatment of Chronic Shoulder Injury Related to Vaccine Administration
Veera, S., Chin, J., Kleyn, L., Spinelli, S., Tafler, L.
Cureus, 2020/08
Free full text
1595

Positional plagiocephaly from structure to function: Clinical experience of the service of pediatric osteopathy in Italy
Filisetti, M., Cattarelli, D., Bonomi, S.
Early Human Development, 2020/07
1596

Musculoskeletal Therapies: Osteopathic Manipulative Treatment
Jonas, C.
FP Essentials, 2020/07
1597

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07
1598

Osteopathic Treatment leads to significantly greater reductions in chronic thoracic pain after CABG surgery: a randomised controlled trial
Roncada, Gert
Journal of Bodywork and Movement Therapies, 2020/07
1599

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07
1600

Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Cicchitti, L., Di Lelio, A., Barlafante, G., Cozzolino, V., Di Valerio, S., Fusilli, P., Lucisano, G., Renzetti, C., Verzella, M., Rossi, M. C.
Medical sciences, 2020/07
Free full text
1601

Osteopathic Manipulation in the Management of Chronic Pain: Current Perspectives
Licciardone, J. C., Schultz, M. J., Amen, B.
Journal of Pain Research, 2020/07
Free full text
1602

Auswirkungen osteopathischer Techniken an der Pleura parietalis auf das Atemvolumen: Eine Pilotstudie mit gesunden Erwachsenen
(Effects of osteopathic techniques applied to the Pleura parietalis on the respiratory volume: a pilot study with healthy adults)
Strnad, V.
Unpublished MSc thesis, 2020/07
Free full text
1603

Osteopathic Response to the COVID-19 Pandemic
Martinez, E., Redding, D.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1604

Osteopathic Manipulative Treatment and Psychosocial Management of Dysmenorrhea
Matsushita, S., Wong, B., Kanumalla, R., Goldstein, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1605

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1606

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht, Teil 1: Was ist ein Osteopath?
(Who and what work in the effective therapeutic alliance of osteopathy? - A medical-philosophical contribution from the point of view of osteopathy. Part 1: What is an osteopath?)
Kaiser, A. K.
Osteopathische Medizin, 2020/06
1607

Regulationsstörung bei Säuglingen: neue An- und Aussichten
(Regulation disorder in infants: new approaches and prospects)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1608

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1609

(Corporeality of the heart)
Kozljanič, R. J., Scheuchl, F., Rösing, S.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1610

Die visuelle Vorstellung in der osteopathischen Palpation
(Visual Imagination in Osteopathic Palpation)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1611

Neuro-Ocular Release: A New Osteopathic Technique For Resolving Somatic Dysfunction
Feely, R. A., Smith, J. A.
The AAO Journal, 2020/06
Free full text
1612

How Trainees Finance Their Medical Education: Implications of Higher Education Act Reform
Scheckel, C. J., Richards, J. R., Newman, J. R., Fangman, B. D., Poole, K. G.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1613

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text
1614

Integrating Osteopathic Manipulative Treatment and Injections in the Diagnosis and Management of a Hip Labral Tear
Snyder, L. L., Knox, S. C., Smutny, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1615

Das Konzept „Hotelzimmer Uterus” möchte als anschauliche Allegorie dem Osteopathen und der (werdenden) Mutter aufzeigen, dass potenzielle Schockenergien, insbesondere in den Uteruswänden, einen negativen Effekt auf ein Ungeborenes haben oder sogar eine erfolgreiche Schwangerschaft verhindern kann. Es werden insbesondere Themen wie Kindsverlust und sexuelle Übergriffe angesprochen, da sie erfahrungsgemäß am ehesten gespeicherte (potenzielle) Schockenergien im gynäkologischen System hinterlassen. Das Phänomen Schockenergie wie auch die therapeutischen Ansätze zu deren Ausleitung werden kurz erläutert, insbesondere auch eventuelle Risiken bei der Behandlung in der Schwangerschaft.
(Shock in the uterus: The “hotel room“ phenomenon)
Muntinga, E.
Osteopathische Medizin, 2020/06
1616

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1617

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06
1618

Skoliose und Osteopathie: Teil 2: Osteopathische Behandlung
(Scoliosis and osteopathy. Part 2: Osteopathic treatment)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/06
1619

Effects of Osteopathic Manipulative Treatment on Musicians: A Systematic Review
Kiepe, M. S., Fernholz, I., Schmidt, T., Brinkhaus, B., Schmidt, A., Weikert, C., Rotter, G.
Medical problems of performing artists, 2020/06
1620

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text
1621

Inter-examiner agreement of musculoskeletal and visceral tests to assess the pelvic region in women with stress urinary incontinence
Arcanjo, G. N., Mendes, M. R., Cavalcante, A., Lima, . O., Vilaça-Alves, J., Rocha, M.
Motricidade, 2020/06
Free full text
1622

Influence of osteopathic correction on sports achievements of racing athletes
(Влияние остеопатической коррекции на спортивные достижения спортсменов-автогонщиков)
Azarenkova, A. M., Safin, R. F.
Russian Osteopathic Journal, 2020/06
Free full text
1623

Global osteopathic treatment in the therapy of patients with chronic tension headache
(Общее остеопатическое лечение в терапии пациентов с хронической головной болью напряжения)
Belash, V. O., Bruk, I. I.
Russian Osteopathic Journal, 2020/06
Free full text
1624

Osteopathic correction in the treatment of pain in the lower back
(Остеопатическая коррекция при лечении боли в нижней части спины)
Belash, V. O., Novikov, Y. O.
Russian Osteopathic Journal, 2020/06
Free full text
1625

Efficacy of osteopathic manipulative treatment on postural control in Parkinsonian patients with Pisa syndrome: A pilot randomized placebo-controlled trial
Zarucchi, A., Vismara, L., Frazzitta, G., Mauro, A., Priano, L., Maestri, R., Bergna, A., Tarantino, A. G.
NeuroRehabilitation, 2020/06
1626

Influence of osteopathic correction on the functional state of the athletes′ organism during the training process of martial arts practicing (Kendo
(Влияние остеопатической коррекции на функциональное состояние спортсменов при занятиях восточными единоборствами (кендо)
Fasikov, R. M., Safin, R. F.
Russian Osteopathic Journal, 2020/06
Free full text
1627

A subjective and objective analysis of the immediate effect of osteopathic manual treatment OMT on the golf swing
Maass, Z, Buffington, A, Miner, M, Hall, M
Clinical journal of sport medicine, 2020/06
1628

Possibility of osteopathic correction in the complex therapy of patients after sternotomy performed in connection with the surgical treatment of acquired heart defects
(Возможность применения остеопатической коррекции в комплексной терапии пациентов после стернотомии, выполненной в связи с хирургическим лечением приобретенного порока сердца)
Glushkov, A. A., Salakhov, R. G., Yunusova, A. D., Lebedev, D. A.
Russian Osteopathic Journal, 2020/06
Free full text
1629

Möglicher Erfolg einer individualisierten osteopathischen Behandlung für die Lebensqualität bei einem Patienten mit einem idiopathischen zentralen Diabetes insipidus
(Potential success of an individualised osteopathic therapy for the quality of life of a patient suffering from an idiopathic central diabetes insipidus)
Zenner, C.
Unpublished MSc thesis, 2020/06
Free full text
1630

The rationale for the joint use of osteopathic correction and kinesiotherapy in the humeroscapular periarthrosis syndrome (humeroscapular periarthropathy) treatment
(Обоснование совместного применения остеопатической коррекции и метода кинезиотейпирования при лечении синдрома плечелопаточного периартроза (плечелопаточной периартропатии)
Lebedev, E. B., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/06
Free full text
1631

Influence of osteopathic correction on the psychoemotional state and quality of life of pregnant women with concomitant pathology of the urinary system
(Влияние остеопатической коррекции на психоэмоциональное состояние и качество жизни беременных с сопутствующей патологией мочевыводящей системы)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/06
Free full text
1632

Rationale for the use of osteopathic correction in the treatment of patients with chronic lower limb vein disease
(Обоснование применения остеопатической коррекции при лечении пациенток с хроническим заболеванием вен нижних конечностей)
Shmeleva, A. S., Mizonova, I. B.
Russian Osteopathic Journal, 2020/06
Free full text
1633

Effects of Osteopathic Care on patients suffering with pudendal neuralgia: a prospective monocentric study
(Моноцентровое проспективное исследование влияния остеопатического лечения на здоровье пациентов, страдающих невралгией полового нерва)
Tessier, A., Morin, M.P.
Russian Osteopathic Journal, 2020/06
Free full text
1634

The use of osteopathic correction in conjunction with radon baths at the sanatorium-resort stage of rehabilitation of patients with dorsopathy
(Применение остеопатической коррекции совместно с радоновыми ваннами на санаторно-курортном этапе реабилитации пациентов с дорсопатией)
Ul′ikhina, N. V., Shiryayeva, E. E.
Russian Osteopathic Journal, 2020/06
Free full text
1635

Manualtherapeutische Behandlung des Zwerchfells bei Asthma bronchiale: Studien geben Hoffnung
(Manual therapy treatment of the diaphragm in bronchial asthma: studies give hope)
Funke, P., Grasmück, J., Merkt, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1636

Behandlung einer stauungsbedingten Trigeminusneuralgie
(Treatment of trigeminal neuralgia as a result of congestion)
Hartmann, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1637

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1638

Weekly Osteopathic Manipulative Treatment to Improve Measures of Sympathetic Tone in Women With Polycystic Ovary Syndrome: A Randomized, Controlled Pilot Study
Davis, S. E., Hendryx, J., Menezes, C., Bouwer, S., Menezes, H., Patel, V., Bostick Smith, C. A., Speelman, D. L.
The Journal of the American Osteopathic Association, 2020/05
Free full text
1639

Evaluation of the stomatognathic system before and after osteopathic manipulative treatment in 120 healthy people by using surface electromyography
Manzotti, A., Viganoni, C., Lauritano, D., Bernasconi, S., Paparo, A., Risso, R., Nanussi, A.
International Journal of Environmental Research and Public Health, 2020/05
Free full text
1640

Doctors Wanted: Women Encouraged to Apply. A Historical Analysis of Women in Osteopathic Medical Education
Karacay, K. C.
Unpublished PhD thesis, 2020/05
1641

Revisión sistemática del tratamiento de la fibromialgia con osteopatía
(Systematic review of the treatment of fibromyalgia with osteopathy)
Giraldo Cardona, S.
Unpublished MSc thesis, 2020/05
Free full text
1642

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05
1643

The Five Diaphragms in Osteopathic Manipulative Medicine: Myofascial Relationships, Part 1
Bordoni, B.
Cureus, 2020/05
Free full text
1644

Visceral Mobilization and Functional Constipation in Stroke Survivors: A Randomized, Controlled, Double-Blind, Clinical Trial
Pasin Neto, H., Borges, R. A.
Cureus, 2020/05
Free full text
1645

Osteopathische Intervention bei Mydriasis nach Contusio bulbi
(Osteopathic Intervention for Mydriasis after Contusio bulbi)
Lehnen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1646

Der Subarachnoidalraum – ein Zwischenraum mit unterschätzter Bedeutung
(The subarachnoid space - an interspace with underestimated importance)
Muntinga, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1647

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1648

Wie erleben Cancer Survivors eine osteopathische Behandlung und wie hat diese zum allgemeinen Wohlbefinden (well-being) beigetragen? : eine qualitative Studie
(How do cancer survivors experience osteopathic treatment and how has it contributed to their overall well-being? : a qualitative study)
Meuwly, N.
Unpublished MSc thesis, 2020/04
Free full text
1649

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1650

Osteopathic manipulative treatment combined with exercise improves pain and disability in individuals with non-specific chronic neck pain: A pragmatic randomized controlled trial
Groisman, S, Malysz, T, de Souza da Silva, L., Rocha Ribeiro Sanches, T., Camargo Bragante, K., Locatelli, F., Pontel Vigolo, C., Vaccari, S., Homercher Rosa Francisco, C., Monteiro Steigleder, S., Jotz, G. P.
Journal of Bodywork and Movement Therapies, 2020/04
1651

Severe Postoperative Chronic Constipation Related to Anorectal Malformation Managed with Osteopathic Manipulative Treatment
Vismara, L., Cozzolino, V., Pradotto, L. G., Gentile, R., Tarantino, A. G.
Case Reports in Gastroenterology, 2020/04
Free full text
1652

Osteopathic Manipulative Treatment Relieves Post-concussion Symptoms in a Case of Polytrauma
Baltazar, G. A., Kolwitz, C., Petrone, P., Stright, A., Joseph, D'A.
Cureus, 2020/04
Free full text
1653

Inhibitory Tests as Assessment Tools for Somatic Dysfunctions: Mechanisms and Practical Applications
Bicalho, E., Vieira, L., Makita, D. K., Rivas, L.
Cureus, 2020/04
Free full text
1654

The Effect of High Velocity Low Amplitude Cervical Manipulations on the Musculoskeletal System: Literature Review
Giacalone, A., Febbi, M., Magnifica, F., Ruberti, E.
Cureus, 2020/04
Free full text
1655

Regular Mindful Yoga Practice as a Method to Improve Androgen Levels in Women With Polycystic Ovary Syndrome: A Randomized, Controlled Trial
Patel, V., Menezes, H., Menezes, C., Bouwer, S., Bostick-Smith, C. A., Speelman, D. L.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1656

Überaktive Blase bei Frauen - der Zusatznutzen von Osteopathie zur Standardtherapie Blasentraining
(Overactive Bladder in Women - Benefit of osteopathy in addition to standard bladder-training)
Cecon, S.
Unpublished MSc thesis, 2020/03
Free full text
1657

Perception des effets d'un traitement ostéopathique sur la qualité et la pratique du chant : une étude qualitative
(Perceived effects of osteopathic treatment on the quality and practice of singing: a qualitative study)
Christe, C.
Unpublished MSc thesis, 2020/03
Free full text
1658

Gesundheit entsteht?: Die Bedeutung der sensomotorischen und psychischen Stabilität in der Entwicklung von Gesundheit
(Does health develop?: The importance of sensorimotor and psychological stability in the development of health)
Levin, Valbona A., Levin, P.
Osteopathische Medizin, 2020/03
1659

Effect of Osteopathic Manipulative Therapy on Generalized Anxiety Disorder
Dixon, L., Fotinos, K., Sherifi, E., Lokuge, S., Fine, A., Furtado, M., Anand, L., Liberatore, K., Katzman, M. A.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1660

Osteopathic Manipulative Medicine in the Era of the Single Accreditation System: Can the Past Guide the Way to the Future of OMM?
Kanze, D.M.
The AAO Journal, 2020/03
Free full text
1661

An osteopathic approach to Graves’ ophthalmopathy: A case report
McDermott, G., Qureshi, Y., Foster-Moumoutjis, G., Espejo, A.
International Journal of Osteopathic Medicine, 2020/03
1662

Transitions: Our Own, Our Patients’, Our Profession’s
Newman, D.B.
The AAO Journal, 2020/03
Free full text
1663

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text
1664

Assessment and Management of Somatic Dysfunctions in Patients With Patellofemoral Pain Syndrome
Tramontano, M., Pagnotta, S., Lunghi, C., Manzo, C., Manzo, F., Consolo, S., Manzo, V.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1665

Effektivität osteopathischer Maßnahmen bei Dysgnathie-Patienten post operationem: Eine Pilotstudie
(Effectiveness of osteopathic measures in postoperative dysgnathia patients: A pilot study)
Rost, H., Makuch, A.
Osteopathische Medizin, 2020/03
1666

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1667

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1668

CATALYST: Piloting a Longitudinal Assessment and Learning Program for Board Recertification and Continuous Professional Development
Horber, D. T., Flamini, J., Gimpel, J. R., Tsai, T. E., Shrum, K., Hudson, K.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1669

Characteristics and Treatment of Pediatric Patients in an Osteopathic Manipulative Medicine Clinic
Kaiser, G., Degenhardt, B. F., Michael Menke, J., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1670

La prise en charge de la douleur testiculaire chronique due a un syndrome de charniere thoraco-lombaire : étude pilote
(Management of chronic testicular pain due to thoracolumbar junction syndrome: A pilot study)
Aoun, F., Malek, E., Kazan, D., Albisinni, S., Peltier, A., Bollens, R., Roumeguère, T.
Progres en urologie : journal de l'Association francaise d'urologie et de la Societe francaise d'urologie, 2020/03
1671

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1672

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text
1673

Combining psychotherapy with craniosacral therapy for severe traumatized patients: A qualitative study from an outpatient clinic in Norway
Stub, T., Kiil, M., Lie, B., Kristoffersen, A., Weiss, T., Hervik, J., Musial, F.
Complementary Therapies in Medicine, 2020/03
1674

The Intraosseous Dysfunction in the Osteopathic Perspective: Mechanisms Implicating the Bone Tissue
Bicalho, E.
Cureus, 2020/03
Free full text
1675

Nutraceutical Augmentation Strategies for Depression: A Narrative Review
Lande, R. G.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1676

Osteopathic Manipulative Medical Assistant: A Proposed Allied Profession
Lennon, J. L.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1677

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1678

Effect of manual approaches with osteopathic modality on brain correlates of interoception: an fMRI study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Perrucci, M. G., Barassi, G., Visciano, C., Bellomo, R. G., Saggini, R., Ferretti, A.
Scientific Reports, 2020/02
Free full text
1679

Osteopathic Medical Care With and Without Osteopathic Manipulative Treatment in Patients With Chronic Low Back Pain: A Pain Registry-Based Study
Licciardone, J. C., Gatchel, R. J.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1680

Evidence and recommendations for the use of segmental motion testing for patients with LBP – A systematic review
Stolz, M., von Piekartz, H., Hall, T., Schindler, A., Ballenberger, N.
Musculoskeletal Science and Practice, 2020/02
Free full text
1681

Eine systematische Übersichtsarbeit über osteopathische manuelle Therapie bei Pneumonie
(Osteopathic Manual Treatment in Pneumonia: A systematic review)
Kafader, J. C.
Unpublished MSc thesis, 2020/02
Free full text
1682

Die akute Sprunggelenksverletzung in der osteopathischen Praxis
(The acute ankle injury in osteopathic practice)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1683

Kriterien zur Qualitätsbewertung von randomisierten kontrollierten Studien (RCTs)
(Criteria for the quality assessment of randomized controlled trials (RCTs))
Sumbauer, H.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1684

U.S. Physician Recommendations to Their Patients About the Use of Complementary Health Approaches
Stussman, B. J., Nahin, R. R., Barnes, P. M., Ward, B. W.
The Journal of Alternative and Complementary Medicine, 2020/01
Free full text
1685

The architecture and spatial organization of the living human body as revealed by intratissular endoscopy – An osteopathic perspective
Armstrong, C.
Journal of Bodywork and Movement Therapies, 2020/01
Free full text
1686

The labor study: Labor length and birth outcomes osteopathic research
Martingano, D., Mitrofanova, A., Kim, A. F., Ulfers, A., Mersch, M., Stevenson, R., Singh, S.
American Journal of Obstetrics & Gynecology, 2020/01
1687

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01
1688

Tratamento manipulativo osteopático em Unidade de Terapia Intensiva Neonatal / Osteopathic manipulative treatment in a neonatal intensive care unit
(Osteopathic manipulative treatment in a neonatal intensive care unit)
dos Santos Varela, A. P. A., Yasojima, E. Y., Gonçalves, H. M. T., Silvestre, L. C., Tannus, L. O.
Brazilian Journals Publicações de Periódicos e Editora Ltda, 2020/01
1689

Impact of blinding on estimated treatment effects in randomised clinical trials: meta-epidemiological study
Moustgaard, H., Clayton, G. L., Jones, H. E., Boutron, I., Jorgensen, L., Laursen, D. R. T., Olsen, M. F., Paludan-Muller, A., Ravaud, P., Savovic, J., Sterne, J. A. C., Higgins, J. P. T., Hrobjartsson, A.
The BMJ, 2020/01
Free full text
1690

The use of complementary medicine in palliative care in France: an observational cross-sectional study
Filbet, M., Schloss, J., Maret, J.-B., Diezel, H., Palmgren, P. J., Steel, A.
Supportive care in cancer, 2020/01
1691

Preventing Premature Weaning: Management Options for Common Lactation Conditions, Including OMT
Sackett, D. R., Dajani, T., Shoup, D., Ikonne, U., Bombei, B.
Osteopathic Family Physician, 2020/01
1692

Isometric osteopathic manipulation influences on cervical ranges of motion and correlation with osteopathic palpatory diagnosis: A randomized trial
Niewiadomski, C., Bianco, R. J., Arnoux, P. J., Evin, M.
Complementary Therapies in Medicine, 2020/01
1693

Fitz-Hugh-Curtis Syndrome
Mersch, M., Martingano, D.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1694

Burnout, Perceived Stress, Sleep Quality, and Smartphone Use: A Survey of Osteopathic Medical Students
Brubaker, J. R., Beverly, E. A.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1695

Lateral Strain Patterns at the Sphenobasilar Synchondrosis
Burruano, M. P.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1696

Forschung und Osteopathie – ein Widerspruch? Ein Versuch der Auflösung am Beispiel des DO-Touch.Net
(Research and Osteopathy - a contradiction? An approach to solution using the example of DO-Touch.Net)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1697

Das cerebrospinale venöse System: Anatomie, Physiologie und Pathologie diskutiert im Kontext der Osteopathie
(The cerebrospinal venous system: anatomy, physiology and pathology in the context of osteopathy)
Flenker, J.
Unpublished MSc thesis, 2020/01
Free full text
1698

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020
1699

Global review of osteopathic medicine and osteopathy 2020
, 2020
1700

A Comparative Study of the Heart as a Fulcrum in Relation to the Central Chain and the Ancient Wisdom of the Pervuvian Healers
Friesecke, D.
Unpublished D.O. thesis, 2019/5
Free full text
1701

Who Uses Osteopathic Manipulative Treatment? A Prospective, Observational Study Conducted by DO-Touch.NET
Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2019/12
Free full text
1702

Impact of Predoctoral Teaching Fellows on Osteopathic Medical Students: A Near-Peer Teaching Program Evaluation
Akers, B., Davis, G., Keys, J., Pierce-Talsma, S. L., Lund, G.
The AAO Journal, 2019/12
Free full text
1703

Influence of postoperative adhesions after caesarean section on chronic lower back pain – A pilot study of osteopathic manipulative treatment
Liedler, M., Woisetschläger, G.
European Journal of Osteopathic Research, 2019/12
Free full text
1704

An Osteopathic Approach to Traumatically Induced Mechanical Dyspnea: A Case Report
Kanze, D. M.
The AAO Journal, 2019/12
Free full text
1705

Applying Osteopathic Manipulative Treatment to Postconcussion Syndrome: A Case Report
Yao, S. C.
The AAO Journal, 2019/12
Free full text
1706

Impact of osteopathic manipulative treatment on range of motion of the pelvis during the one-sided tilt test: a pilot study
Menard, M., Ferrari, M., Bouchet, A., Puchaud, P., Vaucher, P., Sutre, F., Bideau, B., Bourgin, M.
HAL CCSD Taylor & Francis, 2019/12
Free full text
1707

Craniosacral therapy for chronic pain: a systematic review and meta-analysis of randomized controlled trials
Haller, H., Lauche, R., Sundberg, T., Dobos, G., Cramer, H.
BMC Musculoskeletal Disorders, 2019/12
Free full text
1708

Complaint risk among mental health practitioners compared with physical health practitioners: A retrospective cohort study of complaints to health regulators in Australia
Veness, B. G., Tibble, H., Grenyer, B. F., Morris, J. M., Spittal, M. J., Nash, L., Studdert, D. M., Bismark, M. M.
BMJ Open, 2019/12
Free full text
1709

Osteopathic correction of somatic dysfunctions in preschool children with delayed speech development
(Остеопатическая коррекция соматических дисфункций у детей дошкольного возраста с задержкой речевого развития)
Abramova, E. V., Aptekar, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1710

Constipation in Parkinson’s Disease Improved by an Osteopathic Manipulative Medicine Sequence in a Repeated Measures Study
Valasareddi, S., Mathai, M., Li, T. S., Yao, S. C., Mancini, J.
The Journal of the American Osteopathic Association, 2019/12
1711

Justification of the use of osteopathic correction in the complex rehabilitation of patients with consolidated fractures of the large tubercle of the humerus
(Обоснование применения остеопатической коррекции в комплексной реабилитации больных с консолидированными переломами большого бугорка плечевой кости)
Bogachev, A. A., Kutuzov, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1712

The role of generalized muscule hyperfacilitation in pathogenesis and clinical picture of myofascial pain syndrome. Possible option of its correction
(Роль генерализованной мышечной гиперфасилитации в патогенезе и клинической картине миофасциального болевого синдрома. Возможный вариант её коррекции)
Boldin, A. V., Agasarov, L. G., Tardov, M. V., Bokova, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1713

Possibilities of osteopathic correction of somatic dysfunctions in children with chronic adenoiditis
(Возможности остеопатической коррекции соматических дисфункций у детей с хроническим аденоидитом)
Chaiko, E. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2019/12
Free full text
1714

Correlation between certain rhythms of the body in osteopathic patients
(Корреляционные связи между некоторыми ритмами организма у пациентов врача-остеопата)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/12
Free full text
1715

Efeitos da manipulação osteopática em trabalhadores feirantes com dor lombar crônica inespecífica: ensaio clínico randomizado
(Effects of osteopathic manipulation in fairground workers with chronic nonspecific low back pain: randomized clinical trial)
Estrázulas, J. A.
Unpublished MSc thesis, 2019/12
Free full text
1716

Secondary effects and quality of life with chemotherapy: assessing the impact of an osteopathic treatment (multicentric randomized clinical trial
(Побочные эффекты и качество жизни пациентов при химиотерапии: оценка влияния остеопатической коррекции (многоцентровое рандомизированное клиническое исследование)
Favier, N., Guinet, A. G., Nageleisen, M., Ceccaldi, B., Pujade-Lauraine, E., LeFoll, C., Soudain-Pineau, M., Turlin, C., Stubbe, L.
Russian Osteopathic Journal, 2019/12
Free full text
1717

Segmental innervation: a graphic synthesis of correspondence between dermatomes, myotomes, sclerotomes and viscerotomes. Systematic review of existing works and publications about dermatomes, myotomes, sclerotomes and viscerotomes aimed to design a graphic synthesis of somato-visceral correspondences
(Сегментарная иннервация: графический синтез соответствий между дерматомами, миотомами, склеротомами и висцеротомами. Систематический обзор научных работ и публикаций о дерматомах, миотомах, склеротомах и висцеротомах для разработки графического синтеза соматовисцеральных соответствий)
Gadet, P.
Russian Osteopathic Journal, 2019/12
Free full text
1718

Possibilities of using osteopathic correction in treatment of combined forms of infertility
(Возможности применения остеопатической коррекции в лечении сочетанной формы бесплодия)
Nenashkina, E. N.
Russian Osteopathic Journal, 2019/12
Free full text
1719

Osteopathy In The Cranial Field As A Method To Enhance Injury Recovery: A Preliminary Study
Brolinson, P. G., Hyppolite, N. A., Dickerson, M. R., Murphy, S. F., VandeVord, P. J.
The Journal of the American Osteopathic Association, 2019/12
1720

Developing “Migraneous” Rat Models to Evaluate the Efficacy of OMT on Various Migraine Biomarkers
Byrd, K. E., Gregory, C., Krishna, S., Xie, J. Y., Fleming, R. K.
The Journal of the American Osteopathic Association, 2019/12
1721

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12
1722

Epidemiological and clinical aspects of chronic pyelonephritis in pregnant women and osteopathic follow-up of pregnant women with chronic pyelonephritis
(Эпидемиологические и клинические аспекты хронического пиелонефрита у беременных и остеопатическое сопровождение беременных, страдающих хроническим пиелонефритом)
Nenashkina, E. N., Tregubova, E. S., Belash, V. O.
Russian Osteopathic Journal, 2019/12
Free full text
1723

Osteopathic Manipulative Medicine Vs Counseling in the Treatment of Sports-Related Concussion: Comparative Balance Assessment
Morris, J. Z., Shah, J., Zwibel, H., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12
1724

Tension-type headache in patients with concomitant musculoskeletal disorders
(Головная боль напряжения у пациентов с сопутствующей скелетно-мышечной патологией)
Novikov, Y. O., Salakhov, I. E.
Russian Osteopathic Journal, 2019/12
Free full text
1725

The Effect of OMM on Opioid Users with Chronic Low Back Pain
Patel, K. C., Cooley, D. L., Bailey, J. W., Janora, D. M., Fusco, C.
The Journal of the American Osteopathic Association, 2019/12
1726

The Efficacy of Osteopathic Manipulative Treatment on Decreasing the Severity of Migraine Headaches
Rhoads, A., Metzgar, M. M., Donovan, P.
The Journal of the American Osteopathic Association, 2019/12
1727

Clinical efficacy of osteopathic correction in the complex treatment of patients with unoperated open-angle glaucoma
(Клиническая эффективность остеопатической коррекции в комплексном лечении больных с неоперированной открытоугольной глаукомой)
Simakova, E. N., Stenkova, O. V.
Russian Osteopathic Journal, 2019/12
Free full text
1728

Osteopathic support of sportsmen during the annual training process
(Остеопатическое сопровождение спортсменов в годовом тренировочном процессе)
Yakupov, R. A., Safiullina, G. I., Safiullina, A. A., Burganov, E. R.
Russian Osteopathic Journal, 2019/12
Free full text
1729

Myofascial Release for Vulvar Pain and Pubic Shear After a Straddle Injury in a 3-Year-Old Girl
Dade, M. M., Broecker, J. D.
The Journal of the American Osteopathic Association, 2019/11
Free full text
1730

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text
1731

The Role of Mental Imagery in Osteopathic Palpation: a qualitative study
Kraml, M. M., Besse, J.P.
European Journal of Osteopathic Research, 2019/11
Free full text
1732

Effect of Osteopathic Cranial Manipulative Medicine on an Aged Rat Model of Alzheimer Disease
Tobey, H., Lucas, T., Bledsoe, D., Mykins, M., Campbell, C., Berr, S. S., Sasser, T., Helm, R., Brolinson, P. G., Klein, B. G., Costa, B. M.
The Journal of the American Osteopathic Association, 2019/11
Free full text
1733

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11
1734

Osteopathic manipulative medicine to improve balance and quality of life in parkinson disease
Yao, S., Docherty, J., Mancini, J., Leder, A., DiFrancisco-Donoghue, J.
Movement Disorders, 2019/11
1735

The Effect of Osteopathic Manual Treatment on Concussion Injury Rehabilitation
Henderson, L. D.
Unpublished MSc thesis, 2019/11
Free full text
1736

The Benefits and Limitations of Evidence-based Practice in Osteopathy
Bordoni, B.
Cureus, 2019/11
Free full text
1737

Einfluss von Osteopathie auf die gesundheitsbezogene Lebensqualität von Frauen nach Sectio caesarea
(Influence of osteopathy on the health-related quality of life of women after caesarean section)
Rehak, M.
Unpublished MSc thesis, 2019/10
1738

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1739

Die Anwendung osteopathischer Techniken zur Behandlung bei chronisch obstruktiver Lungenerkrankung (COPD)
(The use of osteopathic techniques in the management of the chronic obstructive pulmonary disease (COPD))
Lebersorger, P.
Unpublished MSc thesis, 2019/10
Free full text
1740

Herzratenvariabilitätsanalyse in der Osteopathie und Manualmedizin
(Heart rate variability in manual medicine)
Klumpp, M.
Unpublished MSc thesis, 2019/10
Free full text
1741

Osteopathie zur Behandlung von Schlafstörungen bei Kindern: Eine klinische Studie mit Drei- bis Sechsjährigen
(Osteopathy for the Treatment of Sleep Disturbances of Children: A Clinical Study Among 3-6 Year Olds)
Ellersdorfer, A.
Unpublished MSc thesis, 2019/10
Free full text
1742

Effectiveness of an osteopathic treatment on the autonomic nervous system: a systematic review of the literature
Rechberger, V., Biberschick, M., Porthun, J.
European Journal of Medical Research, 2019/10
Free full text
1743

Einfluss einer osteopathischen Behandlung der vier Diaphragmen des Rumpfes nach Zink auf die Bewegungen des Center of pressure von Personen mit Rückenbeschwerden
(The impact of an osteopathic treatment of the four diaphragms after Zink on the movement of the center of pressure of individuals with back pain)
Arztmann, A.
Unpublished MSc thesis, 2019/10
Free full text
1744

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10
1745

A comprehensive physical therapy evaluation for Male Chronic Pelvic Pain Syndrome: A case series exploring common findings
Archambault-Ezenwa, L., Markowski, A., Barral, J-P.
Journal of Bodywork and Movement Therapies, 2019/10
1746

Understanding the role of osteopathic manipulative medicine in the management of gastrointestinal disorders and symptoms: a survey study
Shah, R. N., Diehl, D. L., Graham, J., Kim, A. H., Loughlin, M. T.
The American Journal of Gastroenterology, 2019/10
Free full text
1747

Effects of Osteopathic Visceral Treatment in Patients with Gastroesophageal Reflux: A Randomized Controlled Trial
Eguaras, N., Rodriguez-Lopez, E. S., Lopez-Dicastillo, O., Franco-Sierra, M. A., Ricard, F., Oliva-Pascual-Vaca, A.
Journal of Clinical Medicine, 2019/10
1748

Osteopathie bei Spondylitis ankylosans (Morbus Bechterew)
(Osteopathy in ankylosing spondylitis (Bechterew's disease))
Gugganig, K.
Unpublished MSc thesis, 2019/10
Free full text
1749

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10
1750

Einfluss der osteopathischen Behandlung im Rahmen der stationären Anschlussheilbehandlung bei Patienten mit Zustand nach Hüft-TEP-Implantation. Randomisierte kontrollierte Studie.
(Influence of osteopathic treatment during post-hospital curative treatment in patients after total hip arthroplasty. A randomized controlled trial)
Behm, B., Mattern, E. R.
Unpublished D.O. thesis, 2019/10
1751

Wechselbeziehung von Mittelohrpathologien und Mobilität des Os temporale bei Säuglingen mit Lippen-Kiefer-Gaumenspalten - ein Pilotprojekt
(Middle Ear Pathologies and the Mobility of the Temporal Bone in Children with Cleft Lip and Palate - A Pilot Study)
Wedenig, K.
Unpublished MSc thesis, 2019/10
1752

Können osteopathische Behandlungen Einfluss auf die Intensität und Dauer der Schmerzen bei Frauen mit primärer Dysmenorrhoe nehmen? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with primary dysmenorrhea. A randomized controlled trial)
Plathner, M., Wolf, L.
Unpublished D.O. thesis, 2019/10
1753

Osteopathic Manipulative Treatment for Allostatic Load Lowering
Nuno, V., Siu, A., Deol, N., Juster, R. P.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1754

Einfluss osteopathischer Behandlung der Fascia thoracolumbalis bei chronisch unspezifischen Rückenschmerzen
(The influence of osteopathic treatment on the thoracolumbar fascia in case of chronic non-specific low back pain)
Putz, F.
Unpublished MSc thesis, 2019/10
Free full text
1755

Does Compression of the Fourth Ventricle Cause Preterm Labor? Analysis of Data From the PROMOTE Study
Hensel, K. L., Roane, B. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1756

Rezidivierende Harnwegsinfekte und Reizblase
(Recurrent urinary tract infections and irritable bladder)
Kilian-von Hofe, K.
Osteopathische Medizin, 2019/09
1757

Effektivität einer osteopathischen Therapie auf das autonome Nervensystem: Eine systematische Übersichtsarbeit
(Effectiveness of an osteopathic treatment on the autonomic nervous system A systematic review of the literature)
Rechberger, V.
Unpublished MSc thesis, 2019/09
Free full text
1758

Das Restless-Legs-Syndrom und die Nierenregion - Können osteopathische Behandlungen die Symptome verbessern?
(The Restless Legs Syndrome and Kidney Region - Can Osteopathic Treatment Influence the Symptoms?)
Lotz, S.
Unpublished MSc thesis, 2019/09
Free full text
1759

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text
1760

Osteopathic Approach for Lateral Knee Pain Caused by Iliotibial Band Friction Syndrome: A Case Report
Kostanjevec, J., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
1761

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy in somatoform disorders - Systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
Free full text
1762

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1763

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1764

Effektivität der osteopathischen Behandlung eines Maldescensus testis bei Kindern im Alter von neun Monaten bis sechs Jahren
(Effectiveness of the osteopathic treatment of maldescensus testis in children from 9 months to 6 years of age)
Roch, U.
Unpublished MSc thesis, 2019/09
Free full text
1765

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
1766

Entwicklung der unteren Extremität beim Kind aus osteopathischer Sicht
(Development of the lower extremity in the child from an osteopathic point of view)
Möckel, E.
Osteopathische Medizin, 2019/09
1767

Integrating Osteopathic Evaluation and Treatment in a Case Report of Acute Chest Pain
Yao, S. C.
The AAO Journal, 2019/09
Free full text
1768

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09
1769

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09
1770

Temporomandibuläre Dysfunktion (TMD) mit Diskusprolaps
(Temporomandibular dysfunction (TMD) with discus prolapse: Case study on the efficacy of osteopathic treatment)
Vathrakokoilis, K., Liem, T., Aetopoulos, I., Antoniadis, K., Triantafyllidou, E.
Osteopathische Medizin, 2019/09
1771

Osteopathic Manipulation Treatment Improves Cerebro-splanchnic Oximetry in Late Preterm Infants
Marinelli, B., Pluchinotta, F., Cozzolino, V., Barlafante, G., Strozzi, M. C., Marinelli, E., Franchini, S., Gazzolo, D.
Molecules, 2019/09
Free full text
1772

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text
1773

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text
1774

A Literature Review of Osteopathic Manipulative Techniques for Otalgia
Lindsey, T., Lawson, R., Hiffernan, F.
Osteopathic Family Physician, 2019/09
1775

Beschleunigungstrauma der Halswirbelsäule
(Whiplash injury in the cervical spine)
Belz, S., Baum, N.
Osteopathische Medizin, 2019/09
1776

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy for somatoform disorders - a systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1777

Ergojump evaluation of the explosive strength in volleyball athletes pre- and post-fascial treatment
Buscemi, A., Petralia, M. C., Ramaci, T., Rapisarda, A., Provazza, C., Di Corrado, D., Perciavalle, V., Perciavalle, V., Coco, M.
Experimental and Therapeutic Medicine, 2019/08
Free full text
1778

Efficacy of osteopathic treatment in patients with stable moderate-to-severe chronic obstructive pulmonary disease: a randomized controlled pilot study
Buscemi, A., Pennisi, V., Rapisarda, A., Pennisi, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2019/08
1779

Muscle energy technique for chronic obstructive pulmonary disease: a systematic review
Baxter, D. A., Shergis, J. L., Fazalbhoy, A., Coyle, M. E.
Chiropractic & Manual Therapies, 2019/08
1780

Empathy in Medicine Osteopathic and Allopathic Physician Interpersonal Manner, Empathy, and Communication Style and Clinical Status of Their Patients: A Pain Registry-Based Study
Licciardone, J. C., Schmitt, M. E., Aryal, S.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1781

Assessment of shoulder pain and somatic dysfunction in young competitive swimmers: Preventive Osteopathic Manipulative Treatment
Granger, F., Etevenard, M., Kily, J. P., Garet, M.
Journal of Sports Medicine and Therapy, 2019/08
Free full text
1782

Osteopathic Manipulative Therapy in Patients With Chronic Tension-Type Headache: A Pilot Study
Deodato, M., Guolo, F., Monticco, A., Fornari, M., Manganotti, P., Granato, A.
The Journal of the American Osteopathic Association, 2019/08
1783

Stretch Receptor and Somatic Dysfunction: A Narrative Review
Andrews, M. A. W.
The Journal of the American Osteopathic Association, 2019/08
1784

Revisión sistemática de la terapia osteopática en el tratamiento del Síndrome del túnel del carpo
(Efficacy of osteopathic therapy in the management of carpal tunnel syndrome)
Mesa Palacio, A. M.
Unpublished MSc thesis, 2019/08
Free full text
1785

Effects of Post-Isometric Relaxation on Ankle Plantarflexion and Timed Flutter Kick in Pediatric Competitive Swimmers
Noto-Bell, L., Vogel, B. N., Senn, D. E.
The Journal of the American Osteopathic Association, 2019/08
1786

Understanding Myalgic Encephalomyelitis/Chronic Fatigue Syndrome and the Emerging Osteopathic Approach: A Narrative Review
Larrimore, C., Ramnot, A., Jaghab, A., Sarduy, S., Guerrero, G., Troccoli, P., Hilton, K., Bested, A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1787

OMT for the Prevention and Management of Chronic Constipation and Distal Intestinal Obstructive Syndrome in Cystic Fibrosis: A Pilot Study
Modlin, S. E., Borofka, K., Franzini, D., Klene-Bowns, A. C., Nuño, V. A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1788

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1789

Rücken- und Beckenschmerzen bei Schwangeren und nach der Geburt – eine Metaanalyse
(Back and pelvic pain in pregnant women and after childbirth - a meta-analysis)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
1790

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
1791

Differences in Function and Comorbidities Between Older Adult Users and Nonusers of Chiropractic and Osteopathic Manipulation: A Cross-sectional Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2019/07
1792

The influence of osteopathic correction on the restoration of the functions of the ankle joint with partial damage of its ligaments
(Влияние остеопатической коррекции на восстановление функций голеностопного сустава при частичном повреждении его связок)
Alekseev, V. N., Naumenko, E. Y.
Russian Osteopathic Journal, 2019/07
1793

Results of osteopathic correction of patients with post-traumatic coccygodynia
(Результаты остеопатической коррекции у пациентов с посттравматической кокцигодинией)
Antonova, Y. V., Iskandarov, A. M., Mizonova, I. B.
Russian Osteopathic Journal, 2019/07
1794

La lumbalgia: La visión desde la osteopatía y medicina tradicional del Palenque San Basilio
(Low back pain: The vision of osteopathy and traditional medicine of Palenque San Basilio)
Ayala Ardila, D. P.
Unpublished MSc thesis, 2019/07
Free full text
1795

Сhange in the functional activity of fibroblasts in the process of modelling of compression, hypercapnia and hypoxia
(Изменение функциональной активности фибробластов в процессе моделирования компрессии, гиперкапнии и гипоксии)
Aptekar, A. I., Kostolomova, E. G., Sukhovey, Y. G.
Russian Osteopathic Journal, 2019/07
1796

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text
1797

The influence of osteopathic correction on the rate of various rhythms of the body
(Влияние остеопатической коррекции на частоту различных ритмов организма)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
1798

The effectiveness of additional treatment methods for post-stroke periarthropathy of the shoulder joint
(Эффективность дополнительных методов лечения постинсультной периартропатии плечевого сустава)
Kozlova, N. S., Amelin, A. V.
Russian Osteopathic Journal, 2019/07
1799

Possibilities of osteopathic correction in complex therapy of temporomandibular joint dysfunction
(Возможности остеопатической коррекции в комплексной терапии дисфункции височно-нижнечелюстного сустава)
Milutka, Y. A., Yushmanov, I. G., Badmaeva, A. N.
Russian Osteopathic Journal, 2019/07
1800

Randomized controlled study of the effectiveness of osteopathic manipulative correction for muscular torticollis due to birth injury
(Рандоминизированное контролируемое исследование эффективности остеопатической манипуляционной коррекции при мышечной кривошее вследствие родовой травмы)
Novikov, Y. O., Mokhov, D. E., Amigues, J.P., Musina, G. M., Shaiakhmetov, A. R.
Russian Osteopathic Journal, 2019/07
1801

Change of skin electrical activity during osteopathic correction with the use of biodynamical approach
(Изменение электрической активности кожи во время остеопатического воздействия с применением биодинамического подхода)
Novikov, Y. O., Shaiakhmetov, A. R., Musina, G. M.
Russian Osteopathic Journal, 2019/07
1802

Osteopathic correction in complex treatment of carpal tunnel syndrome with complicated closed forearm fractures
(Остеопатическая коррекция в комплексном лечении синдрома карпального канала при закрытых осложненных переломах предплечья)
Sebaykin, Y. V., Mokhov, D. E., Tarusova, K. S., Nechoroshev, S. N.
Russian Osteopathic Journal, 2019/07
1803

The influence of osteopathic correction on the viscoelastic characteristics of the lower leg muscles
(Влияние остеопатической коррекции на вязкоупругие характеристики мышц голени)
Timanin, E. M., Sydneva, N. S., Zakharova, A. A.
Russian Osteopathic Journal, 2019/07
1804

Specific Adjusting Technique
(Specific Adjusting Technique)
Lamb, Gez, Schabel, Kai
Osteopathische Medizin, 2019/06
1805

Effect of Osteopathic Obstetrical Management on the Duration of Labor in the Inpatient Setting: A Prospective Study and Literature Review
Martingano, D., Ho, S., Rogoff, S., Chang, G., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1806

The Combined Shoulder Technique: A Novel Approach in the Treatment of Scapular Dysfunction—A Case Report
Kanze, D. M.
The AAO Journal, 2019/06
Free full text
1807

Pilot randomized single-blind clinical trial, craniosacral therapy vs control on physiological reaction to math task in male athletes
Wójcik, M., Dziembowska, I., Izdebski, P., Żekanowska, E.
International Journal of Osteopathic Medicine, 2019/06
1808

Osteopathische Behandlung bei Pertussis im 19. und 20. Jahrhundert
Osteopathic treatment of pertussis in the 19th and 20th centuries: A structured historical literature review
Liem, T.
Osteopathische Medizin, 2019/06
1809

Restoring Full Squat Range of Motion by Applying OMT to Superior Innominate Shear: A Case Report
Lewis, D. D., Pickos, J.
The AAO Journal, 2019/06
Free full text
1810

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06
1811

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06
1812

Integrated pilot medical study on 40 patients affected by open angle glaucoma undergoing topical therapy with additional osteopathic manipulation
Paoli, D., Brusini, P., Michelin, L., Vassallo, F., Ciullo, L., Torelli, L.
Acta Ophthalmologica, 2019/06
1813

A Study to Investigate the Effect of ‘Frontal Lift’ Osteopathic Manipulative Technique (OMT) in Patients with Chronic Sinusitis
Lintonbon, David
American Journal of Biomedical Science & Research, 2019/06
1814

Do empathic osteopaths achieve better clinical results? An observational feasibility study
Acquati, A., Uberti, S., Aquino, A., Cerasetti, E., Castagna, C., Rovere-Querini, P., Pisa, V.
International Journal of Osteopathic Medicine, 2019/06
1815

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1816

¿La Manipulación Osteopática Mejora la Función Mecánica y Física y la Simetría Espinal en Golfistas?
(Does Osteopathic Manipulation Lead to Improvements in Physical and Muscle Mechanical Function and Spinal Symmetries in Golfers?)
Rojas-Valverde, D., Sánchez García, A., Sáez Ulloa, D., Gutiérrez-Vargas, R.
Kronos, 2019/06
Free full text
1817

Spinal manual therapy in infants, children and adolescents: A systematic review and meta-analysis on treatment indication, technique and outcomes
Driehuis, F., Hoogeboom, T. J., Nijhuis-van der Sanden, M. W. G., de Bie, R. A., Staal, J. B.
PLoS One, 2019/06
1818

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06
1819

Étude randomisée monocentrique évaluant l’efficacité de l’ostéopathie dans la prise en charge des douleurs chroniques après chirurgie mammaire en oncologie
(Osteopathy for chronic pain after breast cancer surgery: a monocentric randomised study)
Chvetzoff, G., Berthier, A., Blanc, E., Bourne Branchu, V., Millaret, A., Cropet, C., Pérol, D.
Bulletin du Cancer, 2019/06
1820

Patient experience, satisfaction, perception and expectation of osteopathic manipulative treatment: A systematic review
Lam, M. T., Banihashem, M., Lam, H. R., Wan, A. B., Chow, E.
International Journal of Osteopathic Medicine, 2019/06
1821

The role of osteopathic complementary treatment in high frequency paediatric headache: a randomised controlled study
Rossi, R., Versace, A., Lauria, B., Grasso, G., Bagagiolo, D., Cappitella, E., Altieri, R., Delli Santi, M., Scarinzi, C., Urbino, A. F.
Neurological Sciences, 2019/06
1822

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1823

The New Zealand Osteopathic Profession’s Understanding of Continuing Professional Development
Fairs, E. J.
Unpublished MSc thesis, 2019/06
Free full text
1824

A systematic review of non-invasive manual therapies in the management of irritable bowel syndrome
Badenhorst, N.
Unpublished MSc thesis, 2019/06
1825

OSLO – Effets d’un traitement ostéopathique manuel sur la lombalgie non spécifique aiguë dans un service d’accueil des urgences : un protocole d’essai randomisé contrôlé monocentrique
(OSLO – Effects of osteopathic manipulative therapy for acute nonspecific low back pain in emergency room: design of a randomised monocentric controlled trial)
Ginier-Gillet, M.
Unpublished MSc thesis, 2019/06
1826

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06
1827

Osteopathic Approach to the Treatment of a Patient With an Atypical Presentation of Coccydynia
Alexandre, K., Channell, M. K.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1828

Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Levy, V. J., Holt, C. T., Haskins, A. E.
The Journal of the American Osteopathic Association, 2019/05
Free full text
1829

Einfluss von Osteopathie auf die Symptomatik, Häufigkeit und die Medikamenteneinnahme von PatientInnen mit episodisch-häufigem Spannungskopfschmerz
(Impact of Osteopathic Treatment on Frequent Tension-type Headache)
Huemer, D.
Unpublished MSc thesis, 2019/05
Free full text
1830

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text
1831

Cynefin Framework for Evidence-Informed Clinical Reasoning and Decision-Making
Lunghi, C., Baroni, F.
The Journal of the American Osteopathic Association, 2019/05
Free full text
1832

Desenvolvimento de técnicas manipulativas osteopáticas para tratamento da síndrome do impacto do ombro baseado na biomecânica
(Development of osteopathic manipulative technique for impingement syndrome of shoulder treatment based on the biomechanics)
Louro, S. M.
Unpublished MSc thesis, 2019/05
Free full text
1833

Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative pilot study of osteopathy and electrostimulation /biofeedback for pelvic floor
Bogner, D.
European Journal of Osteopathic Research, 2019/04
Free full text
1834

Role of Debt and Loan Forgiveness/Repayment Programs in Osteopathic Medical Graduates' Plans to Enter Primary Care
Scheckel, C. J., Richards, J., Newman, J. R., Kunz, M., Fangman, B., Mi, L., Poole, K. G.
The Journal of the American Osteopathic Association, 2019/04
Free full text
1835

Manual therapy for musculoskeletal pain in cystic fibrosis: Review of the literature
Graziano, L., Giordani, B., Nico, D., Colella, E., Savi, D., Cimino, G., Di Vito, A., Valente, D., Palange, P.
Italian Journal of Pediatrics, 2019/04
1836

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text
1837

Osteopathic Manipulative Treatment in a Paediatric Patient with Oesophageal Atresia and Tracheo-Oesophageal Fistula
Barni, A., Zecchillo, D., Uberti, S., Ratti, S.
Gastroenterology, 2019/04
1838

Osteopathic manipulative treatment in pudendal neuralgia: A case report
Origo, D., Tarantino, A. G.
Journal of Bodywork and Movement Therapies, 2019/04
1839

Effect of soft tissue mobilization techniques on adhesion-related pain and function in the abdomen: A systematic review
Wasserman, J. B., Copeland, M., Upp, M., Abraham, K.
Journal of Bodywork and Movement Therapies, 2019/04
1840

Analyse comparative entre la thérapie manuelle orthopédique et l'ostéopathie une mise au point sur la situation en Belgique
(Comparative analysis between orthopaedic manual therapy and osteopathy: Focus on the Belgian situation)
Hidalgo, B., Demoulin, C.
Revue Medicale de Liege, 2019/04
Free full text
1841

Manipulasjonsteknikker ved nakkeasymmetri hos spedbarn
(Manipulation techniques for infant torticollis)
Brurberg, K. G., Dahm, K. T., Kirkehei, I.
Tidsskrift for den Norske Laegeforening, 2019/04
Free full text
1842

Allopathic supervision of osteopathic education: What support is needed?
James, S. J., Zakletskaia, L:
Osteopathic Family Physician, 2019/04
1843

Complementary and alternative medicine research in practice-based research networks: A critical review
Lee, H., Peng, W., Steel, A., Reid, R., Sibbritt, D., Adams, J.
Complementary Therapies in Medicine, 2019/04
1844

Effects of osteopathic manipulative treatment on patients with multiple sclerosis: A pilot study
Porcari, B., Russo, M., Naro, A., La Via, C., Pullia, M., Accorinti, M., De Luca, R., Calabro, R. S.
Complementary Therapies in Medicine, 2019/04
1845

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04
1846

Osteopathic Manipulative Treatment as a Novel Way to Manage Postvasectomy Pain Syndrome
Gray, R. E., Kasper, K.
The Journal of the American Osteopathic Association, 2019/04
Free full text
1847

Patient satisfaction and perception of treatment in a student-led osteopathy teaching clinic: Evaluating questionnaire dimensionality and internal structure, and outcomes
Vaughan, B., Burns, C., Burridge, L., Wigger, J., Blair, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2019/03
1848

Osteopathic Structural Findings in Women During Menstruation
Cabrera, K. L., Darwish, A. M., Lurz, K. L., L., McClain. R., McClain, E., Cox, J., Segars, L.
The AAO Journal, 2019/03
Free full text
1849

Un audit clinique ostéopathique visant à décrire les procédures d’examen, de diagnostic, de traitement et de consentement chez des patientes présentant des douleurs pelviennes chroniques : projet de recherche
(An osteopathic clinical audit to describe examination, diagnosis, treatment and consent procedures in patients with chronic pelvic pain: a research project)
Cettou, N.
Unpublished MSc thesis, 2019/03
Free full text
1850

Ernährungswissen von Osteopathinnen und Osteopathen
(Knowledge of Nutrition Issues among Osteopaths)
Putschögl, J.
Unpublished MSc thesis, 2019/03
Free full text
1851

Die Rolle der mentalen Vorstellung in der Palpation von Osteopathen
(The role of mental imagery in osteopathic palpation)
Kraml, M.
Unpublished MSc thesis, 2019/03
Free full text
1852

Rescued Root Canal: A Case Report on OMT for Jaw Pain Following Repeat Root Canal Procedure
Fong, K. F., Rummel, T. B.
The AAO Journal, 2019/03
Free full text
1853

Effektivität von Osteopathie bei Patientinnen mit lumbalen Rückenschmerzen und/oder Beckengürtelschmerzen in der Schwangerschaft und Post Partum - systematic review
(The effectiveness of osteopathy for low back pain and pelvic girdle pain during and after pregnancy - a systematic review)
König, M.
Unpublished MSc thesis, 2019/03
Free full text
1854

Der Effekt von osteopathischen Behandlungen auf das Tagesprofil des Speichelcortisols
(The effect of osteopathic treatments on the diurnal profile of salivary cortisol)
Hämmerli, U.
Unpublished MSc thesis, 2019/03
Free full text
1855

Exploration des méthodes d’identification et des stratégies de gestion du stress et de l’anxiété des patients par l’ostéopathe : étude qualitative
(Exploring methods of identification and strategies for management of patient stress and anxiety by the osteopath: a qualitative study)
Piaget, B.
Unpublished MSc thesis, 2019/03
Free full text
1856

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text
1857

Dans quelle mesure la prise en charge ostéopathique des gonalgies chez les adolescents et les adultes est en concordance avec les bonnes pratiques ? : un sondage
(To what extent is osteopathic management of gonalgia in adolescents and adults in line with good practice? A survey)
Rossier, F.
Unpublished MSc thesis, 2019/03
Free full text
1858

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text
1859

Osteopathie bei Bone Bruise
(Osteopathy for bone bruise)
Bick, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
1860

Mechanischer Risikofaktor für Otitis media?
(Mechanical risk factor in otitis media?)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
Free full text
1861

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
1862

Biodynamische Osteopathie – Life
(Biodynamic osteopathy - life: A before - an afterwards - between them a stillpoint)
Schöndorfer, S.
Osteopathische Medizin, 2019/03
1863

Die Kinderosteopathie aus Sicht der Kinderärzte. Eine qualitative Interview-Studie
(Pediatric osteopathy: What registered pediatricians think about it - A qualitative interview study)
Seidner, K., Belz, S.
Osteopathische Medizin, 2019/03
1864

Manual therapy for the pediatric population: a systematic review
Parnell Prevost, C., Gleberzon, B., Carleo, B., Anderson, K., Cark, M., Pohlman, K. A.
BMC Complementary and Alternative Medicine, 2019/03
Free full text
1865

Klinische und osteopathische Bedeutung der beidseitigen Blutdruckmessung. Nützlich bei “Thoracic outlet Syndrome“?
(Clinical and osteopathic significance of bilateral blood pressure measurement. Useful with “Thoracic outlet syndrome“?)
Stattin, E.
Unpublished MSc thesis, 2019/03
Free full text
1866

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text
1867

Dancers’ experience of osteopathy and their attitudes towards dance injuries
Maddren, K.
Unpublished MSc thesis, 2019/03
Free full text
1868

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text
1869

Does somatic dysfunction lead to lower extremity injuries in the high school soccer player?
Wisinski, J., Lipp, T., Dougherty, J. J.
Clinical Journal of Sport Medicine, 2019/03
1870

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03
1871

Short-term effectiveness of the flexion-distraction technique in comparison with high-velocity vertebral manipulation in patients suffering from low-back pain
Carrasco-Martínez, F., Ibáñez-Vera, A. J., Martínez-Amat, A., Hita-Contreras, F., Lomas-Vega, R.
Complementary Therapies in Medicine, 2019/03
1872

Effects of Practicing Osteopathic Manipulative Treatment (OMT) on Hand Function
Barnum, I. F. O., Chang, M. E., Patterson, R. M., Surve, S.
UNTHSC Scholarly Repository, 2019/03
1873

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text
1874

Just Say Know to Drugs! A High School Pharmacology Enrichment Program for a Rural Population
Hamrick, L. A., Harter, S. R., Fox, C. L., Dhir, M., Carrier, R. L.
The Journal of the American Osteopathic Association, 2019/02
Free full text
1875

Osteopathic Manipulative Treatment: A Primary Care Approach
Bodine, W. A.
American Family Physician, 2019/02
1876

Manipulative Therapies: What Works
Smith, M. S., Olives, J., Smith, K.
American Family Physician, 2019/02
Free full text
1877

Assessment of the Efficacy of An Osteopathic Treatment in Infants with Biomechanical Impairments to Suckling
Herzhaft-LeRoy, J., Xhignesse, M., Gaboury, I.
Journal of Visualized Experiments, 2019/02
1878

Osteopathic Manipulative Treatment for Pertussis in the 19th and 20th Centuries: A Structured Historical Literature Review
Liem, T.
The Journal of the American Osteopathic Association, 2019/02
Free full text
1879

The sacro-iliac joint: A potentially painful enigma. Update on the diagnosis and treatment of pain from micro-trauma
Le Huec, J. C., Tsoupras, A., Leglise, A., Heraudet, P., Celarier, G., Sturresson, B.
Orthopaedics & Traumatology: Surgery & Research, 2019/02
1880

Long-term outcomes after primary anterior cruciate ligament reconstruction when comparing three surgical techniques
Bauer, F.
Unpublished MSc thesis, 2019/02
Free full text
1881

Evaluating Patient's Understanding of Pain Neurophysiology: Rasch Analysis of the Neurophysiology of Pain Questionnaire
Vaughan, B., Mulcahy, J., Fitzgerald, K., Austin, P.
The Clinical Journal of Pain, 2019/02
1882

Making sense of cranial osteopathy : an interpretative phenomenological analysis.
Banton, A
Unpublished PhD thesis, 2019/02
1883

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1884

Correlation Between Physiologic and Osteopathic Measures of Sympathetic Activity in Women With Polycystic Ovary Syndrome
Davis, S. E., Hendryx, J., Bouwer, S., Menezes, C., Menezes, H., Patel, V., Speelman, D. L.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1885

Osteopathische Behandlung bei akut traumatischen Zuständen: die Kraft der Flüssigkeiten
(Osteopathic treatment for acute traumatic conditions: the power of fluids)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
1886

Nonpharmacologic Management of Symptoms in Females With Polycystic Ovary Syndrome: A Narrative Review
Speelman, D. L.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1887

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1888

The Italian Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross sectional survey
Cerritelli, F., van Dun, P. L. S., Esteves, J. E., Consorti, G., Sciomachen, P., Lacorte, E., Vanacore, N.
PLoS One, 2019/01
Free full text
1889

Ultrasound Evaluation of Diaphragmatic Mobility and Contractility After Osteopathic Manipulative Techniques in Healthy Volunteers: A Prospective, Randomized, Double-Blinded Clinical Trial
Mancini, D., Cesari, M., Lunghi, C., Benigni, A. M., Antonelli Incalzi, R., Scarlata, S.
Journal of Manipulative and Physiological Therapeutics, 2019/01
1890

Women’s experiences of osteopathic care whilst living with endometriosis
Waugh, M. D.
Unpublished MSc thesis, 2019/01
Free full text
1891

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01
1892

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1893

Der suprachiasmatische Nukleus und seine klinische Bedeutung
(The suprachiasmatic nucleus and its clinical significance)
Liem, T., Havel, M.
Osteopathische Medizin, 2018/12
1894

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12
1895

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text
1896

Exodus From the Classroom: Student Perceptions, Lecture Capture Technology, and the Inception of On-Demand Preclinical Medical Education
Ikonne, U., Campbell, A. M., Whelihan, K. E., Bay, R. C., Lewis, J. H.
The Journal of the American Osteopathic Association, 2018/12
1897

Therapieblockaden durch Zahn- und Kieferstörfelder: Umgang mit Störfeldern aus Sicht der täglichen osteopathischen Praxis
(Therapy blockades due to interference fields of teeth and jawbone: Dealing with interference fields from the point of view of daily osteopathic practice)
Von Gimborn, G.
Osteopathische Medizin, 2018/12
1898

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text
1899

Identification of prognostic factors and assessment methods on the evaluation of non-specific low back pain in a biopsychosocial environment: A scoping review
Draper-Rodi, J., Vogel, S., Bishop, A.
International Journal of Osteopathic Medicine, 2018/12
1900

Effect of the soft-tissue techniques in the quality of life in patients with Crohn's disease: A randomized controlled trial
Espi-Lopez, G. V., Ingles, M., Soliva-Cazaban, I., Serra-Ano, P.
Medicine (Baltimore), 2018/12
Free full text
1901

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1902

Can lateral epicondylitis be relief by osteopathic treatments targeting tensions from the thoracic region? Results of a case study
Brisson-Larouche, A., Kassab, G., Wehbe, W.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1903

Effect of global osteopathic treatment on functional mobility in the parkinsonian patient: A quasi-experimental study
Devantéry, K., Bouchard, J.C.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1904

The effect of early osteopathic manual treatment (OMT) care, after vaginal delivery, on pelvic health recovery
Fafard, A.M.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1905

Assessing the immediate behavioural responses of hospitalized preterm babies during osteopathic manipulative treatment (OMT): A case series
O'Connor, S., Lafrenaye, S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1906

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text
1907

Immediate effect of T2, T5, T11 thoracic spine manipulation of asymptomatic patient on autonomic nervous system response: Single-blind, parallel-arm controlled-group experiment
Minarini, G., Ford, M., Esteves, J.
International Journal of Osteopathic Medicine, 2018/12
1908

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text
1909

Osteopaticheskaia korrektsiia v kompleksnoi terapii i reabilitatsii patsientov s sindromom pozvonochnoi arterii.
[The use of the osteopathic correction for the combined treatment and rehabilitation of the patients presenting with the vertebral artery syndrome]
Belash, V. O., Mokhov, D. E., Tregubova, E. S.
Voprosy Kurortologii, Fizioterapii, i Lechebnoi Fizicheskoi Kultury, 2018/12
1910

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text
1911

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text
1912

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text
1913

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
The Journal of the American Osteopathic Association, 2018/11
1914

The Effect of Osteopathic Manipulative Medicine on Oxidative Stress Following Mild Traumatic Brain Injury: A Pilot Study
Angelo, N., Mazzeo, S., Oommen, T., Zwibel, H., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1915

Osteopathy and patients who have experienced sexual violence: management, treatment and self-care
Michael-Anna, E.
Unpublished MSc thesis, 2018/11
Free full text
1916

Lymphatic Pump Technique Enhances Immunity in a DSS Colitis Model
Atkinson, E. N., Barcroft, M., Barcroft, Z., Berglind, J.
The Journal of the American Osteopathic Association, 2018/11
1917

Clinically Based OMM Competency Standards for Physicians in Residencies Designated With Osteopathic Recognition in the Single Accreditation System for GME
Cooper Rau Jr., D., Merritt, M.
The Journal of the American Osteopathic Association, 2018/11
1918

The Effect of Osteopathic Manipulative Treatment on Reactive Oxygen Species in Parkinson Disease
Docherty, J., Chu, K., Orshan, D., Kulason, K., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1919

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1920

Managing Tremor in Parkinson Disease Using Osteopathic Manipulative Medicine
Li, R., Docherty, J., Koo, S. L., Shinners, J., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1921

Using Wearable Technology to Measure the Effectiveness of Osteopathic Manipulative Treatment on Parkinson Disease Motor Symptoms
Poon, J., Docherty, J., Mancini, J., DiFrancisco-Donoghue, J., Cheriyan, G., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1922

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11
1923

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1924

Kann die Schwangerschaftsrate nach technisch assistierter Reproduktion durch osteopathische Behandlungen erhöht werden?
(Can the pregnancy rate after assisted reproductive technology be increased through osteopathic treatments?)
Samouh, S.
Unpublished MSc thesis, 2018/10
Free full text
1925

Outpatient satisfaction with osteopathic manipulative treatment in a hospital center: A survey
Tramontano, M., Cinnera, A. M., Petracca, M., Gaeta, A., Tamburella, F., Audouard, M., Caltagirone, C.
Alternative Therapies in Health and Medicine, 2018/10
1926

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10
1927

Die osteopathische Behandlung aus PatientInnensicht – Interviews mit PatientInnen über ihre subjektive Befindlichkeit während osteopathischen Behandlungen
(The osteopathic treatment from the patient's point of view - Interviews with patients about their subjective well-being during osteopathic treatments)
Hocher, J.
Unpublished MSc thesis, 2018/10
Free full text
1928

Scoping review of systematic reviews of complementary medicine for musculoskeletal and mental health conditions
Lorenc, A., Feder, G., MacPherson, H., Little, P., Mercer, S. W., Sharp, D.
BMJ Open, 2018/10
Free full text
1929

Die Rolle der Eltern in der osteopathischen Säuglingsbehandlung innerhalb der ersten drei Lebensmonate aus Sicht von Eltern und OsteopathInnen
(The Role of the Parents in Osteopathic Care of Infants within the First Three Months of Life from the Parents’ and Practitioners’ Perspectives)
Bechinie, C.
Unpublished MSc thesis, 2018/10
Free full text
1930

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text
1931

(Effectiveness of osteopathic treatment in patients with chronic knee pain. A randomized controlled trial)
Weitendorff, A.
Unpublished D.O. thesis, 2018/10
1932

Meralgia paresthetica: A 5 model osteopathic approach
Torrents, M., Malik, R.
Osteopathic Family Physician, 2018/10
Free full text
1933

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10
1934

Möglicher Erfolg einer individualisierten osteopathischen Behandlung für die Lebensqualität und das Angstbefinden bei einer Patientin mit einer chronischen Lungensarkoidose.
(Possible success of an individualized osteopathic treatment regarding the quality of life and the state of anxiety of a patient with a chronic lung sarcoidosis)
Origer, S.
Unpublished MSc thesis, 2018/10
Free full text
1935

Messung des Effekts einer Midline-Behandlung. Eine randomisierte kontrollierte Studie mit gesunden Erwachsenen.
(Measuring the effect of a midline treatment: randomized controlled trial in healthy adults)
Galoppi, M.
Unpublished MSc thesis, 2018/10
Free full text
1936

A Short Review of the Treatment of Headaches Using Osteopathic Manipulative Treatment
Whalen, J., Yao, S., Leder, A.
Current Pain and Headache Reports, 2018/10
1937

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text
1938

An Osteopathic Approach to Rib Somatic Dysfunction in Respiratory Disorders
Pierce-Talsma, S., Talsma, J., Ferrill, H.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1939

The One Health Initiative as a Basis for Research Development in the Department of Pharmacology at Midwestern University
Prozialeck, W. C., Edwards, J. R.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1940

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1941

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
1942

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09
1943

Behandlung einer Patientin mit Schulter-Arm-Syndrom nach proximaler Radiusfraktur infolge eines Sturzes
(Treatment of a patient with shoulder-arm syndrome after proximal radius fracture as a result of a fall: Commented case study on the article “Resonance and dialogue: On the methodology of a neuroregulative treatment model“)
Metcalfe-Wiegand, D.
Osteopathische Medizin, 2018/09
1944

The Immediate Effect of Therapeutic Touch and Deep Touch Pressure on Range of Motion, Interoceptive Accuracy and Heart Rate Variability: A Randomized Controlled Trial With Moderation Analysis
Edwards, D. J., Young, H., Johnston, R.
Frontiers in Integrative Neuroscience, 2018/09
Free full text
1945

In welchem Ausmaß kann die Osteopathie bei Kindern mit Zerebralparese die Bewegung mit funktionellen Konsequenzen und die Lebensqualität positiv beeinflussen
(To what extend can osteopathy have a positive influence on movement with functional consequences and quality of life by children with cerebral palsy)
Schneider, D.
Unpublished MSc thesis, 2018/09
1946

Osteopathic Manipulative Treatment Including Specific Diaphragm Techniques Improves Pain and Disability in Chronic Nonspecific Low Back Pain: A Randomized Trial
Marti-Salvador, M., Hidalgo-Moreno, L., Domenech-Fernandez, J., Lison, J. F., Arguisuelas, M. D.
Archives of Physical Medicine and Rehabilitation, 2018/09
1947

Learning through multiple lenses: analysis of self, peer, near-peer and faculty assessment of a clinical history taking task in Australia
Fitzgerald, K., Vaughan, B.
Journal of Educational Evaluation for Health Professions, 2018/09
Free full text
1948

Primary care physicians' attitude and reported prescribing behavior for chronic low back pain: An exploratory cross-sectional study
Rodondi, P. Y., Dubois, J., Bill, A. S., Koutaissoff, D., Ros, J., Aveni, E., Pasquier, J., Herzig, L., Decosterd, I., Burnand, B.
PLoS One, 2018/09
Free full text
1949

Was ist Schmerzpsychotherapie?
(What is pain psychotherapy?)
Butz, M., Braun, C., Böger, A.
Osteopathische Medizin, 2018/09
1950

Ernährungswissen: Integrativer Bestandteil der Osteopathie in Deutschland?
(Nutritional Knowledge: An integrative part of osteopathy in Germany?)
Nier, R.
Unpublished MSc thesis, 2018/09
Free full text
1951

Design and development of an e-learning programme: An illustrative commentary
Draper-Rodi, J., Vogel, S., Bishop, A.
International Journal of Osteopathic Medicine, 2018/09
1952

Osteopathic Manipulative Therapy and Multiple Sclerosis: A Proof-of-Concept Study
Cordano, C., Armezzani, A., Veroni, J., Pardini, M., Sassos, D., Infante, M. T., Tacchino, A., Lapucci, C., Cellerino, M., Calabro, V., Ciullo, L., Nourbakhsh, B.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1953

Effectiveness of an Osteopathic Abdominal Manual Intervention in Pain Thresholds, Lumbopelvic Mobility, and Posture in Women with Chronic Functional Constipation
Martinez-Ochoa, M. J., Fernandez-Dominguez, J. C., Morales-Asencio, J. M., Gonzalez-Iglesias, J., Ricard, F., Oliva-Pascual-Vaca, A.
The Journal of Alternative and Complementary Medicine, 2018/08
1954

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1955

Medical Infrared Thermography in back pain osteopathic management
Polidori, G., Kinne, M., Mereu, T., Beaumont, F., Kinne, M.
Complementary Therapies in Medicine, 2018/08
1956

Progressive Infantile Scoliosis Managed With Osteopathic Manipulative Treatment Response
Feely, R. A., Kapraun, H. E.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1957

Treatment of bilateral dyshidrotic eczema with drugs versus nutritional and osteopathic treatment
Aceranti, A., Vernocchi, S.
Italian Journal of Medicine, 2018/07
Free full text
1958

Osteopathic Lymphatic Pump Techniques
Franzini, D., Cuny, L. A., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1959

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1960

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07
1961

Role of osteopathic manipulative treatment in cystic fibrosis: A pilot study
Fainardi, V., Benecchi, S., Longo, F., Tripodi, M. C., Villani, M. L., Teopompi, E., Chetta, A. A., Pisi, G.
Journal of Cystic Fibrosis, 2018/07
1962

Use of complementary health approaches at military treatment facilities, active component, U.S. Armed Forces, 2010-2015
Williams, V. F., Clark, L. L., McNellis, M. G.
Medical Surveillance Monthly Report, 2018/07
1963

Enablers and barriers to the development of interprofessional collaboration between physicians and osteopaths: A mixed methods study
Morin, C., Desrosiers, J., Gaboury, I.
Journal of Interprofessional Care, 2018/07
1964

Osteopathic Lymphatic Pump Treatment as an Adjunctive Therapy to Protect Against Infection and Inflammation
Castillo, R. A.
Unpublished PhD thesis, 2018/07
1965

Burnout Rates in Oklahoma State University - College of Osteopathic Medicine Alumni
Chaffin, J.
Unpublished MSc thesis, 2018/07
Free full text
1966

Lymphatic Pump Treatment Mobilizes Bioactive Lymph That Suppresses Macrophage Activity In Vitro
Castillo, R., Schander, A., Hodge, L. M.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1967

Osteopathic Manipulative Therapy Potentiates Motor Cortical Plasticity
Ponzo, V., Cinnera, A. M., Mommo, F., Caltagirone, C., Koch, G., Tramontano, M.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1968

Blood pressure screening in an Australian osteopathy student-led clinic
Vaughan, B., Cannon, N., Davies, D., Kourtis, N., Neophitou, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2018/06
1969

Osteopathic Evaluation and Post-Surgical Rehabilitation Approach in a Patient With Myelopathy and Tetraparesis Related to Cervical Ependymoma: A Case Report
Lewis, D. D.
The AAO Journal, 2018/06
Free full text
1970

The immediate effects of two manual therapy techniques on ankle musculoarticular stiffness and dorsiflexion range of motion in people with chronic ankle rigidity: A randomized clinical trial
Hidalgo, B., Hall, T., Berwart, M., Biernaux, E., Detrembleur, C.
Journal of Back and Musculoskeletal Rehabilitation, 2018/06
1971

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text
1972

Osteopathic Cranial Manipulative Medicine in the Setting of Concussion
Warren, C., Keys, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1973

Osteopathic manipulative treatment for post mastectomy pain: A case report
Downey, H. F.
International Journal of Osteopathic Medicine, 2018/06
1974

The use of osteopathic manipulative medicine in the treatment of headaches for a patient with subdural hematomas in the setting of traumatic brain injury
Bonthala, S., Falco, C.
The Journal of Head Trauma Rehabilitation, 2018/06
1975

Clinical reasoning in osteopathy: Experiences of novice and experienced practitioners
King, L., Kremser, S., Deam, P., Henry, J., Reid, D., Orrock, P., Grace, S.
International Journal of Osteopathic Medicine, 2018/06
1976

Osteopathic clinical reasoning: An ethnographic study of perceptual diagnostic judgments, and metacognition
McIntyre, C, Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/06
1977

Letter to the editor on Holism in Osteopathy - Bridging the gap between concept and practice: A grounded theory study
Morelli, R.
International Journal of Osteopathic Medicine, 2018/06
1978

An exploration of osteopaths' views and experiences regarding the identification of, and provision of advice for, urinary incontinence in women: A qualitative study using framework analysis
Robinson, M. E., Ford, S. L., Goodman, L. B.
International Journal of Osteopathic Medicine, 2018/06
1979

Psychogenic Dizziness: An Important but Overlooked Differential Diagnosis in the Workup of the Dizzy Patient
Kelm, Z., Klapchar, K., Kieliszak, C. R., Selinsky, C.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1980

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects
Abdelfattah, A., Abdelraoof, N., Nasef, S.
Internal Medicine Journal, 2018/05
Free full text
1981

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05
1982

Efficacy of Osteopathic Manipulative Treatment in the Patient of Chronic Rhinosinusitis: A Case Report
Baisakhiya, N.
An International Journal Clinical Rhinology, 2018/05
1983

Cervical HVLA Used as Single Intervention Improves Motion and Strength
Zamora, S., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1984

Myofascial Release Therapy Beneficial for Patients With Chronic Low Back Pain
Jazayeri, S., Seffinger, M.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1985

Fibromyalgia Symptoms Reduced by Osteopathic Manipulative Medicine and Gabapentin
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1986

Osteopathic Manipulation Shown to Improve Upper Airway Stabilization
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1987

Cervical Osteopathic Manipulation Shown to Affect Median Nerve Function
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1988

Manipulation and mobilization for treating chronic low back pain: a systematic review and meta-analysis
Coulter, I. D., Crawford, C., Hurwitz, E. L., Vernon, H., Khorsan, R., Suttorp Booth, M., Herman, P. M.
The Spine Journal, 2018/05
Free full text
1989

Toolkit to improve provider adherence to metabolic monitoring of atypical antipsychotics for youths
Carpenter, L.
Unpublished MSc thesis, 2018/05
Free full text
1990

Faculty Vitality in Osteopathic Medical Schools: A Pilot Study
Ables, A. Z., Shan, L., Broyles, I. L.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1991

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1992

Lokale klinische Diagnostik bei Leistenschmerzen
(Local clinical diagnosis of inguinal pain)
Dobler, T. K.
Osteopathische Medizin, 2018/05
1993

Restoration of Full Shoulder Range of Motion After Application of the Fascial Distortion Model
Boucher, J. D., Figueroa, J.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1994

Knieschmerz und fazilitierte Positionierung in Anlehnung an L.H. Jones
(Knee pain and facilitated positioning in the style of L.H. Jones)
Heidrich, M., Buchmann, J., Röper-Krejza, B.
Osteopathische Medizin, 2018/05
1995

Neck-stomach syndrome in the cervical spondylosis: An update on preliminary 2017 data
Ramieri, A., Miscusi, M., Costanzo, G.
European Spine Journal, 2018/04
1996

Fibromyalgia with Gabapentin and Osteopathic Manipulative Medicine: A Pilot Study
Marske, C., Bernard, N., Palacios, A., Wheeler, C., Preiss, B., Brown, M., Bhattacharya, S., Klapstein, G.
The Journal of Alternative and Complementary Medicine, 2018/04
1997

Chronic inflammatory exposure changes the phenotype of human skeletal muscle cells
McManus, C., Richardson, C.
FASEB Journal, 2018/04
1998

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1999

How type and number of training sessions influence the reliability of palpation
Lavazza, C., Milano, V., Abenavoli, A., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2018/04
2000

Osteopathic manipulative treatment in chronic coccydynia: A case series
Origo, D., Tarantino, A. G., Nonis, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2018/04
2001

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04
2002

The immediate effect of osteopathic cervical spine mobilization on median nerve mechanosensitivity: A triple-blind, randomized, placebo-controlled trial
Whelan, G., Johnston, R., Millward, C., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2018/04
2003

IGeL-Monitor. Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text
2004

Assessment Considerations for Core Entrustable Professional Activities for Entering Residency
Linsenmeyer, M., Wimsatt, L., Speicher, M., Powers, J., Miller, S., Katsaros, E.
The Journal of the American Osteopathic Association, 2018/04
Free full text
2005

Effectiveness of 2 Osteopathic Treatment Approaches on Pain, Pressure-Pain Threshold, and Disease Severity in Patients with Fibromyalgia: A Randomized Controlled Trial
Albers, J., Jäkel, A., Wellmann, K., von Hehn, U., Schmidt, T.
Complementary medicine research, 2018/04
2006

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
2007

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
2008

Einfluss der osteopathischen Therapie auf funktionelle Sehstörungen beim Schulkind
(Influence of osteopathic therapy on functional visual disorders in schoolchildren)
Nestel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
Free full text
2009

Wann braucht ein Kind Physiotherapie und wann Osteopathie?
(When does a child need physiotherapy and when do they need osteopathy?)
Schwahn, N., Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
2010

Osteopathic Manipulative Treatment in the Management of Pediatric Headache and Orthodontic Intervention: A Case Report
Heineman, K.
The AAO Journal, 2018/03
Free full text
2011

Characterizing Adverse Events Reported After Osteopathic Manipulative Treatment
Degenhardt, B. F., Johnson, J. C., Brooks, W. J., Norman, L.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2012

Increasing Self-Awareness of Medical Students Through the Use of Ultrasonography
Sandefur, K., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2013

Shaping conservative spinal services with the Spine Tango Registry
Morris, S., Booth, J.
European spine journal, 2018/03
2014

The Safety of Osteopathic Manipulative Treatment (OMT)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2015

Resonanz und Dialog: Zur Methodik eines neuroregulativen Behandlungsmodells
(Resonance and dialogue: On the methodology of a neuroregulative treatment model)
Metcalfe-Wiegand, D.
Osteopathische Medizin, 2018/03
2016

Einfluss der craniosacralen Behandlung CV-4 bei Schwangeren in der 41. Schwangerschafts-woche.
(The influence of craniosacral CV-4-treatment on pregnancies in the 41st week of pregnancy)
Samonigg-Lackner, D.
Unpublished MSc thesis, 2018/03
Free full text
2017

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2018

Clinical versus radiological findings: A paradox in diagnosing minor hamstring injuries
Arumugam, A.
International Journal of Osteopathic Medicine, 2018/03
2019

OMT for Patients With Sacral Somatic Dysfunction
Yu, K., Pfotenhauer, K., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2020

‘I just don't have the tools’ - Italian osteopaths' attitudes and beliefs about the management of patients with chronic pain: A qualitative study
Formica, A., Thomson, O. P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/03
Free full text
2021

“Der schiefe Kopf“ Befundungs- und Behandlungsprozess bei Säuglingen mit Plagiozephalie mittels Experteninterviews
(“The Oblique Head“ Follow-Up and Treatment Process for Infants with Orthesis by Interview of Experts)
Michaelis, C.
Unpublished MSc thesis, 2018/03
Free full text
2022

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text
2023

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text
2024

Assessment of cervical stiffness in axial rotation among chronic neck pain patients: A trial in the framework of a non-manipulative osteopathic management
Dugailly, P. M., Coucke, A., Salem, W., Feipel, V.
Clinical Biomechanics, 2018/03
2025

Work-related musculoskeletal injuries among Australian osteopaths: A preliminary investigation
McLeod, G. A., Murphy, M., Henare, T. M., Dlabik, B.
International Journal of Osteopathic Medicine, 2018/03
2026

The development of a palpation-based clinical assessment of breathing motion: a nominal group technique approach
Petch, K. A.
Unpublished MSc thesis, 2018/03
Free full text
2027

Effektivität der osteopathischen Behandlung bei Patienten mit chronischem Knieschmerz, eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with chronic knee pain, a randomized controlled study)
Weitendorff, A.
Unpublished MSc thesis, 2018/03
2028

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03
2029

Kann durch eine Serie von osteopathischen Behandlungen die Lebensqualität von Bewohnern eines Altenheims, die an Osteoporose erkrankt sind, mehr verbessert werden als mit einer alternativen Behandlung in Form von Bewegungstherapie?
(Can the quality of life of an elderly who is affected by osteoporosis be improved through a series of osteopathic treatments, rather than with an alternative treatment in the form of movement therapy?)
Preis, G.
Unpublished MSc thesis, 2018/03
Free full text
2030

Pilotstudie über den Einfluss der osteopathischen Behandlung des Mesenteriums auf das Atemvolumen
(Pilot study on the influence of the treatment of the mesentery on the respiratory volume)
Muigg, E.
Unpublished MSc thesis, 2018/03
Free full text
2031

The effects of osteopathic treatment on psychosocial factors in people with persistent pain: A systematic review
Saracutu, M., Rance, J., Davies, H., Edwards, D. J.
International Journal of Osteopathic Medicine, 2018/03
2032

Einfluss osteopathischer Behandlung bei Subacromialem Impingement-Syndrom (SAIS)
(Influence of Osteopathic Treatment on Subacromial Impingement Syndrome (SAIS))
Grill, H.
Unpublished MSc thesis, 2018/03
Free full text
2033

Osteopathie bei Rücken- und Beckengürtelschmerzen während und nach der Schwangerschaft
(Osteopathy in low back pain and pelvic girdle pain during and after pregnancy: Systematic review and meta-analysis)
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Osteopathische Medizin, 2018/03
2034

Mechanical Link – Protokoll für eine individuelle Diagnostik und Therapie
(Mechanical link - Protocol for an individual diagnostics and therapy)
Hafen-Bardella, C.
Osteopathische Medizin, 2018/03
2035

OMT to Address the Physiologic Effects of Stress
Emmet, D., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/02
Free full text
2036

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text
2037

Osteopathic Manipulative Treatment in Surgical Care: Short Review of Research Publications in Osteopathic Journals During the Period 1990 to 2017
Sposato, N. S., Bjersa, K.
Journal of Evidence-Based Integrative Medicine, 2018/02
Free full text
2038

Einfluss postoperativer Adhäsionen nach Sektio auf chronischen Low Back Pain - eine Pilotstudie
(Influence of postoperative adhesion after caesarean section on chronic lower back pain - a pilot study)
Liedler, M.
Unpublished MSc thesis, 2018/02
Free full text
2039

Erhöht eine interne myofasciale osteopathische Technik am Beckenboden die Effektivität des Beckenbodentrainings bei Frauen mit Belastungsinkontinenz?
(Does an internal myofascial osteopathic technique applied on the pelvic floor muscles increase the efficiency of the pelvic floor muscle training on women with stress urinary incontinence?)
Hie-Wiederstein, M.
Unpublished MSc thesis, 2018/02
Free full text
2040

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
2041

Osteopathische intrauterine Behandlung einer kongenitalen Lungenzyste
(Osteopathic intrauterine treatment of a congenital lung cyst)
Urbanek, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
2042

Frauen in der osteopathischen Praxis
(Women in osteopathic practice)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
2043

Chronic Pain Management: Perspective of an Osteopathic Medical Student in New Mexico
Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2044

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2045

Effects of spinal manipulation and myofascial techniques on heart rate variability: A systematic review
Amoroso Borges, B. L., Bortolazzo, G. L., Neto, H. P.
Journal of Bodywork and Movement Therapies, 2018/01
2046

OMT May Be Helpful in the Management of Benign Paroxysmal Positional Vertigo
Tegeler, L., Blumer, J.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2047

An evaluation of osteopathic treatment on psychological outcomes with patients suffering from chronic pain: A prospective observational cohort study collected through a health and well-being academy
Edwards, D. J., Toutt, C.
Health Psychology Open, 2018/01
Free full text
2048

Postural and autonomic modifications following osteopathic manipulative treatment (OMT): Comparison between two techniques. A pilot study
Scoppa, F., Pirino, A., Belloni, G., Gallamini, M., Messina, G., Iovane, A.
Acta Medica Mediterranea, 2018/01
Free full text
2049

Lymphatic Vessels Found in the Brain-Osteopathic Considerations, Part 2: Now in Humans and Monkeys
King, H. H.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2050

Manual therapy for unsettled, distressed and excessively crying infants: a systematic review and meta-analyses
Carnes, D., Plunkett, A., Ellwood, J., Miles, C.
BMJ Open, 2018/01
Free full text
2051

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01
2052

Combined osteopathy and exercise management of Achilles tendinopathy in an athlete
Ross, G., Macfarlane, C., Vaughan, B.
The Journal of Sports Medicine and Physical Fitness, 2018/01
2053

Gratitude: Reflections and Belonging in the Osteopathic Family
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2054

Safety of Osteopathic Cranial Manipulative Medicine as an Adjunct to Conventional Postconcussion Symptom Management: A Pilot Study
Patel, K. G., Sabini, R. C.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2055

OMT for Cancer Patients After Bowel Resection
Pena, N., Prieto, H., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2056

Level of evidence and quality of reports of cranial and visceral osteopathic treatment trials
Morin, C., Gaboury, I.
Global Advances in Health and Medicine, 2018
2057

Die Wirklichkeit der Osteopathie. Studie zu einer am Leib orientierten Anthropologie
(The reality of osteopathy. Study of an anthropology oriented to the lived body)
Kaiser, A.K.
Dissertation, 2018
2058

Tools zum Erlernen der Palpation
(Tools for learning palpation)
Krause, R.
Osteopathische Medizin, 2017/12
2059

Palpatory and Ultrasound Assessment of Cervical Dysfunctions and the Effect of Cervical High-Velocity, Low-Amplitude (HVLA) Technique
Flaum, T. B., Mirza, A., Rusnack, F. M-A., Apoznanski, T. E., Munarova, A., Mazzie, J., Terzella, M. J., Yao, S. C.
The AAO Journal, 2017/12
Free full text
2060

Osteopathische Läsion – Teil 2: Definitionen und Terminologien
(Osteopathic lesion - Part 2: Definitions and terminologies)
Liem, T.
Osteopathische Medizin, 2017/12
2061

Kommentar des Autors
Author's comment
Liem, T.
Osteopathische Medizin, 2017/12
2062

Advancing the Understanding and Treatment of the Thoracic Inlet and Incorporation of a New Still Technique—Part 1
Lewis, D. D.
The AAO Journal, 2017/12
Free full text
2063

OMT for Patients With Multiple Sclerosis
Wolf, K., Krinard, T., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text
2064

Braucht es einen Paradigmenwechsel in der osteopathischen Diagnostik und Therapie im kraniozervikalen Bereich?
(Is a paradigm shift required in osteopathic diagnosis and treatment in the craniocervical junction?)
Moser, U.
Osteopathische Medizin, 2017/12
2065

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12
2066

Use of pressure dynamometer in the assessment of the pressure pain threshold in trigger points in the craniocervical muscles in women with unilateral migraine and tension-type headache: An observational study
Pires, R., da Rocha, N. S., Esteves, J. E., Rodrigues, M. E.
International Journal of Osteopathic Medicine, 2017/12
2067

Let's get physical!
Hickner, J.
The Journal of Family Practice, 2017/12
2068

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text
2069

Osteopathic manipulative treatment for post mastectomy lymphedema: A case report
Goyal, M, Goyal, K, Narkeesh, K., Samuel, A. J., Arumugam, N.
International Journal of Osteopathic Medicine, 2017/12
2070

Osteopathic Manipulative Treatment for the Management of Adjacent Segment Pathology
Lewis, D. D., Summers, G. K.
The Journal of the American Osteopathic Association, 2017/12
Free full text
2071

Influence of perceived difficulty of cases on student osteopaths' diagnostic reasoning: a cross sectional study
Noyer, A. L., Esteves, J. E., Thomson, O. P.
Chiropractic & Manual Therapies, 2017/12
Free full text
2072

What are the risks of manual treatment of the spine? A scoping review for clinicians
Swait, G., Finch, R.
Chiropractic & Manual Therapies, 2017/12
Free full text
2073

Osteopathy and troublesome regurgitation in babies. The influence of a set of osteopathic techniques on the symptoms of troublesome regurgitation in babies. A randomized controlled clinical trial
Schepers, V.
Unpublished D.O. thesis, 2017/12
2074

Developing a new approach to persistent pain management in osteopathic practice. Stage 1: A feasibility study for a group course
Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/12
2075

Complementary and alternative therapies in dentistry and characteristics of dentists who recommend them
Baatsch, B., Zimmer, S., Rodrigues Recchia, D., Bussing, A.
Complementary Therapies in Medicine, 2017/12
2076

Median Arcuate Ligament Syndrome (MALS): Fallserie über die osteopathische Behandlung von sieben Patienten: Evidenzlevel IV gemäß CARE-Guideline
(Median arcuate ligament syndrome (MALS): Case series on the osteopathic treatment of seven patients. Evidence level IV according to CARE guidelines)
Beck, M.
Osteopathische Medizin, 2017/12
2077

Challenging Case of Parotitis: A Comprehensive Approach
Patel, P., Scott, S., Cunningham, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text
2078

Effects of Group Fitness Classes on Stress and Quality of Life of Medical Students
Yorks, D. M., Frothingham, C. A., Schuenke, M. D.
The Journal of the American Osteopathic Association, 2017/11
Free full text
2079

Current Clinical Status of Osteopathy: Study Based on Retrospective Evidences of Six Years, A Systemic Review
Ahmad, R.
Annual Research & Review in Biology, 2017/11
Free full text
2080

Functional Limitations in Adults Who Utilize Chiropractic or Osteopathic Manipulation in the United States: Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2017/11
2081

Comparing the Effect of Osteopathic Manipulative Medicine Versus Concussion Education for the Acute Treatment of Mild Concussion Symptoms
Angelo, N., Zwibel, H., Leder, A., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
2082

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
2083

Touro California Student-Run Free Clinic: An Investigation of Actual vs Target Patient Demographic and the Impact of Osteopathic Manipulative Medicine in the Vallejo, California, Community
Jamall, S., Ang, B., Kimpo, J. V., Liu, B., Donn, E., Szeto, H., Devanney, J., Pearce, M.
The Journal of the American Osteopathic Association, 2017/11
2084

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
The Journal of the American Osteopathic Association, 2017/11
2085

Osteopathic Manipulative Treatment Reduces Oxidative Stress Levels and Improves Relative Stiffness and Quality of Life in Parkinson Disease
Moriarty, S. A., Lu, V., Oommen, C., Bellavia, L. M., Lee, J. M., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
2086

Lymphatic Pump Treatment of Inflammation in Rat Adjuvant-Induced Arthritis
Volin, M., McAuliffe, R., Zanotti, B.
The Journal of the American Osteopathic Association, 2017/11
2087

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text
2088

Evaluation of New Zealand osteopathy patients experiences of their treatment
Judkins, R., Vaughan, B., Mulcahy, J.
Complementary Therapies in Clinical Practice, 2017/11
2089

Condylar Decompression Technique for Infants
Pierce-Talsma, S., Pena, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
2090

Sutherlandtechnik beim Knick-Senkfuß
(Sutherlandtechnik for pes planuvalgus)
Radner, J.
Unpublished MSc thesis, 2017/10
Free full text
2091

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text
2092

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10
2093

Manipulative scar treatment and ostheopatic manipulative treatment for pain, shoulder motion and quality of life in post-mastectomy pain syndrome (PMPS). A randomized clinical trial
Figini, D., Seghini, P., Bidin, L.
Annals of Oncology, 2017/10
2094

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10
2095

Kann die osteopathische Behandlung die Krankheitsaktivität bei Patienten mit rheumatoider Arthritis (RA) beeinflussen? Randomisierte kontrollierte Studie.
(The influence of osteopathic treatment in addition to the standard therapy on disease activity in patients with rheumatoid arthritis (RA). A randomized controlled trial)
Franzen, K., Ramscheidt, B.
Unpublished D.O. thesis, 2017/10
2096

Wirksamkeit einer ganzheitlichen osteopathischen Behandlung bei Menschen mit Depression und damit einhergehenden Schlafstörungen. Prä-Post-Studie.
(Effectiveness of individual osteopathic treatment in patients with depression and associated sleep disturbance. A pre-post study)
Gruber, J.
Unpublished D.O. thesis, 2017/10
2097

Einfluss einer osteopathischen Behandlung am Tag des errechneten Geburtstermins auf das Einsetzen einer physiologischen Geburt innerhalb eines 48-Stunden Zeitraums. Randomisierte kontrollierte Studie.
(The influence of an osteopathic treatment at due date on the onset of labor within a 48-hour period. A randomized controlled trial)
Huss, S., Klose, M., Patanchon, P.
Unpublished D.O. thesis, 2017/10
2098

Postpartale Beschwerden von Müttern nach einem Kaiserschnitt
(Postpartal complaints of mothers after Caesarean section)
Weiss, A.
Unpublished MSc thesis, 2017/10
2099

Osteopathic management of chronic constipation in women patients. Results of a pilot study
Belvaux, A., Bouchoucha, M., Benamouzig, R.
Clinics and Research in Hepatology and Gastroenterology, 2017/10
2100

Untersuchung der Effektivität von osteopathischen Behandlungen zusätzlich zur Standardtherapie bei Jugendlichen mit unspezifischen Kreuzschmerzen. Randomisierte kontrollierte Studie.
(Evaluation of effectiveness of osteopathic treatment in addition to standard therapy in adolescents with unspecific low lack pain (LBP). A randomized controlled trial)
Ringeisen, P.
Unpublished D.O. thesis, 2017/10
2101

Osteopathie bei gastroosophagealem Reflux mit Hiatushernie: Ein Fallbericht gemass der CARE-Leitlinie
(Osteopathic Treatment of Gastroesophageal Reflux Disease and Hiatal Hernia: A Case Report Following the CARE Guideline)
Rotter, G., Brinkhaus, B.
Complementary Medicine Research, 2017/10
Free full text
2102

Osteopathische Behandlung von Patienten mit Impingement-Syndrom der Schulter. Prä-Post-Studie.
(Effectiveness of individual osteopathic treatment in patients with shoulder outlet impingement. A pre-post study)
Tallo, F.
Unpublished D.O. thesis, 2017/10
2103

Developing an evidence base for osteopathic healthcare: an exploration of osteopathic healthcare to inform the design of an appropriate methodology to investigate its effectiveness
Orrock, P. J.
Unpublished PhD thesis, 2017/10
Free full text
2104

Die Pathophysiologie von postoperativen peritonealen Adhäsionen - Osteopathie als Behandlungsmöglichkeit?
(The pathophysiology of postoperative peritoneal adhesions - Osteopathy as a treatment option?)
Lackner, I.
Unpublished MSc thesis, 2017/10
Free full text
2105

Osteopathie und die Auswirkung auf den Trainingslevel der MFT Challenge Disc. Eine kontrollierte randomisierte klinische Pilotstudie an gesunden Personen.
(Osteopathy and its effect on the Training Level of the MFT Challenge Disc. A randomised controlled pilot study of healthy adults)
Moser-Dobaj, A.
Unpublished MSc thesis, 2017/10
Free full text
2106

The effects of cervical sustained natural apophyseal glides on neck range of movement and sympathetic nervous system activity
Bowler, N., Browning, P., Lascurain-Aguirrebeña, I.
International Journal of Osteopathic Medicine, 2017/09/01/
2107

An observational study of ultrasound to confirm cervical spine segmental positional rotation
Flaum, T. B., Rusnack, F. M., Mirza, A., Apoznanski, T. E., Munarova, A., Mazzie, J. P., Terzella, M.l J., Yao, S. C.
International Journal of Osteopathic Medicine, 2017/09/01/
2108

Mother Still
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2109

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text
2110

Prozessorientierung in der Osteopathie: ein Ansatz jenseits des Strukturmodells
(Process orientation in osteopathy: An approach beyond the structural model)
Lederman, E.
Osteopathische Medizin, 2017/09
2111

Chronologie von Krankheitsgeschehen, Therapie und Forschung in der Osteopathie
(Chronology of pathophysiology, therapy and research in osteopathy)
Levin, P.
Osteopathische Medizin, 2017/09
2112

Die biodynamische Behandlung bei einem Patienten mit Makuladegeneration
(Biodynamic treatment of a patient suffering from macular degeneration)
Koop, J. P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2113

Update zur Drainage des Gehirns und osteopathische Behandlungsansätze
Update on brain drainage and osteopathic treatment approaches
Liem, T.
Osteopathische Medizin, 2017/09
2114

Osteopathic Manipulative Treatment for Chronic Neck Pain, Headaches, and Referred Pain in a Patient With Myofascial Pain Syndrome: A Case Report
Lewis, D. D.
The AAO Journal, 2017/09
Free full text
2115

The Use of Osteopathic Manual Therapy and Rehabilitation for Subacromial Impingement Syndrome: A Case Report
Bennett, S., Macfarlane, C., Vaughan, B.
Explore (NY), 2017/09
2116

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2117

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2118

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2119

What Osteopathic Physicians Do
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2120

Acupuncture Meridian-Based Myofascial Release to Treat Knee Pain in Sinding-Larsen–Johansson Syndrome: A Case Report
Valvano, K. D., Sina, R. E.
The AAO Journal, 2017/09
Free full text
2121

Interet clinique du traitement osteopathique chez les patientes ayant une endometriose colorectale : classification fondee sur les symptomes et la qualite de vie.
(Impact of osteopathic manipulative therapy in patient with deep colorectal endometriosis: A classification based on symptoms and quality of life)
Darai, C., Bendifallah, S., Foulot, H., Ballester, M., Chabbert-Buffet, N., Darai, E.
Gynecologie, Obstetrique, Fertilite & Senologie, 2017/09
2122

Osteopathic approach to treating a patient with congenital infantile torticollis reveals unusual presentation of absence of concomitant cranial base strain pattern: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/09
2123

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2124

Integrating osteopathic approaches based on biopsychosocial therapeutic mechanisms. Part 1: The mechanisms
Fryer, G.
International Journal of Osteopathic Medicine, 2017/09
2125

Scheinselbstständigkeit in der osteopathischen Praxis
(False self-employment in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
Free full text
2126

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2127

Osteopathische Behandlung bei Coxarthrose
(Osteopathic Treatment of Patients with Coxarthrosis: A Randomised Controlled Trial)
Vögele, T.
Unpublished MSc thesis, 2017/09
Free full text
2128

Aus welchen Gründen und mit welchen Beschwerden kommen Mütter innerhalb 18 Monate post partum zum/zur Osteopathen/in und welche somatischen Dysfunktionen weisen sie auf?
(What are the reasons and complaints of mothers who consult an osteopath within 18 months postpartum, and which somatic dysfunctions do they have?)
Woitzik, K.
Unpublished MSc thesis, 2017/09
Free full text
2129

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2130

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2131

Diagnostic reliability of osteopathic tests: A systematic review
Basile, F., Scionti, R., Petracca, M.
International Journal of Osteopathic Medicine, 2017/08
2132

Corrigendum to “Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research“ [Musculoskelet. Sci. Pract. 27 165-175]
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/08
2133

Efficacité d'un traitement ostéopathique pour les problématiques biomécaniques de succion des nouveau-nés
(Efficacy of an osteopathic treatment for infants with biomechanical sucking dysfunctions)
Herzhaft-Le Roy, J.
Unpublished MSc thesis, 2017/08
Free full text
2134

Conservative management of a traumatic meniscal injury utilising osteopathy and exercise rehabilitation: A case report
Feehan, J., Macfarlane, C., Vaughan, B.
Complementary Therapies in Medicine, 2017/08
2135

Successful outcome of musculoskeletal injury leads to a reduction in chronic fatigue: A case report
Todd, C.
Journal of Bodywork and Movement Therapies, 2017/07
2136

Efficacy of Osteopathic Manipulative Treatment Approach in the Patient with Pulmonary Fibrosis in Critical Care Outpatient Department
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Arumugam, N., Chatterjee, S., Sharma, S.
Indian Journal of Critical Care Medicine, 2017/07
Free full text
2137

The effectiveness of osteopathic manipulative treatment in an abnormal uterine bleeding related pain and health related quality of life (HR-QoL) - A case report
Goyal, K., Goyal, M., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S., Arumugam, N.
Journal of Bodywork and Movement Therapies, 2017/07
2138

Hypnosis and Osteopathic Manipulative Treatment for Visual Disorders During Pregnancy: A Case Report
Russo, G., Remonato, A., Remonato, R., Zanier, E.
Advances in Mind-Body Medicine, 2017/07
2139

Osteopathic approach to treating a patient with new onset low back pain following injury reveals unusual presentation of bilateral and symmetric symptoms: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/07
2140

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text
2141

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
2142

Osteopathic Approach to Anxiety
Blumer, T.., Blumer, J.
Osteopathic Family Physician, 2017/07
Free full text
2143

Wirkungen der Osteopathie im psychischen Bereich – eine systematische Literaturübersicht
(Effects of osteopathy in the psychological field - a systematic review)
Perstling, A., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2144

Effects of Osteopathic Manipulative Therapy on Pain and Mood Disorders in Patients With High-Frequency Migraine
D'Ippolito, M., Tramontano, M., Buzzi, M. G.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2145

Osteopathic manipulative treatment in soccer players with chronic groin pain: a pilot study
Nolli, L., Baraggiolo, S., PaganiI, M, Origo, D., Bergna, A., Vismara, L.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2017/06
2146

Osteopathie als aktuelle Satzungsleistung gesetzlicher Krankenkassen
(Osteopathy as current optional benefit of statutory health insurance companies)
Newiger, C.
Osteopathische Medizin, 2017/06
2147

Balanced Fascial Tension (BFT) am Beispiel der faszialen Hüllen des Herzens
(Balanced Fascial Tension (BFT) using the fascial sheaths of the heart as an example)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2148

(Osteopathic approaches for endometriosis)
Ott, S.
Osteopathische Medizin, 2017/06
2149

Efficacy of an eccentric osteopathic manipulation treatment in somatic tinnitus
Goyal, M., Sharma, S., Baisakhiya, N., Goyal, K.
Indian Journal of Otology, 2017/06
2150

Wirkungen der Osteopathie im psychischen Bereich – eine systematische Literaturübersicht
(Effects of osteopathy in the psychological field - a systematic literature review)
Perstling, A., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2151

Diaphragm postural function in injured subtalar joint
Urbaniak, M., Kisilewicz, A., Klich, S.
Physiotherapy Quarterly, 2017/06
2152

Schwindel bei Tubenkatarrh nach Otitis media
(Vertigo in tubal catarrh after otitis media)
Schneider, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2153

Mikrobiom: Worauf Sie bei Ihren Patienten achten sollten
(Microbiome: What you should pay particular attention to in your patients)
Zschocke, A. K.
Osteopathische Medizin, 2017/06
2154

Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment
Licciardone, J. C.
Musculoskeletal Science and Practice, 2017/06
2155

Reply to the letter to the editor: 'Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment'
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/06
2156

Osteopathic medical students entering family medicine and attitudes regarding osteopathic manipulative treatment: Preliminary findings of differences by sex
Baker, H. H., Linsenmeyer, M., Ridpath, L. C., Bauer, L. J., Foster, R. W.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2157

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06
2158

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text
2159

Osteopathische Behandlungen nach Karpaltunneloperation – eine randomisierte kontrollierte Studie
(Osteopathic treatments after carpal tunnel surgery - A randomized controlled trial)
Deutschmann, G., Porthun, J., Grabner, O., Leskowschek, H., Graff, W., Sammer, A., Safran, T.
Osteopathische Medizin, 2017/06
2160

A systematic review of randomised controlled trials using Acceptance and commitment therapy as an intervention in the management of non-malignant, chronic pain in adults
Simpson, P. A., Mars, T., Esteves, J. E.
International Journal of Osteopathic Medicine, 2017/06
2161

‘Talking a different language’: a qualitative study of chronic low back pain patients' interpretation of the language used by student osteopaths
Thomson, O. P., Collyer, K.
International Journal of Osteopathic Medicine, 2017/06
2162

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06
2163

The effect of visceral osteopathic manual therapy applications on pain, quality of life and function in patients with chronic nonspecific low back pain
Tamer, S., Öz, M., Ülger, O.
Journal of Back and Musculoskeletal Rehabilitation, 2017/05
2164

Osteopathic manipulation of the ankle improves spinal flexibility in elite alpine skiers: a pilot study
Parisio, C., Vismara, L., Micotti, V., Cimolin, V., Aprile, D., Cavigioli, M., Panzeri, A., Manzotti, A., Galli, M., Capodaglio, P.
Gazzetta Medica Italiana Archivio Per Le Scienze Mediche, 2017/05
2165

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2166

Addition of Osteopathic Visceral Manipulation to OMT for Low Back Pain Decreases Pain and Increases Quality of Life
King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2167

Clinical classification in low back pain: best-evidence diagnostic rules based on systematic reviews
Petersen, T., Laslett, M., Juhl, C.
BMC Musculoskeletal Disorders, 2017/05
Free full text
2168

Effects of Osteopathic Treatment on Postural Equilibrium Evaluated through a Stabilometric Platform: A Randomized and Controlled Study
Buscemi, A., Cannatella, M., Lutrario, P., Rapisarda, A., Di Gregorio, G., Coco, M.
Journal of Functional Morphology and Kinesiology, 2017/05
Free full text
2169

Integrating osteopathic approaches based on biopsychosocial therapeutic mechanisms. Part 2: Clinical approach
Fryer, G.
International Journal of Osteopathic Medicine, 2017/05
2170

Osteopathic Manipulative Treatment During the Third Trimester of Pregnancy
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2171

A efetividade do tratamento osteopático na constipação intestinal: uma revisão sistemática
(Effectiveness of the ostheopatic treatment in intestinal constipation: A systematic review)
Rocha Do Vale, J., De Carvalho, H. F. B., Andrade, V. L. Â, Almeida, L. C.
GED - Gastrenterologia Endoscopia Digestiva, 2017/04
2172

Autismus-Spektrum-Störung (ASS) und Osteopathie
(Autism spectrum disorder (ASD) and osteopathy)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2173

„Point of Balance“ in der osteopathischen Behandlung eines Kindes mit Handicap
(“Point of Balance“ in the osteopathic treatment of a child with handicap)
Müller, H.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2174

Preliminary evidence of Regional Interdependent Inhibition, using a 'Diaphragm Release' to specifically induce an immediate hypoalgesic effect in the cervical spine
McCoss, C. A., Johnston, R., Edwards, D. J., Millward, C.
Journal of Bodywork and Movement Therapies, 2017/04
2175

Biological effects of direct and indirect manipulation of the fascial system. Narrative review
Parravicini, G., Bergna, A.
Journal of Bodywork and Movement Therapies, 2017/04
2176

Ein Leben mit Arthrogryposis multiplex congenita (ACM)
(Living with arthrogryposis multiplex congenita (AMC))
Seger, G.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2177

Behandlungsvertrag nach dem Patientenrechtegesetz
(Treatment contract in accordance with the Patient's Rights Law)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2178

Persistierende frühkindliche Reflexe
(Persistent early childhood reflexes)
Watrin, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2179

Osteopathie bei infantiler Zerebralparese (IZP) – eine Einzelfallstudie
(Osteopathy in infantile cerebral palsy (IZP) - a single case study)
Budroni, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2180

Das Fasziendistorsionsmodell: Ein medizinisches Konzept – Praxiswissen kompakt
(The fascial distortion model: A medical concept - Praxiswissen Kompakt)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2181

Das chronische Beckenschmerzsyndrom : Hilfe durch Osteopathie.
(Chronic pelvic pain syndrome : Treatment options using osteopathy)
Marx, S.
Der Urologe, 2017/04
2182

Opening the Doors of Medicine to Women
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2183

Use of the Spencer Technique on Collegiate Baseball Players: Effect on Physical Performance and Self-Report Measures
Curcio, J. E., Grana, M. J., England, S., Banyas, P. M., Palmer, B. D., Placke, A. E., Rieck, W. A., Jr., Eade
The Journal of the American Osteopathic Association, 2017/03
Free full text
2184

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text
2185

Osteopathic Manipulative Treatment for Nausea and Vomiting Following Fine Needle Aspiration of the Neck
Hess, N. J.
The AAO Journal, 2017/03
Free full text
2186

Imaging Evidence Demonstrating Effectiveness of Osteopathic Visceral Manipulation Techniques in Treating Pseudo-Obstruction
Ignatowicz, A., Berkowitz, M. R.
The AAO Journal, 2017/03
Free full text
2187

Osteopathic Manipulative Treatment in the Management of Isaacs Syndrome
Shanahan, L. K. T., Raines, S. G., Coggins, R. L., Moore, T., Carnes, M., Griffin, L.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2188

Efficacy of Myofascial Unwinding and Myofascial Release Technique in a Patient with Somatic Symptoms - A Case Report
Goyal, M., Goyal, K., Bathla, M., Kanimozhi, D., Narkeesh, D.
Indian journal of Psychological Medicine, 2017/03
Free full text
2189

Impact of osteopathic therapy on proprioceptive balance and quality of life in patients with dizziness
Papa, L., Amodio, A., Biffi, F., Mandara, A.
Journal of Bodywork and Movement Therapies, 2017/03
2190

A mixed methods evaluation of a third wave cognitive behavioural therapy and osteopathic treatment programme for chronic pain in primary care (OsteoMAP)
Carnes, D., Mars, T., Plunkett, A., Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/03
2191

A critical review of manual therapy use for headache disorders: prevalence, profiles, motivations, communication and self-reported effectiveness
Moore, C. S., Sibbritt, D. W., Adams, J.
BMC Neurology, 2017/03
Free full text
2192

Osteopathic manipulative treatment showed reduction of length of stay and costs in preterm infants: A systematic review and meta-analysis
Lanaro, D., Ruffini, N., Manzotti, A., Lista, G.
Medicine (Baltimore), 2017/03
Free full text
2193

Rehabilitation treatment for chronic lower back pain: New evidence for old methods? A randomized, controlled experimental trial
Rigoni, S., Scapin, M.
Minerva Ortopedica e Traumatologica, 2017/03
2194

Osteopathy for primary headache patients: a systematic review
Cerritelli, F., Lacorte, E., Ruffini, N., Vanacore, N.
Journal of Pain Research, 2017/03
Free full text
2195

Osteopathic manipulation as a complementary approach to Parkinson's disease: A controlled pilot study
Difrancisco-Donoghue, J., Apoznanski, T., De Vries, K., Jung, M. K., Mancini, J., Yao, S.
NeuroRehabilitation, 2017/03
2196

The risk associated with spinal manipulation: an overview of reviews
Nielsen, S. M., Tarp, S., Christensen, R., Bliddal, H., Klokker, L., Henriksen, M.
Systematic Reviews, 2017/03
Free full text
2197

Effects of a short-term osteopathic intervention on vertical jump and reach height in female recreational overhead athletes : a cross-over design
Green, T. C.
Unpublished MSc thesis, 2017/03
Free full text
2198

Osteopathie bei Schlafstörungen von Erwachsenen
(Osteopathic treatment on adults with sleep disturbances)
Litzlbauer, T.
Unpublished MSc thesis, 2017/03
Free full text
2199

Osteopathic Medical Student Practice of Osteopathic Manipulative Treatment During School Break
Pierce-Talsma, S., Hiserote, R. M., Lund, G.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2200

Osteopathic treatment in a patient with left-ventricular assist device with left brachialgia: a case report
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Medical Case Reports Journal, 2017/02
Free full text
2201

Vom Aufhängeband zum Organ: neue Forschungsergebnisse zum Mesenterium
From the suspensory ligament to the organ: New findings on the mesentery
Plathner, M.
Osteopathische Medizin, 2017/02
2202

Motorische Entwicklung eines Säuglings: Idealbild und Abweichungen
(Motor development of an infant: Ideal and deviations)
Strunk, A.
Osteopathische Medizin, 2017/02
2203

Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/02
2204

The strain - Counter strain technique in the management of anterior interosseous nerve syndrome: A case report
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S.
Journal of Taibah University Medical Sciences, 2017/02
Free full text
2205

Pectus Excavatum: A Review of Diagnosis and Current Treatment Options
Abid, I., Ewais, M. M., Marranca, J., Jaroszewski, D. E.
The Journal of the American Osteopathic Association, 2017/02
Free full text
2206

Do you hear me?: the caregivers' experience of osteopathy for their child’s otitis media
McCulloch, J.
Unpublished MSc thesis, 2017/02
Free full text
2207

Somatic Dysfunction in the Diagnosis of Uncommon Ectopic Pregnancies: Surgical Correlation and Comparison With Related Pathologic Findings
Martingano, D., Canepa, H., Fararooy, S., Rybitskiy, D., Shahem, S., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2017/02
Free full text
2208

Auswirkungen einer cranialen Technik auf die Herzratenvariabilität
(Effects of a cranial technique on the heart rate variability)
Hauser, B. D.
Unpublished MSc thesis, 2017/02
Free full text
2209

Osteopathische Behandlung chronischer unspezifischer Nackenschmerzen
(Osteopathic treatment of chronic nonspecific neck pain)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2017/02
2210

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/
2211

Developing an integrated osteopathy and acceptance-informed pain management course for patients with persistent pain
Abbey, H. A.
Unpublished PhD thesis, 2017/01
Free full text
2212

Osteopathic Philosophy and Manipulation Enhancement Program: Influence on Osteopathic Medical Students' Interest in Osteopathic Manipulative Medicine
Volokitin, M., Ganapathiraju, P. V.
The Journal of the American Osteopathic Association, 2017/01
Free full text
2213

Die venöse Sinustechnik – Drainage der venösen Blutleiter
(The venous sinus technique - drainage of venous blood vessels)
Percival, H., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2214

Évaluation de l’efficacité d’un traitement ostéopathique structurel chez des patients atteints de céphalées de tension
(Evaluation of the efficacy of structural osteopathic treatment in patients with tension-type headache)
Hug, A.
Unpublished MSc thesis, 2017/01
2215

CranioSacral Therapy and Visceral Manipulation: A New Treatment Intervention for Concussion Recovery
Wetzler, G., Roland, M., Fryer-Dietz, S., Dettmann-Ahern, D.
Medical Acupuncture, 2017/01
Free full text
2216

Osteopathic Manipulative Treatment Limits Chronic Constipation in a Child with Pitt-Hopkins Syndrome
Aquino, A., Perini, M., Cosmai, S., Zanon, S., Pisa, V., Castagna, C., Uberti, S.
Case Reports in Pediatrics, 2017/01
Free full text
2217

Integration of osteopathic manual treatments in management of cervical dystonia with tremor: A case series
Halimi, M., Leder, A., Mancini, J. D.
Tremor and Other Hyperkinetic Movements, 2017/01
Free full text
2218

Osteopathie und Psyche
(Osteopathy and Psyche)
Tschinkel, M.
Unpublished MSc thesis, 2017/01
Free full text
2219

The role of gentle touch in perinatal osteopathic manual therapy
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Neuroscience and Biobehavioral Reviews, 2017/01
2220

Knee Pain in Adults with an Osteopathic Component
Datta, R., Burina, L., Romanelli, F., Flaum, T. B.
Osteopathic Family Physician, 2017/01
Free full text
2221

The role of New Zealand osteopaths in the care of people who experience migraine: a qualitative exploration
Chaise, K.
Unpublished MSc thesis, 2017/01
Free full text
2222

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text
2223

Osteopathische Behandlung eines Descensus genitalis und dessen Begleitsymptome bei Frauen. Eine Vergleichsstudie von Osteopathie und Elektrostimulation/Biofeedback für den Beckenboden
(Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative study of osteopathy and electrostimulation / biofeedback for pelvic floor)
Bogner, D.
Unpublished MSc thesis, 2017/01
Free full text
2224

Der kurzfristige Effekt des General Osteopathic Treatment auf die Beweglichkeit bei jungen Frauen am Beispiel “Finger-Boden-Abstand“. Eine quasi randomisierte, einfach verblindete, experimentelle Studie
(The short-term effect of General Osteopathic Treatment (GOT) on the mobility of young women using the Finger-Floor-Distance test (FFD). A quasi-randomized, single blinded, experimental study)
Dutzler, R.
Unpublished MSc thesis, 2017/01
Free full text
2225

Effectiveness of Osteopathic Therapy in the Treatment of Oral Submucous Fibrosis
Goyal, M., Aggarwal, A., Goyal, K., Garg, P.
Contemporary Clinical Dentistry, 2017/01
Free full text
2226

Effektivität von Osteopathie bei Patienten mit Migräne - ein Systematic Review
(The Effectiveness of Osteopathy in Treating Patients Suffering from Migraine - a Systematic Review)
Michlits-Lichtenecker, D.
Unpublished MSc thesis, 2017/01
Free full text
2227

Der osteopathische Ansatz beim allergischen Patienten
(The osteopathic approach to allergic patients)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2228

How Osteopathy Could Help Obstetrics in Diagnosis and Therapy. Preliminary Report About Safety and Efficacy of Osteopathy in an Obstetrics Department in Italy
Siccardi, M., Valle, C., Di Matteo, F., Perlo, B., Pratticò, M., Angius, V., Bianco, G., Damonte, V., Giusto, S., Palezzato, E., Tabò, M., Brichetto, C., Valle, P., Zolezzi, A., Parodi, G., Airaudi, G.
Journal of Perinatal Medicine, 2017/01
2229

Osteopathic Manipulative Treatment of Primary Dysmenorrhea and Related Factors: A Randomized Controlled Trial
Zecchillo, D., Acquati, A., Aquino, A., Pisa, V., Uberti, S., Ratti, S.
International Journal of Medical Research & Health Sciences, 2017
Free full text
2230

Osteopathische Behandlung des Reizdarmsyndroms – ein Review
(Osteopathic treatment of irritable bowel syndrome - A review)
Krüger, S.
Osteopathische Medizin, 2016/12
2231

A Review of Hypertension and Its Management by Osteopathic Manipulative Therapy
Miller, A. D.
The AAO Journal, 2016/12
2232

Relationship Between Falls and Complementary and Alternative Medicine Use Among Community-Dwelling Older Adults
Caron, A., Gallo, W. T., Durbin, L. L., Mielenz, T. J.
The Journal of Alternative and Complementary Medicine, 2016/12
2233

Assessment of Hospital Staff's Knowledge of Osteopathic Manipulative Medicine: A Survey-Based Study
Smith-Kelly, J. B., Cardenas, A.
The Journal of the American Osteopathic Association, 2016/12
Free full text
2234

What can osteopaths learn from concerns and complaints raised against them? A review of insurance and regulator reports
Carnes, D.
International Journal of Osteopathic Medicine, 2016/12
2235

Säuglinge mit frühkindlicher Regulationsstörung – eine Pilotstudie
(Infants with early childhood regulation disorder - A pilot study)
Wikus, P.
Osteopathische Medizin, 2016/12
2236

Reliability of Diagnosis and Clinical Efficacy of Cranial Osteopathy: A Systematic Review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
PLoS One, 2016/12
Free full text
2237

Efficacy of an Osteopathic Treatment Coupled With Lactation Consultations for Infants' Biomechanical Sucking Difficulties
Herzhaft-Le Roy, J., Xhignesse, M., Gaboury, I.
Journal of Human Lactation, 2016/12
2238

Osteopathic Manipulative Treatment for Somatic Dysfunction After Acute Severe Traumatic Brain Injury
McCallister, A., Brown, C., Smith, M., Ettlinger, H., Baltazar, G. A.
The Journal of the American Osteopathic Association, 2016/12
Free full text
2239

Effects of osteopathic manipulative treatment on hand function, disease symptoms and functional status in systemic sclerosis: a series of single-case studies in working women
O'Connor, S., Durand, M. J., Hudson, M., Baron, M., Gaudreault, N.
International Journal of Osteopathic Medicine, 2016/12
2240

Effectiveness of osteopathic manipulative treatment versus osteopathy in the cranial field in temporomandibular disorders - a pilot study
Gesslbauer, C., Vavti, N., Keilani, M., Mickel, M., Crevenna, R.
Disability and Rehabilitation, 2016/12
2241

Entwicklungstests für Säuglinge und Kleinkinder: Hintergründe und praktische Empfehlungen
(Developmental tests for infants and toddlers: Backgrounds and practical recommendations)
Hohendahl, J.
Osteopathische Medizin, 2016/12
2242

Does replacing live demonstration with instructional videos improve student satisfaction and osteopathic manipulative treatment examination performance?
Seals, R., Gustowski, S. M., Kominski, C., Li, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2243

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: The PROMOTE Study Protocol
Hensel, K. L., Carnes, M. S., Stoll, S. T.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2244

PROMOTE Study: Safety of Osteopathic Manipulative Treatment During the Third Trimester by Labor and Delivery Outcomes
Hensel, K. L., Roane, B. M., Chaphekar, A. V., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2245

Effects of osteopathic treatment on pulmonary function and chronic thoracic pain after coronary artery bypass graft surgery (OstinCaRe): study protocol for a randomised controlled trial
Roncada, G.
BMC Complementary and Alternative Medicine, 2016/11
Free full text
2246

Vergleich der Effektivität einer osteopathischen mit einer ausschließlich craniosacralen Therapie bei Temporomandibulärer Dysfunktion – eine Pilotstudie
(Comparison of the effectiveness of osteopathic versus craniosacral treatment for temporomandibular dysfunction - a pilot study.)
Gesslbauer, C., Keilani, M., Nicolakis, P., Mickel, M., Vavti, N., Crevenna, R.
Physikalische Medizin, Rehabilitationsmedizin, Kurortmedizin, 2016/11
2247

Das Potential osteopathisch manipulativer Therapie Myofibroblastenaktivität zu beeinflussen
(The potential of osteopathic manipulative therapy in regulating myofibroblast activity)
Hofbauer, A.
Unpublished MSc thesis, 2016/11
Free full text
2248

How do the Number and the Duration Between Osteopathic Treatments Influence the Effect on Patients Suffering from Foot-Related Pain? A Dose-Response Study
Kaufmann, J., Larsen, S.
International Journal of Pharma and Bio Sciences, 2016/11
Free full text
2249

A model for radiating leg pain of endometriosis
Bove, G. M.
Journal of Bodywork and Movement Therapies, 2016/10
2250

T4 syndrome – A distinct theoretical concept or elusive clinical entity? A case report
Hirai, P. M., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2016/10
2251

Multimodal compared to pharmacologic treatments for chronic tension-type headache in adolescents
Przekop, P., Przekop, A., Haviland, M. G.
Journal of Bodywork and Movement Therapies, 2016/10
2252

Osteopathic manipulative treatment in neurological diseases: Systematic review of the literature
Cerritelli, F., Ruffini, N., Lacorte, E., Vanacore, N.
Journal of the Neurological Sciences, 2016/10
2253

Manual therapy and OMT may be of benefit in the management of somatosensory tinnitus
King, H. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2254

A craniosacral osteopathic approach can help improve olfactory function in patient with a diminished sense of smell following head trauma
Barrette, M., Legault, K., Pomerleau, N., Ricard, M.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2255

Can postural manual osteopathic intervention improve temporo-mandibular joint (TMJ) opening in a client with scoliosis?
Bétournay, M., Desgagnes, A., Tran-Nguyen, B.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2256

Is cranial mobility affecting school performance and can osteopathic manual treatment (OMT) improve it? Results from a pilot study with children in a regular elementary curriculum
Bouchard, A.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2257

Can manual osteopathic techniques performed on the small and large intestines reduce the symptoms associated with irritable bowel syndrome?
Choquette, J., Plante, S., Sabourin, D.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2258

The effect of the compression of the fourth ventricle (CV4) on uterine contractions at term – A quasi-experimental study
Fafard, A.M., Trottier, N., Morand, A.J.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2259

Efficacy of an osteopathic treatment for biomechanical suckling dysfunctions in newborn: A randomised controlled trial
Herzhaft-LeRoy, J., Gaboury, I., Xhignesse, M.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2260

Osteopathie als zusätzliche Therapie bei Kindern mit akuten Lungenentzündungen in Kambodscha. - Eine randomisiert-kontrollierte Pilotstudie.
(Osteopathic Manipulative Therapy as Adjunctive Treatment on Hospitalized Children with Pneumonia in Cambodia. - A randomized-controlled Pilotstudy)
Orsini-Rosenberg, T.
Unpublished MSc thesis, 2016/10
Free full text
2261

The effects of osteopathic treatment on snapping hip syndrome in ballet and contemporary dancers: A longtudinal study
Ryder, C.
Journal of Complementary and Integrative Medicine, 2016/10
2262

Manual Therapy in the Treatment of Idiopathic Scoliosis. Analysis of Current Knowledge
Czaprowski, D.
Ortopedia, Traumatologia, Rehabilitacja, 2016/10
Free full text
2263

Die osteopathische Behandlung von Kindern mit idiopathischer Säuglingsasymmetrie im Vergleich zur physiotherapeutischen Behandlung. Randomisierte kontrollierte Studie.
(Osteopathic treatment compared to physiotherapy in infants with idiopathic postural asymmetry. A randomized controlled trial)
Lange, T., Kramer, U., Hasemann, B.
Unpublished D.O. thesis, 2016/10
2264

Untersuchung der Effektivität der osteopathischen Behandlung bei Patienten mit Hypercholesterinämie mit mäßig erhöhten Gesamtcholesterinwerten. Randomisierte kontrollierte Studie.
(Evaluation of effectiveness of osteopathic treatment in patients with moderate hypercholesterolemia. A randomized controlled trial)
Liedl, T., Pinter, K.
Unpublished D.O. thesis, 2016/10
2265

Osteopathische Behandlung von Patienten mit gastroösophagealer Refluxkrankheit (GÖR) additiv zur medikamentösen Standardtherapie. Randomisierte kontrollierte Studie.
(Osteopathic treatment in addition to usual care in patients with Gastroesophageal Reflux Disease (GERD). A randomized controlled trial)
Lynen, A., Schömitz, M., Vahle, M.
Unpublished D.O. thesis, 2016/10
2266

Current clinical practices, experiences, and perspectives of healthcare practitioners who attend to dysfunctional breathing: A qualitative study
Shaw, J.
Unpublished MSc thesis, 2016/10
Free full text
2267

Manual therapy and cervical artery dysfunction: Identification of potential risk factors in clinical encounters
Vaughan, B., Moran, R., Tehan, P., Fryer, G., Holmes, M., Vogel, S., Taylor, A.
International Journal of Osteopathic Medicine, 2016/09
2268

Osteopathische Imagination – ein Weg zur osteopathischen Selbstbehandlung
(Osteopathic Imagination - A way to osteopathic self-treatment)
Liedtke, H.
Osteopathische Medizin, 2016/09
2269

Die Regio inguinalis dextra aus osteopathischer Sicht
(The regio inguinalis dextra from an osteopathic point of view)
Kuschel, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2270

Spine Tango registry data collection in a conservative spinal service: a feasibility study
Morris, S., Booth, J., Hegarty, J.
European Spine Journal, 2016/09
2271

The Attitudes of Physicians, Nurses, Physical Therapists, and Midwives Toward Complementary Medicine for Chronic Pain: A Survey at an Academic Hospital
Aveni, E., Bauer, B., Ramelet, A. S., Kottelat, Y., Decosterd, I., Finti, G., Ballabeni, P., Bonvin, E., Rodondi, P. Y.
Explore (NY), 2016/09
2272

Lumbalgie bei Uterusdeszensus
(Low back pain in uterine descent)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2273

Patienteninfo: Leben ist Bewegung
(Patient information: Life is movement)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2274

Osteopathic Manipulative Therapy for Preterm Infants, Acupuncture for Menopausal Symptoms, Mindfulness-Based Stress Reduction for Chronic Low Back Pain, Chocolate for Ischemic Heart Disease, Berberine for Irritable Bowel Syndrome
Pettit, J., Glickman-Simon, R.
Explore (NY), 2016/09
2275

Die viszeralen Behandlungen des Andrew Taylor Still
(The visceral treatments of Andrew Taylor Still)
Marx, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2276

The Incidence of Somatic Dysfunction in Patients with Sudden Onset Atraumatic Neck Pain: A Retrospective Case Note Study
Snider, K. T., Ghouse, A., He, S. S., Pazdernik, V. K.
The AAO Journal, 2016/09
2277

Osteopathy for Endometriosis and Chronic Pelvic Pain - a Pilot Study
Sillem, M., Juhasz-Boss, I., Klausmeier, I., Mechsner, S., Siedentopf, F., Solomayer, E.
Geburtshilfe Frauenheilkunde, 2016/09
2278

Integrative Behandlung der Nebennieren in der Osteopathie
(Integrative treatment of the adrenal glands in osteopathy)
Namer, V., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2279

Neurovaskuläre Mobilisation des Plexus hypogastricus inferior
(Neurovascular mobilization of the inferior hypogastric plexus)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2016/09
2280

Neue Ansätze für die Behandlung viszeraler Strukturen über den Schädel
(New approaches for the treatment of visceral structures via the skull)
Riedel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2281

Osteopathic Manipulative Treatment in Pediatric and Neonatal Patients and Disorders: Clinical Considerations and Updated Review of the Existing Literature
Bagagiolo, D., Didio, A., Sbarbaro, M., Priolo, C. G., Borro, T., Farina, D.
American Journal of Perinatology, 2016/09
2282

Preliminary development of a complex intervention for osteopathic management of dysfunctional breathing
Benjamin, J. G., Bacon, C. J., Verhoeff, W. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/09
2283

R18 - Osteopathy for Post-Mastectomy Pain Syndrome (PMPS) in early breast cancer (EBC) patients: a pilot study in an Italian Oncology Unit
Putignano, F., Bidin, L., Belfiglio, B., Bordoni, F., Seghini, P., Cavanna, L.
Annals of Oncology, 2016/09
2284

Einfluss osteopathischer Techniken auf das Lymph- und Immunsystem – eine systematische Übersichtsarbeit
(Influence of osteopathic techniques on the lymphatic and immune system - a systematic review)
Unger, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2285

Haftungsfälle in der osteopathischen Praxis
(Cases of liability in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2286

Tensegrity and manual therapy practice: a qualitative study
Hohenschurz-Schmidt, D. J., Esteves, J. E., Thomson, O. P.
International Journal of Osteopathic Medicine, 2016/09
2287

Behandlung der viszeralen Gefäße aus osteopathischer Sicht
(Treatment of the visceral vessels from an osteopathic point of view)
Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2288

The effect of osteopathic intervention and corrective exercise on golf performance: a prospective case series
Miles, J. I. W.
Unpublished MSc thesis, 2016/09
Free full text
2289

Case report of osteopathic treatment of insomnia and traumatic anhidrosis
Nobles, T., Bach, A., Boesler, D.
International Journal of Osteopathic Medicine, 2016/09
2290

Factors affecting help-seeking behaviour of women with urinary incontinence; a commentary providing insights for osteopaths
Robinson, M., Humpage, C.
International Journal of Osteopathic Medicine, 2016/09
2291

The potential of osteopathic manipulative treatment in antimicrobial stewardship: A narrative review
Noll, D. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
2292

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text
2293

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text
2294

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text
2295

The effectiveness of complementary manual therapies for pregnancy-related back and pelvic pain A systematic review with meta-analysis
Hall, H., Cramer, H., Sundberg, T., Ward, L., Adams, J., Moore, C., Sibbritt, D., Lauche, R.
Medicine (Baltimore), 2016/08
Free full text
2296

The paradox of sham therapy and placebo effect in osteopathy: A systematic review
Cerritelli, F., Verzella, M., Cicchitti, L., D', Alessandro, G., Vanacore, N.
Medicine (Baltimore), 2016/08
Free full text
2297

Osteopathic Manual Treatment for Amyotrophic Lateral Sclerosis: A Feasibility Pilot Study
Maggiani, A., Tremolizzo, L., Della Valentina, A., Mapelli, L., Sosio, S., Milano, V., Bianchi, M., Badi, F., Lavazza, C., Grandini, M., Corna, G., Prometti, P., Lunetta, C., Riva, N., Ferri, A., Lanfranconi, F., Me, Study
The Open Neurology Journal, 2016/08
Free full text
2298

The effect of osteopathic manual therapy with breathing retraining on dysfunctional breathing and exercise economy: a randomised controlled trial
Barnett, L. E.
Unpublished MSc thesis, 2016/08
Free full text
2299

Psychoneuroimmunologie: eine osteopathische Annäherung
(Psychoneuroimmunology: an osteopathic approach)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
2300

HVLA or Stretch May Not Be Necessary for Nonspecific Back or Neck Pain Relief
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2016/07
Free full text
2301

Naturheilkunde und Komplementarmedizin in medizinischen Leitlinien - konnen europaische Normen Leitlinien fur Naturheilkunde und Komplementarmedizin verdrangen?
(Naturopathy and Complementary Medicine in Medical Guidelines - Can European Standards Replace Guidelines for Naturopathy and Complementary Medicine?)
Jutte, R.
Forschende Komplementärmedizin, 2016/07
2302

Repeat-measures longitudinal study evaluating behavioural and gastrointestinal symptoms in children with autism before, during and after visceral osteopathic technique (VOT)
Bramati-Castellarin, I., Patel, V. B., Drysdale, I. P.
Journal of Bodywork and Movement Therapies, 2016/07
2303

Exploration of clinical changes following a novel mobilisation technique for treatment of chronic low back pain: A single cohort design
Hanson, G. C., Jones, B., Bacon, C. J., Moran, R. W.
Journal of Bodywork and Movement Therapies, 2016/07
2304

Dynamik der Gedanken oder wenn das Denken den Rhythmus lähmt
(Dynamics of thinking or when thinking paralyzes rhythm)
Schöndorfer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
2305

Osteopathic manipulative therapy is feasible and safe after abdominal surgery
King, H. H.
The Journal of the American Osteopathic Association, 2016/07
Free full text
2306

The Use of COMLEX-USA and USMLE for Residency Applicant Selection
Sandella, J. M., Gimpel, J. R., Smith, L. L., Boulet, J. R.
Journal of Graduate Medical Education, 2016/07
Free full text
2307

Psyche und Hormonsystem – Dirigenten unseres Lebens
(Psyche and endocrine system - conductors of our life)
Vogt, E. S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
2308

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text
2309

Management of Cesarean Deliveries and Cesarean Scars With Osteopathic Manipulative Treatment: A Brief Report
Martingano, D.
The Journal of the American Osteopathic Association, 2016/07
Free full text
2310

Osteopathic Approach to the Diagnosis of Appendiceal Mucinous Cystadenocarcinoma Mimicking Primary Ovarian Malignant Neoplasm
Martingano, D., Gurm, H., Oliff, A., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2016/07
Free full text
2311

Pseudoischialgie bei Dysfunktion der Fibula
(Pseudo sciatica in dysfunction of the fibula)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
2312

Confirmatory factor analysis of the Study Process Questionnaire in an Australian osteopathy student population
Vaughan, Brett
International Journal of Osteopathic Medicine, 2016/06
2313

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text
2314

The use of osteopathic manipulative treatment as part of an integrated treatment for infantile colic:A case report
Snider, K. T.
The AAO Journal, 2016/06
2315

Response of Tinnitus to Osteopathic Manipulation
Kurisu, M., Alexander, J., Fleming, J., King, H.
Journal of Integrative and Complementary Medicine, 2016/06
2316

(The polyvagal theory in osteopathy)
Porges, S. W., Liem, T.
Osteopathische Medizin, 2016/06
2317

Behandlungsvertrag in der Osteopathie – Warum ist er wichtig?
(Treatment contract in osteopathy - Why is it important?)
Schröder, B.
Osteopathische Medizin, 2016/06
2318

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06
2319

Osteopatia e lombalgia
(Osteopathy and low back pain)
de Oliveira Meirelles, F.
Unpublished MSc thesis, 2016/06
Free full text
2320

Osteopathic manipulative treatment in gynecology and obstetrics: A systematic review
Ruffini, N., D'Alessandro, G., Cardinali, L., Frondaroli, F., Cerritelli, F.
Complementary Therapies in Clinical Practice, 2016/06
2321

Sensomotorische Entwicklung und pädiatrische Osteopathie
(Sensorimotor development and pediatric osteopathy)
Ava Levin, V., Levin, P.
Osteopathische Medizin, 2016/06
2322

Randomised controlled pilot trial on feasibility, safety and effectiveness of osteopathic MANipulative treatment following major abdominal surgery (OMANT pilot trial)
Probst, P., Büchler, E., Doerr-Harim, C., Knebel, P., Thiel, B., Ulrich, A., Diener, M. K.
International Journal of Osteopathic Medicine, 2016/06
2323

O desenvolvimento profissional do osteopata: Representações de profissionais em início decarreira
(The professional development of an osteopath: Representations of early-career professionals)
Pedro, J. C. F.
Unpublished MSc thesis, 2016/06
Free full text
2324

Osteopathische Behandlungstechnik für die Fascia clavipectoralis
(Osteopathic treatment techniques for fascia clavipectoralis)
Baumgart, V.
Osteopathische Medizin, 2016/06
2325

Ergänzende Anmerkungen zum Artikel „Osteopathische Behandlungstechnik für die Fascia clavipectoralis”
(Supplementary notes on the article “Osteopathic treatment techniques for fascia clavipectoralis“)
Hartwig, B.
Osteopathische Medizin, 2016/06
2326

Experiences of intervertebral motion palpation in osteopathic practice – A qualitative interview study among Swedish osteopaths
Sposato, N. S., Bjerså, K.
Journal of Bodywork and Movement Therapies, 2016/05
2327

Eye contact, appetite, and vomiting improved in children with autism spectrum disorder after visceral osteopathic technique
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
2328

Significant Benefit Shown After Lumbar Disk Surgery Rehabilitation by Inclusion of Osteopathic Intervention
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
2329

Postural Balance and Gait Improved With an Osteopathic Intervention in a Special Needs Population
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
2330

Non-specific mechanisms in orthodox and CAM management of low back pain (MOCAM): theoretical framework and protocol for a prospective cohort study
Bradbury, K., Al-Abbadey, M., Carnes, D., Dimitrov, B. D., Eardley, S., Fawkes, C., Foster, J., Greville-Harris, M., Harvey, J. M., Leach, J., Lewith, G., MacPherson, H., Roberts, L., Parry, L., Yardley, L., Bishop, F. L.
BMJ Open, 2016/05
2331

Proposed Amendments to the AOA Constitution, Bylaws, and Code of Ethics
listed, No authors
The Journal of the American Osteopathic Association, 2016/05
Free full text
2332

Osteopathic considerations in obstructive pulmonary disease: A systematic review of the evidence
Raguckas, C., Ference, J., Gross, G. A.
Osteopathic Family Physician, 2016/05
Free full text
2333

The mini Clinical Evaluation Exercise (mini-CEX) in a pre-registration osteopathy program: Exploring aspects of its validity
Vaughan, B., Moore, K.
International Journal of Osteopathic Medicine, 2016/03
2334

Osteopathic Manipulative Treatment improves gait pattern and posture in adult patients with Prader–Willi syndrome
Vismara, L., Cimolin, V., Galli, M., Grugni, G., Ancillao, A., Capodaglio, P.
International Journal of Osteopathic Medicine, 2016/03
2335

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2336

Somatic Dysfunction: A Principled Approach to Diagnosis and the Selection of OMT Modalities
Hruby, R. J.
The AAO Journal, 2016/03
2337

Reduziert die Osteopathische Behandlung die Dauer des Neonatalen Abstinenzsyndroms? Eine Pilotstudie
(Does an osteopathic treatment reduce the duration of the neonatal abstinence syndrome? A Pilot Study)
Sander, K.
Unpublished MSc thesis, 2016/03
Free full text
2338

Pilotstudie: Reduziert die Osteopathische Behandlung die Dauer des Neonatalen Abstinenzsyndroms?
(Pilot study: Does an osteopathic treatment reduce the duration of the neonatal abstinence syndrome?)
Sander, K.
Unpublished MSc thesis, 2016/03
Free full text
2339

The Use of Osteopathic Manipulative Treatment for Acute Dental Pain: A Case Report
Snider, K. T.
The AAO Journal, 2016/03
2340

Resolution of Concussion Symptoms After Osteopathic Manipulative Treatment: A Case Report
Guernsey, D. T., Leder, A., Yao, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2341

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2342

Hörsturz bei einem Kind nach Beginn einer kieferorthopädischen Behandlung
(Hearing loss in a child after start of an orthodontic treatment)
Refle, S.
Osteopathische Medizin, 2016/03
2343

Groß- und Minderwuchs in der osteopathischen Praxis
(Large and small stature in osteopathic practice)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2344

Craniomandibuläre Dysfunktion. Welchen Stellenwert hat Osteopathie in der interdisziplinären Behandlung von Patienten mit craniomandibulärer Dysfunktion (CMD) in Bezug auf Lebensqualität?
(What influence on quality of life does osteopathy have in interdisciplinary treatment of patients suffering from temporomandibular disorder?)
Schmidt, N.
Unpublished MSc thesis, 2016/03
Free full text
2345

Targeting Patient Subgroups With Chronic Low Back Pain for Osteopathic Manipulative Treatment: Responder Analyses From a Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2346

Die Veränderung der venösen Wiederauffüllzeit bei Patientinnen und Patienten mit Chronisch-venöser Insuffizienz nach osteopathischer Intervention
(Changes of Venous Refill Time in Male and Female Patients with Chronic Venous Insufficiency after Osteopathic Intervention)
Pink, S.
Unpublished MSc thesis, 2016/03
Free full text
2347

Recovery From Chronic Low Back Pain After Osteopathic Manipulative Treatment: A Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2348

Understanding clinical reasoning in osteopathy: a qualitative research approach
Grace, S., Orrock, P., Vaughan, B., Blaich, R., Coutts, R.
Chiropractic & Manual Therapies, 2016/03
Free full text
2349

Die Beeinflussung der Kapazität der Vena portae durch eine Mobilisierung der Leber gemessen mit Doppler-Ultraschall
(Influence of osteopathic treatment on the capacity of the portal vein through a mobilisation of liver measured by Doppler ultrasonography)
Maier, M.
Unpublished MSc thesis, 2016/03
Free full text
2350

Osteopathie bei Infantiler Cerebralparese
(Osteopathy for Infant Cerebral Palsy)
Budroni, J.
Unpublished MSc thesis, 2016/03
Free full text
2351

Commitment der österreichischen Osteopathinnen zur Osteopathie und zur Österreichischen Gesellschaft für Osteopathie
(Commitment of Austrian osteopaths to osteopathy and to the Austrian Society for Osteopathy (OEGO))
Unpublished MSc thesis, 2016/03
2352

Resolution of New Daily Persistent Headache After Osteopathic Manipulative Treatment
Alexander, J.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2353

Constipation: A review with osteopathic consideration
Cole, S., Moore, C., Shah, P.
Osteopathic Family Physician, 2016/03
2354

Assessment of Australian osteopathic learners
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03
2355

Auswirkungen von frühkindlichem Stress auf das neuroendokrine System und Immunsystem
(Effects of early childhood stress on the neuroendocrine system and immune system)
Carter, P. V.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2356

Schlafstörungen und Epiphyse
(Sleep disorders and pineal gland)
Clostermann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2357

Osteopaths' clinical reasoning during consultation with patients experiencing acute low back pain: A qualitative case study approach
Roots, S. A., Niven, E., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/03
2358

Klinische Effektivität einer osteopathischen Behandlung bei Migräne
(Clinical effectiveness of osteopathic treatment for migraines)
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Osteopathische Medizin, 2016/03
2359

Assessment of Australian osteopathic learners' clinical competence during workplace learning
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03
2360

Osteopathic approach to chronic constipation in Prader–Willi Syndrome: A case report
Smith, L., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2016/03
2361

Concussions and Osteopathic Manipulative Treatment: An Adolescent Case Presentation
Castillo, I., Wolf, K., Rakowsky, A.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2362

Osteopathic manipulative treatment for older patients: A national survey of osteopathic physicians
Channell, M. K., Wang, Y., McLaughlin, M. H., Ciesielski, J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2363

Research Into Osteopathic Manipulative Medicine: Steps on the Evidence Pyramid
Ching, L. M.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2364

Ergänzende Anmerkungen zum Artikel „Faszien: Verbindungen zwischen Perikard und umgebenden Strukturen”
(Supplementary comments on the article “Fascia: Connections between pericardium and surrounding structures“)
Hartwig, B.
Osteopathische Medizin, 2016/03
2365

Funktionelle Aspekte der Dura sacralis und des anokokzygealen „Verspannungsapparates”
(Funktionelle Aspekte der Dura sacralis und des anokokzygealen „Verspannungsapparates”)
Hörmann, R., Brenner, E., Künzel, K.H.
Osteopathische Medizin, 2016/03
2366

Abdominal Trigger Points and Psychological Function
Reeves, R. R., Ladner, M. E.
The Journal of the American Osteopathic Association, 2016/02
Free full text
2367

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text
2368

The effect of the combination of dry needling and MET on latent trigger point upper trapezius in females
Yeganeh Lari, A., Okhovatian, F., Naimi, Ss, Baghban, A. A.
Manual Therapy, 2016/02
2369

Osteopathic clinical reasoning: an ethnographic study of perceptual diagnostic judgments, metacognition, and reflective practice
McIntyre, C. L.
Unpublished PhD thesis, 2016/01
Free full text
2370

Use of complementary and alternative medicine (CAM) by parents in their children and adolescents with epilepsy - Prevelance, predictors and parents' assessment
Hartmann, N., Neininger, M. P., Bernhard, M. K., Syrbe, S., Nickel, P., Merkenschlager, A., Kiess, W., Bertsche, T., Bertsche, A.
European Journal of Paediatric Neurology, 2016/01
2371

Altersbedingte Veränderungen des Herz-Kreislauf-Systems
(Age-related changes in the cardiovascular system)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2372

Die Faszien im Alter
(Fascia in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2373

Prevalence and characteristics of women who consult with osteopathic practitioners during pregnancy; a report from the Australian Longitudinal Study on Women's Health (ALSWH)
Frawley, J., Sundberg, T., Steel, A., Sibbritt, D., Broom, A., Adams, J.
Journal of Bodywork and Movement Therapies, 2016/01
2374

Lumbosakrale Schmerzen und Miktionsbeschwerden bei benignem Prostatasyndrom (BPS)
(Lumbosacral pain and micturition symptoms in benign prostatic hyperplasia (BPH))
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2375

Bluthochdruck im Alter
(Hypertension in old age)
Seidler, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2376

General Movements in preterm infants undergoing craniosacral therapy: a randomised controlled pilot-trial
Raith, W., Marschik, P. B., Sommer, C., Maurer-Fellbaum, U., Amhofer, C., Avian, A., Lowenstein, E., Soral, S., Muller, W., Einspieler, C., Urlesberger, B.
BMC Complementary and Alternative Medicine, 2016/01
Free full text
2377

As the Twig Is Bent, so Grows the Tree-Part 6: In a Multicenter Study, OMTh Shortens Length of Stay in the Neonatal Intensive Care Unit
King, H. H.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2378

Muscle energy technique improves chronic lateral epicondylitis
Koh, C., III, Seffinger
The Journal of the American Osteopathic Association, 2016/01
Free full text
2379

Rechtliches rund um die osteopathische Praxis: Heilpraktikergesetz und GKV-Erstattungspraxis
(Non-Medical Practitioners Act and GKV reimbursement practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2380

An indication of current views of Australian general practitioners towards chiropractic and osteopathy: a cross-sectional study
Engel, R. M., Beirman, R., Grace, S.
Chiropractic & Manual Therapies, 2016/01
Free full text
2381

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2382

Management of Acute Isolated Soleal Vein Thrombosis in a Pregnant Patient With an Osteopathic Approach to Evaluation
Martingano, D., Eisenberg, J., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2383

The acute effects of a standardised osteopathic manual therapy protocol on the vertical jump and reach performance in healthy basketball players: a cross-over design
Hall, J.
Unpublished MSc thesis, 2016/01
Free full text
2384

An osteopathic approach to the treatment of ovarian cancer
Martingano, D., Cannon, M., Williams, S., Stoner, A.
Osteopathic Family Physician, 2016/01
Free full text
2385

Multicenter Osteopathic Pneumonia Study in the Elderly: Subgroup Analysis on Hospital Length of Stay, Ventilator-Dependent Respiratory Failure Rate, and In-hospital Mortality Rate
Noll, D. R., Degenhardt, B. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2386

Review über die osteopathische Behandlung bei obstruktiven Lungenerkrankungen – eine systematische Literaturrecherche
(OMT for obstructice pulmonary diseases – a systematic review)
Schäfer, M.
unpublished D.O. thesis, 2016
Free full text
2387

A systematic review suggests inflammation could favour spontaneous lumbar disc herniation regression especially for more severe stages of herniation
Vaucher, P.
International Journal of Osteopathic Medicine, 2015/12
2388

Assessment in the final year clinical practicum of an Australian osteopathy program
Vaughan, B., Morrison, T.
International Journal of Osteopathic Medicine, 2015/12
2389

The Osteopathic Clinical Practice Assessment – a pilot study to develop a new workplace-based assessment tool
Vaughan, B., Moore, K.
International Journal of Osteopathic Medicine, 2015/12
2390

Acceleration of clinician hand movements during spinal manipulative therapy
Walker, S.
International Journal of Osteopathic Medicine, 2015/12
2391

Effect of Select Osteopathic Manipulative Treatment Techniques on Patients With Acute Rhinosinusitis
Nishida, Y., Sopchak, M. M., Jackson, M. R., Andersonning, T. R., Leikert, E. P., Goldman, S. I., Jarski, R. W.
The AAO Journal, 2015/12
2392

The Educational Model of Private Colleges of Osteopathic Medicine: Revisited for 2003-2013
Cummings, M.
Academic Medicine, 2015/12
Free full text
2393

Osteopathische Behandlung der Symphysensprengung – ein Fallbeispiel
(Osteopathic treatment of symphyseal disruption - A case study)
Past, A.
Osteopathische Medizin, 2015/12
2394

Kindernöte verstehen – das Bewegungsverhalten von Babys und Kindern
(Understanding children's afflictions - The movement behavior of babies and children)
Ritter, K.
Osteopathische Medizin, 2015/12
2395

Osteopathic manipulative treatment for chronic nonspecific neck pain: A systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
International Journal of Osteopathic Medicine, 2015/12
2396

The anatomy, biological plausibility and efficacy of visceral mobilization in the treatment of pelvic floor dysfunction
Horton, R. C.
Journal of Pelvic, Obstetric Gynaecological Physiotherapy, 2015/12
Free full text
2397

Intra-oral osteopathic technique for chronic temporomandibular disorders
Frederikson, H.
Unpublished MSc thesis, 2015/12
Free full text
2398

Osteopathic treatment for unsettled, fussy and irritable infants in their first year of life: mothers’ experiences and effect on infant temperament
Covich, O. A.
Unpublished MSc thesis, 2015/12
Free full text
2399

Conditioned placebo analgesia persists when subjects know they are receiving a placebo
Raiher, J.
International Journal of Osteopathic Medicine, 2015/12
2400

Scimitar syndrome: A rare explanation for a common symptom with an osteopathic approach
Rivera, N. T., Martin, R. B., Gordon, M.l B., Rajter, J.-J., Bray, N.
International Journal of Osteopathic Medicine, 2015/12
2401

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text
2402

Balance-Konzept – Grundlagen und Fallbeispiele
(Concept of balance - Fundamentals and case studies)
Dräger, K.
Osteopathische Medizin, 2015/12
2403

Geschichte der konservativen Wirbelsaulentherapie.
[History of conservative spinal therapy]
Kladny, B.
Der Unfallchirurg, 2015/12
2404

Kommentar zum Artikel „Craniomandibuläre Dysfunktion: Bedeutung der Körperhaltung bei Okklusionstests”
(Comment on the article “Craniomandibular dysfunction: Importance of body position in occlusion tests“)
Hartwig, B.
Osteopathische Medizin, 2015/12
2405

Are reductions in passive knee extension or flexion associated with radiological changes suggestive of osteoarthritis?
Hendry, F.
International Journal of Osteopathic Medicine, 2015/12
2406

How does style of mentoring supervision affect talent development among trainee doctors?
London, S.
International Journal of Osteopathic Medicine, 2015/12
2407

Objectivation de l'équilibre en stabilité debout et lors du cycle de marche chez le sujet âgé autonome chuteur: apport de l'Ostéopathie
(Objectification of balance stability when standing and walking among elderly fallers: contribution of Osteopathy)
Huard, Y.
Unpublished PhD thesis, 2015/11
Free full text
2408

Achilles Tendon Disorders
Saini, S. S., Reb, C. W., Chapter, M., Daniel, J. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text
2409

Incorporating Osteopathic Curriculum Into a Family Medicine Residency
Hempstead, L. K., Harper, D. M.
Family Medicine, 2015/11
2410

A Preliminary Comparison of Laryngeal Manipulation and Postural Treatment on Voice Quality in a Prospective Randomized Crossover Study
Kennard, E. J., Lieberman, J., Saaid, A., Rolfe, K. J.
Journal of Voice, 2015/11
2411

Serious Adverse Events and Spinal Manipulative Therapy of the Low Back Region: A Systematic Review of Cases
Hebert, J. J., Stomski, N. J., French, S. D., Rubinstein, S. M.
Journal of Manipulative and Physiological Therapeutics, 2015/11
2412

Adverse Events Due to Chiropractic and Other Manual Therapies for Infants and Children: A Review of the Literature
Todd, A. J., Carroll, M. T., Robinson, A., Mitchell, E. K. L.
Journal of Manipulative and Physiological Therapeutics, 2015/11
2413

Job Satisfaction and Affective Commitment of Osteopathic Medical School Clinical Faculty
Yurvati, A. H.
Unpublished PhD thesis, 2015/11
2414

Quantification of Motion Palpation
Kasparian, H., Signoret, G., Kasparian, J.
The Journal of the American Osteopathic Association, 2015/10
Free full text
2415

Person-centered osteopathic practice: patients' personality (body, mind, and soul) and health (ill-being and well-being)
Fahlgren, E., Nima, A. A., Archer, T., Garcia, D.
PeerJ, 2015/10
Free full text
2416

Look but ... please don't touch!
De-Giorgio, F., Panarella, L., Miscusi, M., d', Aloja, E., Spagnolo, A. G., Pascali, V. L., Vetrugno, G.
Medicine, Science and the Law, 2015/10
Free full text
2417

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text
2418

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text
2419

Kann eine osteopathische Behandlung den Geburtsverlauf bei der protrahierten Geburt beeinflussen? Klinische Studie
(Does osteopathic treatment influence birth process in cases of prolonged labor or failure to progress in labor? Clinical trial)
Forster, B., Jusek, A.
Unpublished D.O. thesis, 2015/10
2420

(Osteopathic treatment in patients with age-related macular degeneration. Pre-post study)
Ihlow, D.
Unpublished D.O. thesis, 2015/10
2421

Intratester-Reliabilität des viszeralen Tensionstests nach Helsmoortel et al. (2002). Reliabilitätsstudie.
(Intra-observer reliability of the visceral tension test developed by Helsmoortel et al. (2002). Reliability study)
Verbaarschot, A.
Unpublished D.O. thesis, 2015/10
2422

Intratester-Reliabilität des viszeralen Tensionstests nach Helsmoortel et al. (2002).
Reliabilitätsstudie. (Intra-observer reliability of the visceral tension test developed by Helsmoortel et al. (2002). Reliability study)
Verbaarschot, A.
Unpublished D.O. thesis, 2015/10
2423

Analysis of provider specialties in the treatment of patients with clinically diagnosed back and joint problems
Wilson, F. A., Licciardone, J. C., Kearns, C. M., Akuoko, M.
Journal of Evaluation in Clinical Practice, 2015/10
2424

Larson Syndrome of Dysautonomia in Parkinson Disease Managed With Osteopathic Manipulative Treatment: A Case Report
Durrani, M., Mancini, J. D., Flaum, T. B.
The AAO Journal, 2015/09
2425

Perceived teaching quality between near-peer and academic tutors in an osteopathic practical skills class
Vaughan, B., Macfarlane, C.
International Journal of Osteopathic Medicine, 2015/09
2426

Osteopathische Universität – ein Entwurf
(Osteopathic University - a concept)
Levin, P.
Osteopathische Medizin, 2015/09
2427

Dysfunction in a Patient With Acute Knee Pain and Osteoarthritis: A Case Report
T., Snider. K.
The AAO Journal, 2015/09
2428

Kinesiologisches Taping in der Osteopathie
(Kinesiology taping in osteopathy)
Seifert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
Free full text
2429

Impact of McKenzie Method Therapy Enriched by Muscular Energy Techniques on Subjective and Objective Parameters Related to Spine Function in Patients with Chronic Low Back Pain
Szulc, P., Wendt, M., Waszak, M., Tomczak, M., Cieslik, K., Trzaska, T.
Medical Science Monitor, 2015/09
Free full text
2430

Die osteopathische Behandlung akuter Atemwegserkrankungen im Krankenhaus von Haifa
(The osteopathic treatment of acute respiratory diseases in a hospital in Haifa, Israel)
Waldman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
2431

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09
2432

Management of mood disorders by osteopaths in New Zealand: A survey of current clinical practice
Kovanur Sampath, K., Roy, D. E.
International Journal of Osteopathic Medicine, 2015/09
2433

Interventions for preventing and treating low-back and pelvic pain during pregnancy
Liddle, S. D., Pennick, V.
Cochrane Database of Systematic Reviews, 2015/09
Free full text
2434

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
2435

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09
2436

Communication style based on self-determination theory enhances intervention adherence in physiotherapists’ patients with low back pain
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2015/09
2437

In adults with painful hip osteoarthritis physical therapy did not lead to better improvements in pain or function than sham therapy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2015/09
2438

Do patients’ recognise and value domain specific change following treatment in addition to global impressions of change?
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2015/09
2439

Der Zehengang
(Toe walking)
Guerassimiouk, D., Goussel, W., Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
2440

Modeled Osteopathic Manipulative Treatments: A Review of Their in Vitro Effects on Fibroblast Tissue Preparations
Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/08
Free full text
2441

Accuracy of Anterior Superior Iliac Spine Symmetry Assessment by Routine Structural Examination
Lee, A. S., Pyle, C. W., Redding, D.
The Journal of the American Osteopathic Association, 2015/08
Free full text
2442

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text
2443

Effects of Osteopathic Manipulative Treatment on Diabetic Gastroparesis
Van Ravenswaay, V. J., Hain, S. J., Grasso, S., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2015/07
Free full text
2444

Osteopathische Behandlung bei Patienten mit essenzieller Hypertonie
(Osteopathic treatment in patients with essential hypertension)
Pfeifer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2445

Entzündungsreaktionen aus Sicht der Osteopathie
(Inflammatory reactions from an osteopathic point of view)
Sarzeaud, R., Thon, N., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
Free full text
2446

A unifying neuro-fasciagenic model of somatic dysfunction – Underlying mechanisms and treatment – Part II
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2015/07
2447

Immediate changes in electroencephalography activity in individuals with nonspecific chronic low back pain after cranial osteopathic manipulative treatment: study protocol of a randomized, controlled crossover trial
Martins, W. R., Diniz, L. R., Blasczyk, J. C., Lagoa, K. F., Thomaz, S., Rodrigues, M. E., de Oliveira, R. J., Bonini-Rocha, A. C.
BMC Complementary and Alternative Medicine, 2015/07
Free full text
2448

Assessing the immediate effect of osteopathic manipulation on sports related concussion symptoms
Chappell, C., Dodge, E., Dogbey, G. Y.
Osteopathic Family Physician, 2015/07
Free full text
2449

Lass die Natur ihre Arbeit machen
(Let nature do its job)
Deslee, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2450

Strömung
(Flow)
Geyer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2451

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2452

Zwischen Traditionalisten und Reformern: Littlejohns Konzept der Anpassung
(Between traditionalists and reformers: Little Johns concept of adaptation)
Liem, T.
Osteopathische Medizin, 2015/06/01/
2453

Adverse events among seniors receiving spinal manipulation and exercise in a randomized clinical trial
McEwen, M.
International Journal of Osteopathic Medicine, 2015/06
2454

Well, I'm healthy, but… – Lay perspectives on health among people with musculoskeletal disorders
Niven, E.
International Journal of Osteopathic Medicine, 2015/06
2455

Role of Osteopathic Manipulative Treatment in a Dynamic Case of Parkinson Disease and Levodopa-Induced Dyskinesia: A Case Report
Apoznanski, T. E., Flaum, T. B.
The AAO Journal, 2015/06
2456

Einfluss zirkadianer Rhythmik auf den Kurzzeiteffekt eines myofaszialen Release des Zwerchfells hinsichtlich vagaler Modulation der Herzratenvariabilität
(Influence of circadian rhythmicity on the short-term effect of a myofascial release of the diaphragm with respect to vagal modulation of heart rate variability)
Hofer, U.
Unpublished MSc thesis, 2015/06
Free full text
2457

The effect of daily walking steps on preventing neck and low back pain in sedentary workers: A 1-year prospective cohort study
Palfreyman, S.
International Journal of Osteopathic Medicine, 2015/06
2458

Role of osteopathic manipulative treatment in the management of stiff person syndrome
Rajaii, R. M., Cox, G. J., Schneider, R. P.
The Journal of the American Osteopathic Association, 2015/06
Free full text
2459

Osteopathic Manipulative Treatmentfor Patient With Severe Nausea and Vomiting in Pregnancy: A Case Study
Markelz, K. A., Blumer, J. U.
The AAO Journal, 2015/06
2460

Relationship between somatic dysfunction of the lumbosacral joint and changes in the gait pattern
Croonenborghs, H., Peeters, L., De Schepper, J.
International Journal of Osteopathic Medicine, 2015/06
2461

Can a light touch sham therapy be effective in cranial osteopathic manipulative medicine research?
King, H. H.
The Journal of the American Osteopathic Association, 2015/06
Free full text
2462

The effect of osteopathic manipulative treatment on length of stay in posterolateral postthoracotomy patients: A retrospective case note study
Fleming, R. K., Snider, K. T., Blanke, K. J., Johnson, J. C.
International Journal of Osteopathic Medicine, 2015/06
2463

A global view of osteopathic practice – mirror or echo chamber?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2015/06
2464

The effect of the osteopathic thoracic lymphatic pump technique on salivary secretory immunoglobulin A levels in adults with recurrent upper respiratory tract complaints
Blut, D. P. F.
Unpublished MSc thesis, 2015/06
2465

Osteopathic manipulative treatment for an unusual presentation of fibromyalgia: A case report demonstrating the effectiveness of disease guidelines
Paul, L., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2015/06
2466

Neue Strategien zur persönlichen und beruflichen Weiterentwicklung für Osteopathen
(New strategies for the further personal and professional development of osteopaths)
Bradonic, B., Risch, A. J.
Osteopathische Medizin, 2015/06
2467

Allied Health practitioners' role in the Chronic Disease Management program: The experience of osteopathic practitioners
Orrock, P. J., Lasham, K., Ward, C.
International Journal of Osteopathic Medicine, 2015/06
2468

Osteopathie als alternative Therapie bei Reizmagen – eine Pilotstudie
(Osteopathy as an alternative therapy for dyspepsia - A pilot study)
Elsing, C.
Osteopathische Medizin, 2015/06
2469

Comparison of spinal manipulation methods and usual medical care for acute and subacute low back pain
Dussart, P.
International Journal of Osteopathic Medicine, 2015/06
2470

Pain location matters: The impact of leg pain on health care use, work disability and quality of life in patients with low back pain
Friedlander, T.
International Journal of Osteopathic Medicine, 2015/06
2471

Understanding why people do or do not engage in activities following total joint replacement: A longitudinal qualitative study
Hutchinson, J.
International Journal of Osteopathic Medicine, 2015/06
2472

The value of looking within, and without
Lucas, N.
International Journal of Osteopathic Medicine, 2015/06
Free full text
2473

Using a smartphone to measure joint range – Attractive for clinical use, but are they valid and reliable?
Mason, J.
International Journal of Osteopathic Medicine, 2015/06
2474

Impact of osteopathic manipulative therapy on quality of life of patients with deep infiltrating endometriosis with colorectal involvement: results of a pilot study
Darai, C., Deboute, O., Zacharopoulou, C., Laas, E., Canlorbe, G., Belghiti, J., Zilberman, S., Ballester, M., Darai, E.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2015/05
2475

Systematic Review Challenges Efficacy of Pediatric OMT
Martincik, L., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text
2476

Lymphatic pump treatment as an adjunct to antibiotics for pneumonia in a rat model
Hodge, L. M., Creasy, C., Carter, K., Orlowski, A., Schander, A., King, H. H.
The Journal of the American Osteopathic Association, 2015/05
Free full text
2477

A multicenter, randomized, controlled trial of osteopathic manipulative treatment on preterms
Cerritelli, F., Pizzolorusso, G., Renzetti, C., Cozzolino, V., D'Orazio, M., Lupacchini, M., Marinelli, B., Accorsi, A., Lucci, C., Lancellotti, J., Ballabio, S., Castelli, C., Molteni, D., Besana, R., Tubaldi, L., Perri, F. P., Fusilli, P., D'Incecco, C., Barlafante, G.
PLoS One, 2015/05
Free full text
2478

Kritische Betrachtung einer Besprechung
(Critical consideration of a critique)
Franke, H., Franke, J.D., Fryer, G.
Manuelle Medizin, 2015/05
2479

Effects of osteopathic manipulative treatment on the inflammatory mediators related to asthma
Ragland, C. E.
Unpublished MSc thesis, 2015/05
2480

Comparison of COMLEX-USA scores, medical school performance, and preadmission variables between women and men
Dixon, D.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2481

Wie können wir unsere Wahrnehmung verbessern?
(How can we improve our perception?)
Marris, T., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2482

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2483

Was nimmt mein Osteopath wahr?
(What does my osteopath perceive?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2484

Sutherland
Bordoni, B., Zanier, E.
Advances in Mind-Body Medicine, 2015/04
2485

Can osteopathic manipulative treatment modify the posture in elderly people? – A single-case study
Pellerin, F., Papin-Richard, E., Guihéneuc, P., Niel, S., Guihard, G.
Journal of Bodywork and Movement Therapies, 2015/04
2486

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2487

A systematic review found no consistent difference in effect between more and less intensive placebo interventions
Fassler, M., Meissner, K., Kleijnen, J., Hrobjartsson, A., Linde, K.
Journal of Clinical Epidemiology, 2015/04
2488

„Meine Mitte ist verschoben!“
(“My center is shifted!“)
Weese, P.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2489

Osteopathic manipulative treatment and pain in preterms: study protocol for a randomised controlled trial
Cerritelli, F., Cicchitti, L., Martelli, M., Barlafante, G., Renzetti, C., Pizzolorusso, G., Lupacchini, M., D'Orazio, M., Marinelli, B., Cozzolino, V., Fusilli, P., D'Incecco, C.
Trials, 2015/04
Free full text
2490

Wahrnehmungsstörungen bei Grundschulkindern durch Störungen des hochzervikalen Bereichs
(Perception disorders in elementary school children due to disorders of the high cervical area)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2491

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2492

An exploration of the changes in signs and symptoms associated with sleep bruxism that follow osteopathic manual therapy: a pilot study
Messersmith, L.
Unpublished MSc thesis, 2015/04
Free full text
2493

Clinical effectiveness of osteopathic treatment in chronic migraine: 3-Armed randomized controlled trial
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Complementary Therapies in Medicine, 2015/04
2494

Sensory characteristics of chronic non-specific low back pain
Orchard, D.
International Journal of Osteopathic Medicine, 2015/03
2495

Fatigue and depression in sick-listed chronic low back pain patients
Pointon, R.
International Journal of Osteopathic Medicine, 2015/03
2496

Recognizing the Value of Manual Therapy Interventions in Women's Health: An Interim Report
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2497

Osteopathische Behandlung der Entrapmentneuropathie des Nervus axillaris
(Osteopathic treatment of entrapment neuropathy of the axillary nerve)
Lefelmann, A.K.
Osteopathische Medizin, 2015/03
2498

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text
2499

Day-to-day practice of osteopaths using osteopathy in the cranial field, who are affiliated with the Sutherland Cranial College of Osteopathy (SCCO): A national survey by means of a standardised data collection tool
Wilkinson, J., Thomas, K. J., Freeman, J. V., McKenna, B.
International Journal of Osteopathic Medicine, 2015/03
2500

Die Interrater Reliabilität der segmentalen passiven Mobilitätstestung der Lendenwirbelsäule im Sitz mit markierten Processus spinosi
(Interrater Reliability For Segmental Passive Motion Palpation Of The Lumbar Spine In Sitting Position With Marked Spinous Processes)
Maurer, S.
Unpublished MSc thesis, 2015/03
Free full text
2501

(Complementary notes to the article: “Osteopathic treatment for non-specific back pain“.)
listed, No authors
Osteopathische Medizin, 2015/03
2502

Dramatic Reduction in Menstrual Pain After Osteopathic Manipulative Therapy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2503

OMT—and Placebo—Shown Effective in Reducing Pain During Pregnancy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2504

Chiropraktik in der Bundesrepublik Deutschland von 1949 bis 1975
(Chiropractic in the Federal Republic of Germany from 1949 to 1975)
Mildenberger, F. G.
Osteopathische Medizin, 2015/03
2505

Application of osteopathic manipulative technique in the treatment of back pain during pregnancy
Majchrzycki, M., Wolski, H., Seremak-Mrozikiewicz, A., Lipiec, J., Marszalek, S., Mrozikiewicz, P. M., Klejewski, A., Lisinski, P.
Ginekologia Polska, 2015/03
2506

Osteopathische Betreuung einer Zwillingsschwangerschaft – ein Fallbeispiel
(Osteopathic care of a twin pregnancy - A case example)
Urbanek, B.
Osteopathische Medizin, 2015/03
2507

Adapting and feasibility testing pre-registration e-learning resources for Professionalism in Osteopathy in the UK
Browne, F., Rolfe, K., Currie, A., Walker, T., Roff, S.
International Journal of Osteopathic Medicine, 2015/03
2508

The accuracy of osteopathic manipulations of the lumbar Spine: A Pilot study
Frantzis, E., Druelle, P., Ross, K. E., McGill, S.
International Journal of Osteopathic Medicine, 2015/03
2509

The clinical observation of muscle energy techniques and ligamentous articular strain in 2 cases of cervical disc herniation with thoracic outlet syndrome
Kim, M., Chi, E. H., Lee, J., Ha, I. H.
International Journal of Osteopathic Medicine, 2015/03
2510

Exploring the construct validity of the Patient Perception Measure - Osteopathy (PPM-O) using classical test theory and Rasch analysis
Mulcahy, J., Vaughan, B.
Chiropractic & Manual Therapies, 2015/03
Free full text
2511

Impact of the clinical ultrasound elective course on retention of anatomical knowledge by second-year medical students in preparation for board exams
Kondrashov, P., Johnson, J. C., Boehm, K., Rice, D., Kondrashova, T.
Clinical Anatomy, 2015/03
2512

Osteopathie: eine Heilmethode auf dem Prüfstand
Snijders, C.
Skeptiker, 2015/03
2513

Osteopathic manipulative treatment use in the emergency department: a retrospective medical record review
Ault, B., Levy, D.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2514

Osteopathic Considerations in the Management of Migraine in Pregnancy
Soshnick, S., Mezzone, C., Yao, S., Abu-Sbaih, R.
Osteopathic Family Physician, 2015/03
Free full text
2515

Effectiveness of osteopathic manipulative treatment for carpal tunnel syndrome: a pilot project
Burnham, T., Higgins, D. C., Burnham, R. S., Heath, D. M.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2516

Einfluss der Osteopathie auf den körperlichen und mentalen Zustand von Teenagern
(Influence of osteopathy on the physical and mental states of teenagers)
Egorova, I. A., Buchnov, A. D.
Osteopathische Medizin, 2015/03
2517

Osteopathische Behandlung bei unspezifischen Rückenschmerzen – Literaturübersicht und Metaanalyse
(Osteopathic treatment for unspecific low back pain - systematic review and meta analysis)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2015/03
2518

Weight bearing joint mobilization seems to be durably effective in the treatment of limited ankle dorsiflexion, dynamic postural control, and self-reported instability
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2015/03
2519

Documenting female spine motion during coitus with a commentary on the implications for the low back pain patient
Sidorkewicz, N., McGill, S. M.
European Spine Journal, 2015/03
2520

Postoperative singultus: an osteopathic approach
Petree, K., Bruner, J.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2521

Medical students' professional identity and lapses of professionalism in the learning environment
London, S.
International Journal of Osteopathic Medicine, 2015/03
2522

Osteopathic manipulative treatment for self-reported fatigue, stress, and depression in first-year osteopathic medical students
Wiegand, S., Bianchi, W., Quinn, T. A., Best, M., Fotopoulos, T.
The Journal of the American Osteopathic Association, 2015/02
Free full text
2523

Wie zufrieden sind Eltern Frühgeborener in Deutschland mit osteopathischen Behandlungen ihrer frühgeborenen Kinder innerhalb der ersten 3 Lebensjahre?
(Osteopathic treatments on preborn children within their first 3 years: how content are parents with the effects of treatment?)
Papperger, S.
Unpublished MSc thesis, 2015/02
Free full text
2524

Beschreibung der Insertionsstellen des Ligamentum vertebropericardiacum und der Verbindung zum vegetativen Nervensystem: Eine anatomische Grundlagenstudie an nach Thiel konservierten menschlichen Leichen.
(Description of the insertion sites of the ligament vertebropericardiacum and the connection to the autonomic nervous system: A baseline anatomy study in Thiel embalmed human cadavers)
Hoffmann, R.
Unpublished MSc thesis, 2015/02
Free full text
2525

Use of complementary health approaches among children aged 4-17 years in the United States: National Health Interview Survey, 2007-2012
Black, L. I., Clarke, T. C., Barnes, P. M., Stussman, B. J., Nahin, R. L.
National Health Statistics Reports, 2015/02
Free full text
2526

Das Schielen bei Kindern von 2-6 Jahren - Kann es durch osteopathische Behandlung beeinflusst werden?
(Children from 2 to 6 years suffering from strabism - can it be influenced by osteopathic treatment?)
Vietz, C.
Unpublished MSc thesis, 2015/02
Free full text
2527

Umfragestudie zur Entstehung des kindlichen Schielens (Strabismus) durch prä- bzw. perinatale Einflüsse
(Questionnaire study on the emergence of childhood strabism because of prenatal and perinatal influences)
Vietz, M.
Unpublished MSc thesis, 2015/02
Free full text
2528

Osteopatia como meio terapêutico nas disfunções temporomandibulares e dores orofaciais
(Osteopathy as a therapeutic tool in temporomandibular disorders and orofacial pain)
Ferreira, L. T.
Unpublished MSc thesis, 2015/02
Free full text
2529

Resolution of dacryostenosis after osteopathic manipulative treatment
Apoznanski, T. E., Abu-Sbaih, R., Terzella, M. J., Yao, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text
2530

Relationship of admissions variables and college of osteopathic medicine variables to performance on COMLEX-USA level 3
Baker, H. H., Shuman, V. L., Ridpath, L. C., Pence, L. L., Fisk, R. M., Jr., Boisvert
The Journal of the American Osteopathic Association, 2015/02
Free full text
2531

Promoting optimal breastfeeding through the osteopathic therapeutic cycle
Cornall, D.
Unpublished PhD thesis, 2015/02
Free full text
2532

Sutherlands Herangehensweise an den Körper als Ganzes: Die Schoßtechnik
(Sutherland's approach to the body as a whole: the lap technique)
Chandler, P., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
2533

Pain: Alternative to a Narco-Epidemic
Moreau, M.
Unpublished Dissertation, 2015/01
2534

Osteopathic Manipulative Treatment Improves Clinical Response and Lowers Relapse Rates Among Patients With Chronic Low Back Pain
Brohard, J. N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01
Free full text
2535

Osteopathic Manipulative Treatment Is Effective for Nonspecific Low Back Pain
O'Donnell Rosendahl, N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01
2536

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: the PROMOTE study
Hensel, K. L., Buchanan, S., Brown, S. K., Rodriguez, M., Cruser d, A.
American Journal of Obstetrics & Gynecology, 2015/01
Free full text
2537

Osteopathische Sterbebegleitung
(Osteopathic terminal care)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
Free full text
2538

A pilot study on spatial changes in the maxilla caused by osteopathic therapy
Walter, C., Lechner, K. H., Karl, M.
Quintessence International, 2015/01
2539

Veränderungen im Alter
(Changes in old age)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
2540

Use of a novel assay to measure pre- to posttraining palpatory skills of first-year osteopathic medical students
Loh, M. S., Gevitz, N., Gilliar, W. G., Iacono, L. M., Jung, M. K., Krishnamachari, B., Amsler, K.
The Journal of the American Osteopathic Association, 2015/01
Free full text
2541

Osteopathic clinical reasoning for the diagnosis and management of pelvic girdle pain associated with pregnancy: an interpretive descriptive study
Rioufrays, J.
Unpublished MSc thesis, 2015/01
Free full text
2542

Aufrecht im Alter
(Upright in old age)
Eix, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
2543

Racionalidades médicas de los sistemas tradicional colombiano, biomédico y osteopático: una aproximación a la conceptualización de la dolencia del descuaje en Bogotá, Colombia. 2015
(Medical rationalities of the traditional Colombian, biomedical, and osteopathic systems: an approach to the conceptualization of the ailment of descuaje in Bogota, Colombia)
Sanin Pineda, L. F.
Unpublished MSc thesis, 2015/01
Free full text
2544

Kann die Arbeit mit dem Liquor älteren Patienten helfen?
(Can working with cerebrospinal fluid help elderly patients?)
Grundberg, S., Höflehner-Schnürch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
2545

Biografische Notizen zu den Begründern von Osteopathie und Chiropraktik. Andrew Taylor Still und Daniel David Palmer
Endruscheit, U.
Skeptiker, 2015/01
2546

Osteopathy decreases the severity of IBS-like symptoms associated with Crohn's disease in patients in remission
Piche, T., Pishvaie, D., Tirouvaziam, D., Filippi, J., Dainese, R., Tonohouhan, M., DeGalleani, L., Nebot-Vivinus, M. H., Payrouse, J. L., Hebuterne, X.
European Journal of Gastroenterology & Hepatology, 2014/12
2547

Clinical response and relapse in patients with chronic low back pain following osteopathic manual treatment: results from the OSTEOPATHIC Trial
Licciardone, J. C., Aryal, S.
Manual Therapy, 2014/12
Free full text
2548

Open the Box - An Empirical Research Concering the Evaluation of the Black-Box-Model in the Osteopathic Medicine
Müller, S.
Unpublished MSc thesis, 2014/12
Free full text
2549

Pitfalls and challenges involved in the process of perception and interpretation of palpatory findings
Liem, T.
International Journal of Osteopathic Medicine, 2014/12
2550

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text
2551

Does inter-vertebral range of motion increase after spinal manipulation? A prospective cohort study
McSweeney, T.
International Journal of Osteopathic Medicine, 2014/12
2552

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12
2553

“Making Strange”: A role for the humanities in medical education
Vincent, F.
International Journal of Osteopathic Medicine, 2014/12
2554

Spinal manipulation for patients with lumbar herniated disks attending a private practice
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/12
2555

(Letter to GM Ostendorf: osteopath --an independent health professional? In: Insurance Medicine 66 (2014), No. 2, pp 97th)
Psczolla, M.
Versicherungsmedizin, 2014/12
2556

Mit welchen Problemen kommen Eltern mit ihren Kindern im ersten Lebensjahr zum/zur OsteopathenIn und welche somatischen Dysfunktionen werden dabei gefunden?
(Which problems make parents approaching an osteopath for their children in their first year of life and which somatic dysfunctions can be found?)
Mellitzer, E.
Unpublished MSc thesis, 2014/12
Free full text
2557

Cardiovascular Response to Vertebral Osteopathic Manipulative Treatment (OMT), On Asymptomatic Human Subjects
Pedapati, C.
Unpublished MSc thesis, 2014/12
2558

Intertester-Reliabilitätsprüfung einer visceralen Mobilitätsuntersuchung an der Leberzone
(Examination of the Intertester Reliability of a passive visceral mobility palpation on the hepatic area)
Zeller, U.
Unpublished MSc thesis, 2014/12
Free full text
2559

Credibility of a comparative sham control intervention for craniosacral therapy in patients with chronic neck pain
Haller, H., Ostermann, T., Lauche, R., Cramer, H., Dobos, G.
Complementary Therapies in Medicine, 2014/12
2560

A prodromal, musculoskeletal presentation of Parkinson's disease: A case report
Simpson, P. A.
International Journal of Osteopathic Medicine, 2014/12
2561

Osteopathic manual therapy as an adjunct treatment for self-management of breast cancer related lymphoedema: the lived experience of lymphoedema and osteopathic treatment
Henderson, K.
Unpublished MSc thesis, 2014/12
Free full text
2562

Use of real-time physiologic parameter assessment to augment osteopathic manipulative treatment training for first-year osteopathic medical students
Heath, D. M., Makin, I. R., Pedapati, C., Kirsch, J.
The Journal of the American Osteopathic Association, 2014/12
Free full text
2563

Osteopathic treatment in patients with primary dysmenorrhoea: A randomised controlled trial
Schwerla, F., Wirthwein, P., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2014/12
2564

Experiential Learning: An Irreplaceable Tool in Osteopathic Student Education
Bikman, T. J., Ford, J., Schmidt, D., Ridpath, L.
The Journal of the American Osteopathic Association, 2014/12
2565

Piriformis Syndrome: A Case Study
Lee, J. M., McCaffrey, K.
The AAO Journal, 2014/11
Free full text
2566

Effects of Osteopathic Manipulative Treatment (OMT) in Lowering Perceived Stress in Medical, Dental, and Pharmacy Student Populations
Frye, K. L., Williams, C. J., Johnson, B. N., Quinn, T. A., Fotopoulos, T. J.
The AAO Journal, 2014/11
Free full text
2567

Using the Strain-Counterstrain Approach to Highlight the Body Unity Within Osteopathic Treatment
Dixneuf, A., Ghattas, B.
The AAO Journal, 2014/11
Free full text
2568

Effekt einer Leberbehandlung auf den Laktatwert im Blut von gesunden Erwachsenen
(The effect of an osteopathic treatment of the liver on the blood lactate level of healthy adults)
Hieden, E.
Unpublished MSc thesis, 2014/11
Free full text
2569

Beeinflussung des autonomen Nervensystems durch eine osteopathische Recoiltechnik am Sternum
(Influencing the autonomic nervous system through the application of an osteopathic recoil technique on the sternum)
Mayrhofer, D.
Unpublished MSc thesis, 2014/11
Free full text
2570

Professionalism score and academic performance in osteopathic medical students
Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text
2571

Desenvolvimento e aplicação de um protocolo osteopático de tratamento para bebês com refluxo
(Development and application of an osteopathic treatment protocol for infants with reflux)
Gemelli, M.
Unpublished MSc thesis, 2014/11
Free full text
2572

Observational study fails to demonstrate the effectiveness of OMT in decreasing low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text
2573

Efeito de Técnicas Osteopáticas Estruturais na Postura e Flexibilidade de Individuos com Escoliose Idiopática do Adolescente
(Effect of Structural Osteopathic Techniques on the Posture and Flexibility of Individuals with Adolescent Idiopathic Scoliosis)
Pelai, E. B.
Unpublished MSc thesis, 2014/11
Free full text
2574

Osteopathic manipulative treatment for postural orthostatic tachycardia syndrome
Goodkin, M. B., Bellew, L. J.
The Journal of the American Osteopathic Association, 2014/11
Free full text
2575

Use of beat-to-beat cardiovascular variability data to determine the validity of sham therapy as the placebo control in osteopathic manipulative medicine research
Henley, C. E., Wilson, T. E.
The Journal of the American Osteopathic Association, 2014/11
Free full text
2576

The Effect of Optimally Timed Osteopathic Manipulative Treatment on Length of Hospital Stay in Moderate and Late Preterm Infants: Results from a RCT
Pizzolorusso, G., Cerritelli, F., Accorsi, A., Lucci, C., Tubaldi, L., Lancellotti, J., Barlafante, G., Renzetti, C., D', Incecco, C., Perri, F. P.
Evidence-based Complementary and Alternative Medicine, 2014/11
Free full text
2577

„Wir Osteopathen sind ein wichtiges Stellglied in der Betreuung von Sportlern“
(“We osteopaths are an important actuator in the care of athletes“)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2578

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with persistent non-specific low back pain after childbirth. A randomized controlled trial)
Belz, S.
Unpublished MSc thesis, 2014/10
Free full text
2579

Die Bedeutung der Faszien im Hochleistungssport
(The importance of fascia in high-performance sports)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
2580

Das Fasziendistorsionsmodell (nach Typaldos): Die 6 Störungen und deren Behandlung
(The fascial distortion model (according to Typaldos): The 6 disorders and their treatment)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
2581

Osteopathic Manipulative Treatment Induces Enhanced Intracellular Immune Response
Blumer, J.
The Journal of the American Osteopathic Association, 2014/10
Free full text
2582

OMT Is Efficacious for Patients With High Baseline Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/10
Free full text
2583

Als Osteopath bei den Olympischen Sommerspielen
(At the Summer Olympics as an Osteopath)
Maurer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2584

Das Supinationstrauma aus osteopathischer Sicht
(The supination trauma from an osteopathic point of view)
Peramo, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2585

Response to letter to the editor
Bolino, G., Mangiulli, T.
Medicine, Science and the Law, 2014/10
Free full text
2586

Osteopathische Behandlung von Schwangeren mit Rückenschmerzen. Randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in pregnant women suffering from low back pain (LBP). A randomized controlled trial)
Röhrich, K.
Unpublished D.O. thesis, 2014/10
2587

Onset of complications following cervical manipulation due to malpractice in osteopathic treatment: a case report
Cicconi, M., Mangiulli, T., Bolino, G.
Medicine, Science and the Law, 2014/10
2588

Valuable information about current clinical practice
Vaughan, B., Thomson, O.
Medicine, Science and the Law, 2014/10
Free full text
2589

Osteopathische Behandlung von Kindern mit einer idiopathischen Haltungsasymmetrie. Eine randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in children with idiopathic postural asymmetry. A randomized controlled trial)
Teichmüller, M.
Unpublished D.O. thesis, 2014/10
2590

Der Muskelfaserriss
(The torn muscle fiber)
Taenzer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2591

Changes in rat spinal cord gene expression after inflammatory hyperalgesia of the joint and manual therapy
Ruhlen, R. L., Singh, V. K., Pazdernik, V. K., Towns, L. C., Snider, E. J., Sargentini, N. J., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/10
Free full text
2592

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in women with persistent non specific low back pain after childbirth. A randomized controlled trial)
Belz, S., Brix, K.
Unpublished D.O. thesis, 2014/10
2593

Achillodynie
(Achillodynia)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
2594

Behandlung eines nach anterior verlagerten Akromioklavikulargelenks (ACG) nach Sporttrauma
(Treatment of an anteriorly dislocated acromioclavicular joint after sports trauma)
Delarue, C.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2595

Deformations experienced in the human skin, adipose tissue, and fascia in osteopathic manipulative medicine
Chaudhry, H., Bukiet, B., Ji, Z., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2014/10
Free full text
2596

Bewegung – osteopathische Domäne oder ungenutztes Potenzial?
(Movement - osteopathic domain or untapped potential?)
Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2597

Effectiveness of osteopathic manipulative treatment with home based exercises on progressed flexible pes planus
Kim, C.
Unpublished MSc thesis, 2014/10
Free full text
2598

Response to commentary on: A systematic review investigating complementary and alternative medicine in the management of low back and/or pelvic pain in pregnancy
Close, C., Sinclair, M., Liddle, D.
Journal of Advanced Nursing, 2014/10
2599

Commentary on: Close et al. (2014) A systematic review investigating the effectiveness of Complementary and Alternative Medicine (CAM) for the management of low back and/or pelvic pain in pregnancy
Ernst, E.
Journal of Advanced Nursing, 2014/10
2600

The runner's kidney: A case report
Lalonde, F.
International Journal of Osteopathic Medicine, 2014/09/01/
2601

Spinal manipulation results in specific effects on pain sensitivity associated with altered central nociceptive processing in chronic low back pain
Rickards, L. D.
International Journal of Osteopathic Medicine, 2014/09/01/
2602

The runner's kidney: A case report
Lalonde, F.
International Journal of Osteopathic Medicine, 2014/09/01/
2603

Pilot trial of osteopathic manipulative therapy for patients with frequent episodic tension-type headache
Rolle, G., Tremolizzo, L., Somalvico, F., Ferrarese, C., Bressan, L. C.
The Journal of the American Osteopathic Association, 2014/09
Free full text
2604

Relationships between the Comprehensive Osteopathic Medical Achievement Test (COMAT) subject examinations and the COMLEX-USA Level 2-Cognitive Evaluation
Li, F., Kalinowski, K. E., Song, H., Bates, B. P.
The Journal of the American Osteopathic Association, 2014/09
Free full text
2605

Benchmarking the strategies for assessing clinical reasoning in osteopathic curricula
Moore, K., Grace, S., Orrock, P., Coutts, R., Blaich, R., Vaughan, B.
International Journal of Osteopathic Medicine, 2014/09
2606

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09
2607

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09
2608

Effectiveness of myofascial release in the management of plantar heel pain; A randomised controlled trial
Walker, S.
International Journal of Osteopathic Medicine, 2014/09
2609

Type of technique used on dorsal spine makes no difference to neck outcomes
Zegarra-Parrodi, R.
International Journal of Osteopathic Medicine, 2014/09
2610

Adverse events in pediatric osteopathy
Kales, S.
Unpublished MSc thesis, 2014/09
Free full text
2611

Osteopathische Interventionsevidenz bei Craniomandibulärer Dysfunktion – ein systematischer Review
(Osteopathic Intervention Evidence in Case of Temporomandibular Disorders - A Systematic Review)
Breunig, B.
Unpublished MSc thesis, 2014/09
Free full text
2612

Osteopathie und ihre Effektivität bei craniomandibulärer Dysfunktion (CMD)
(Osteopathic efficiency regarding craniomandibular dysfunction (CMD))
Maron, A.
Unpublished MSc thesis, 2014/09
Free full text
2613

Osteopathie bei chronischen unteren Rückenschmerzen aus Sicht der PatientInnen. Eine qualitative Studie
(The patient's view on osteopathic treatment of chronic low back pain. A qualitative study)
Brenner, F.
Unpublished MSc thesis, 2014/09
Free full text
2614

Pierre robin sequence in a neonate with suckling difficulty and weight loss
Summers, J., Ludwig, J., Kanze, D.
The Journal of the American Osteopathic Association, 2014/09
Free full text
2615

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text
2616

What about OMT and nutrition for managing the irritable bowel syndrome? An overview and treatment plan
Collebrusco, L., Lombardini, R.
Explore (NY), 2014/09
2617

H-reflex responses to High-Velocity Low-Amplitude manipulation in asymptomatic adults
Groisman, S., Silva, L., Rocha, N., Hoff, F., Rodrigues, M. E., Ehlers, J. A., Diniz, L. R.
International Journal of Osteopathic Medicine, 2014/09
2618

Male spine motion during coitus: implications for the low back pain patient
Sidorkewicz, N., McGill, S. M.
Spine (Phila Pa 1976), 2014/09
2619

Primary reasons for osteopathic consultation: a prospective survey in Quebec
Morin, C., Aubin, A.
PLoS One, 2014/09
Free full text
2620

Changes in biomechanical dysfunction and low back pain reduction with osteopathic manual treatment: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Crow, W. T.
Manual Therapy, 2014/08
Free full text
2621

Use of osteopathic manipulative treatment to manage recurrent bouts of singultus
Seidel, B., Desipio, G. B.
The Journal of the American Osteopathic Association, 2014/08
Free full text
2622

Osteopathy as an adjunctive management to standard care for depression in menopausal women
Henderson, P.
Unpublished MSc thesis, 2014/08
Free full text
2623

Osteopathic manipulative treatment for nonspecific low back pain: a systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
BMC Musculoskeletal Disorders, 2014/08
Free full text
2624

Effets d'un traitement ostéopathique sur la fonction de la main, des symtômes globaux de la maladie et le statut fonctionnel de personnes atteintes de sclérodermie systémique: une série d'études à cas unique
(Effects of osteopathy on hand function, disease symptoms and functional status in female workers with systemic sclerosis: a series of single case studies)
O'Connor, S.
Unpublished MSc thesis, 2014/08
Free full text
2625

Quality of life in patients referring to private osteopathic clinical practice: A prospective observational study
Cerritelli, F., Verzella, M., Barlafante, G.
Complementary Therapies in Medicine, 2014/08
2626

Serious adverse events associated with pediatric complementary and alternative medicine
Zorzela, L., Boon, H., Mior, S., Yager, J., Gross, A., Vohra, S.
European Journal of Integrative Medicine, 2014/08
2627

A systematic review investigating the effectiveness of Complementary and Alternative Medicine (CAM) for the management of low back and/or pelvic pain (LBPP) in pregnancy
Close, C., Sinclair, M., Liddle, S. D., Madden, E., McCullough, J. E., Hughes, C.
Journal of Advanced Nursing, 2014/08
Free full text
2628

Cost-effectiveness of manual therapy for the management of musculoskeletal conditions: a systematic review and narrative synthesis of evidence from randomized controlled trials
Tsertsvadze, A., Clar, C., Court, R., Clarke, A., Mistry, H., Sutcliffe, P.
Journal of Manipulative and Physiological Therapeutics, 2014/07
Free full text
2629

Response: observational study demonstrates that OMT is associated with reduced analgesic prescribing and fewer missed work days
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2630

Impact of osteopathic treatment on pain in adult patients with cystic fibrosis--a pilot randomized controlled study
Hubert, D., Soubeiran, L., Gourmelon, F., Grenet, D., Serreau, R., Perrodeau, E., Zegarra-Parodi, R., Boutron, I.
PLoS One, 2014/07
Free full text
2631

„Hoffentlich ist es nicht so schlimm, wie es eh schon ist“ – oder wenn einem das Leben an die Nieren geht
(“I hope it's not as bad as it already is“ - or when life gets to you)
Schöndorfer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
2632

Stimmt unsere Vorstellung vom venösen System?
(Is our conception of the venous system accurate?)
Thon, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
2633

The OSTEOPATHIC trial demonstrates significant improvement in patients with chronic low back pain as manifested by decreased prescription rescue medication use
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2634

Osteopathische Annäherung an die Arteriosklerose
(Osteopathic approach to arteriosclerosis)
Elferink, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
2635

Mountaineering-induced bilateral plantar paresthesia
Henderson, K. K., Parker, J., Heinking, K. P.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2636

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2637

Patienteninfo: Herzinfarkt bei Frauen
(Patient information; Heart attack in women)
Gräfin von Pfeil, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
2638

Osteopathic Manipulative Treatment in Vestibular Neuritis: A Case Report
Ross, B. S., Johnson, V. M.
The AAO Journal, 2014/06
Free full text
2639

Treatment of Common Fibular (Peroneal) Nerve Palsy With Osteopathic Manipulative Medicine: A Case Study
Jahnke, B. M., Hopson, P., Worden, K.
The AAO Journal, 2014/06
Free full text
2640

Application of OMT in a Pediatric Postoperative Ileus Case
Domalski, R. S., Nimkoff, L., Yao, S. C., Kooyman, P. S.
The AAO Journal, 2014/06
Free full text
2641

Is There a Place for Osteopathy in Parkinson Disease Management? A Retrospective Case Control Study
Catanzaro, M. P., Vazzana, K. M., Chen, A., Mancini, J. D., Yao, S. C.
The AAO Journal, 2014/06
Free full text
2642

The Role of Osteopathic Manipulative Medicine in the Treatment of Dacryostenosis
Apoznanski, T. E., Abu-Sbaih, R., Yao, S. C.
The AAO Journal, 2014/06
Free full text
2643

Diagnostic reasoning in osteopathy – A qualitative study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/06
2644

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06
2645

Osteopath--ein eigenstandiger Heilberuf?
(Osteopath - an independent health profession?)
Ostendorf, G. M.
Versicherungsmedizin, 2014/06
2646

Behandlung von Säuglingen mit Regulationsstörungen – Anregungen für die Ausbildung gemäß GAIMH
(Treatment of infants with adjustment disorders - Stimuli for the education according to the GAIMH)
Gillemot, B.
Osteopathische Medizin, 2014/06
2647

Assessing palpation thresholds of osteopathic medical students using static models of the lumbar spine
Snider, E. J., Pamperin, K., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2648

Traumatic Groin Injury in a Football Player: A Case Report
Tsukanov, D., Dowling, D. J., Weiss, L.
The AAO Journal, 2014/06
Free full text
2649

Management of Levator Ani Syndrome With Osteopathic Manipulative Treatment: A Case Study
Yoshida, M., Derenge, D., Worden, K.
The AAO Journal, 2014/06
Free full text
2650

Osteopathic manipulative treatment for inpatients with pulmonary exacerbations of cystic fibrosis: effects on spirometry findings and patient assessments of breathing, anxiety, and pain
Swender, D. A., Thompson, G., Schneider, K., McCoy, K., Patel, A.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2651

Manual therapy, exercise, and education for low back pain and pelvic pain during pregnancy
Licciardone, J. C., Aryal, S.
American Journal of Obstetrics & Gynecology, 2014/06
Free full text
2652

An audit of the accuracy of medication documentation in a United Kingdom osteopathic training clinic before and after an educational intervention
Brunt, H., Abbey, H.
International Journal of Osteopathic Medicine, 2014/06
2653

Effect of a general osteopathic treatment on body satisfaction, global self perception and anxiety: A randomized trial in asymptomatic female students
Dugailly, P.M., Fassin, S., Maroye, L., Evers, L., Klein, P., Feipel, V.
International Journal of Osteopathic Medicine, 2014/06
2654

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06
2655

Osteopathic approach to sacroiliac dysfunction in a patient with steroid myopathy: case report and literature review
Kohns, D. J., Fitch, D. S.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2656

Predictive relationship of osteopathic manual medicine grades and COMLEX-USA Level 1 total scores and osteopathic principles and practice subscores
Lewis, D. D., Johnson, M. T., Finnerty, E. P.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2657

Osteopathie als zusätzliche Leistung gesetzlicher Krankenkassen
(Osteopathy as an additional service of statutory health insurance companies.)
Newiger, C.
Osteopathische Medizin, 2014/06
2658

Effectiveness of osteopathic manipulative therapy for managing symptoms of irritable bowel syndrome: a systematic review
Muller, A., Franke, H., Resch, K.L., Fryer, G.
The Journal of the American Osteopathic Association, 2014/06
2659

Effect of osteopathic manipulative treatment on middle ear effusion following acute otitis media in young children: a pilot study
Steele, K. M., Carreiro, J. E., Viola, J. H., Conte, J. A., Ridpath, L. C.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2660

Response to Letter About “An Unexpectedly Progressed Lumbar Herniated Disk“
Lipton, J. A., McLeod, G. A.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2661

OMT Improves Acute Hemodynamic Control in Pregnancy by Means of Improved Venous Return
Seffinger, M. A., Brohard, J. N.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2662

Two novel nonsurgical treatments of carpal tunnel syndrome
Schreiber, A. L., Sucher, B. M., Nazarian, L. N.
Physical Medicine and Rehabilitation Clinics of North America, 2014/05
2663

Osteopathy: helping pregnant women in pain
Randall, S.
The Practising Midwife, 2014/05
2664

An Unexpectedly Progressed Lumbar Herniated Disk
Gilliss, A. C.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2665

Determination of Genetic Factors Associated with Response to Osteopathic Manipulative Treatment (OMT) in Individuals with Chronic Lower Back Pain (CLBP)
Richardson, K. K.
Unpublished MSc thesis, 2014/05
2666

Lymphatic pump treatment enhances the lymphatic and immune system and ameliorates disease severity in a rat model of respiratory infection
Schander, A.
Unpublished PhD thesis, 2014/05
2667

The DREEM, part 2: psychometric properties in an osteopathic student population
Vaughan, B., Mulcahy, J., McLaughlin, P.
BMC Medical Education, 2014/05
Free full text
2668

Somatic dysfunction and use of osteopathic manual treatment techniques during ambulatory medical care visits: a CONCORD-PBRN study
Licciardone, J. C., Kearns, C. M., King, H. H., Seffinger, M. A., Crow, W. T., Zajac, P., Devine, W. H., Abu-Sbaih, R. Y., Miller, S. J., Berkowitz, M. R., Dyer, R., Heath, D. M., Treffer, K. D., Nevins, N. A., Aryal, S.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2669

The DREEM, part 1: measurement of the educational environment in an osteopathy teaching program
Vaughan, B., Carter, A., Macfarlane, C., Morrison, T.
BMC Medical Education, 2014/05
Free full text
2670

Introducing an osteopathic approach into neonatology ward: the NE-O model
Cerritelli, F., Martelli, M., Renzetti, C., Pizzolorusso, G., Cozzolino, V., Barlafante, G.
Chiropractic & Manual Therapies, 2014/05
Free full text
2671

Caring beyond the table: exploring New Zealand osteopaths’ experience of treating pregnant women: a descriptive phenomenological study
McCollum, F.
Unpublished MSc thesis, 2014/05
Free full text
2672

Investigation into factors influencing roles, relationships, and referrals in integrative medicine
Gray, B., Orrock, P.
The Journal of Alternative and Complementary Medicine, 2014/05
Free full text
2673

Effect of osteopathic manipulative therapy in the attentive performance of children with attention-deficit/hyperactivity disorder
Accorsi, A., Lucci, C., Di Mattia, L., Granchelli, C., Barlafante, G., Fini, F., Pizzolorusso, G., Cerritelli, F., Pincherle, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2674

Does fascia hold memories?
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2014/04
Free full text
2675

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2676

Strain counterstrain technique to decrease tender point palpation pain compared to control conditions: a systematic review with meta-analysis
Wong, C. K., Abraham, T., Karimi, P., Ow-Wing, C.
Journal of Bodywork and Movement Therapies, 2014/04
2677

Development of a data collection tool to profile osteopathic practice: use of a nominal group technique to enhance clinician involvement
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
2678

Anatomical landmark position--can we trust what we see? Results from an online reliability and validity study of osteopaths
Pattyn, E., Rajendran, D.
Manual Therapy, 2014/04
2679

Im Gespräch mit ... Sue Turner
(In dialog with Sue Turner)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
2680

Das fetale Alkoholsyndrom
(Fetal alcohol syndrome)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
2681

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2682

Auffinden von peripheren Nerven am Beispiel des N. radialis
(Locating peripheral nerves using the radial nerve as an example)
Van Loo, B.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
2683

Osteopathic management of mild leg length inequality with heel lift therapy: A pilot study analyzing altered gait kinetics and kinematics
Bens, S.
Unpublished MSc thesis, 2014/04
2684

Besserung der Symptome bei Multipler Sklerose
(Improvement of symptoms in multiple sclerosis)
Butenschön, W.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
2685

Concurrent validity of the Osteopathic General Surgery In-Service Examination
Falcone, J. L., Rosen, M. E.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2686

Approach to low back pain – osteopathy
Vaughan, B., Morrison, T., Buttigieg, D., Macfarlane, C., Fryer, G.
Australian Family Physician, 2014/04
Free full text
2687

Do placebo effects associated with sham osteopathic procedure occur in newborns? Results of a randomized controlled trial
Martelli, M., Cardinali, L., Barlafante, G., Pizzolorusso, G., Renzetti, C., Cerritelli, F.
Complementary Therapies in Medicine, 2014/04
2688

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2689

Relationship between COMLEX-USA scores and performance on the American Osteopathic Board of Emergency Medicine Part I certifying examination
Li, F., Gimpel, J. R., Arenson, E., Song, H., Bates, B. P., Ludwin, F.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2690

Osteopathic manipulative treatment as a useful adjunctive tool for pneumonia
Yao, S., Hassani, J., Gagne, M., George, G., Gilliar, W.
Journal of Visualized Experiments, 2014/04
Free full text
2691

Technical requirements to become an osteopathic physician
Sandhouse, M. E.
International Journal of Osteopathic Medicine, 2014/03/01/
2692

Usefulness of Video Learning for Osteopathic Manipulative Medicine Techniques in the Classroom and Clinical Setting
Meghpara, M., Yao, S. C., Flaum, T. B., Caron, E., Terzella, M. J.
The AAO Journal, 2014/03
Free full text
2693

Resolution of Post-traumatic Temporomandibular Joint Pain, Headache and Vision Changes with OMM in the Unified Field: A Case Report
Lipton, J. A., Case, M. G.
The AAO Journal, 2014/03
Free full text
2694

Osteopathic Manipulative Treatment of Pelvic Dysfunction in a Postpartum Patient with Co-Morbid Headaches: A Case Report
Kant, R., Berkowitz, M. R.
The AAO Journal, 2014/03
Free full text
2695

Osteopathic student satisfaction and preparedness to practice: A comparative study
Luciani, E., Cerritelli, F., Waters, M., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/03
2696

Hydrodynamik des Liquor cerebrospinalis – eine Neubewertung
(Cerebrospinal fluid hydrodynamics - A reassessment)
Chikly, B., Quaghebeur, J.
Osteopathische Medizin, 2014/03
2697

Osteopathic Manipulation in the Treatment of Primary Nocturnal Enuresis: A Retrospective Chart Review
Kanze, D. M., Kanze, K. A.
The AAO Journal, 2014/03
2698

Preliminary findings on the use of osteopathic manipulative treatment: outcomes during the formation of the practice-based research network, DO-Touch.NET
Degenhardt, B. F., Johnson, J. C., Gross, S. R., Hagan, C., Lund, G., Curry, W. J.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2699

Qualitative evaluation of osteopathic manipulative therapy in a patient with gastroesophageal reflux disease: a brief report
Diniz, L. R., Nesi, J., Curi, A. C., Martins, W.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2700

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03
2701

An investigation into the current practices and educational theories that underpin the teaching of palpation in osteopathic education: A Delphi study
Browning, S.
International Journal of Osteopathic Medicine, 2014/03
2702

The self-directed osteopathic medical student: Bringing adult learning into the osteopathic manipulative technique lab
Jons-Cox, L.A. D.
International Journal of Osteopathic Medicine, 2014/03
2703

Osteopathic manipulative treatment in tarsal somatic dysfunction: a case study
Alsager, D. E.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2704

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03
2705

Osteopathic manipulative therapy induces early plasma cytokine release and mobilization of a population of blood dendritic cells
Walkowski, S., Singh, M., Puertas, J., Pate, M., Goodrum, K., Benencia, F.
PLoS One, 2014/03
Free full text
2706

Vestibular dysfunction in patients with chronic pain or underlying neurologic disorders
Gilbert, J. W., Vogt, M., Windsor, R. E., Mick, G. E., Richardson, G. B., Storey, B. B., Herder, S. L., Ledford, S., Abrams, D. A., Theobald, M. K., Cunningham, D., Kelly, L., Herring, K. V., Maddox, M. L.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2707

OMT associated with reduced analgesic prescribing and fewer missed work days in patients with low back pain: an observational study
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/02
Free full text
2708

A qualitative grounded theory study of the conceptions of clinical practice in osteopathy – A continuum from technical rationality to professional artistry
Thomson, O. P., Petty, N. J., Moore, A. P.
Manual Therapy, 2014/02
2709

Correlation of the emergency medicine resident in-service examination with the American Osteopathic Board of Emergency Medicine Part I
Levy, D., Dvorkin, R., Schwartz, A., Zimmerman, S., Li, F.
Western Journal of Emergency Medicine, 2014/02
Free full text
2710

Should osteopathic students applying to allopathic emergency medicine programs take the USMLE Exam?
Weizberg, M., Kass, D., Husain, A., Cohen, J., Hahn, B.
Western Journal of Emergency Medicine, 2014/02
Free full text
2711

Osteopathic manipulative treatment in the management of biliary dyskinesia
Heineman, K.
The Journal of the American Osteopathic Association, 2014/02
Free full text
2712

Changes in Biomechanical Dysfunction With Osteopathic Manual Treatment in Patients With Chronic Low Back Pain According to Diabetes Mellitus Status
Panjwani, R., Kearns, C., Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/01
2713

Somatic dysfunction and fascia's gliding-potential
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text
2714

Development of a Novel Osteopathic Animal Modality of Inflammatory Bowel Disease: Preliminary Findings and Clinical Implications
Schander, A., Orlowski, A., McCarty, M., Hodge, L.
The Journal of the American Osteopathic Association, 2014/01
2715

Effect of Osteopathic Manipulative Medicine Thoracic Cage Techniques on Parkinson Disease Patients
Vazzana, K. M., Hart, A., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2014/01
2716

No place like HOME
Pham, J. T.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2717

Abdominal Muscles Are the Front Side of the Low Back
King, H. H.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2718

OMT Relieves Severe Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2719

Systematic Review Paints Incomplete Picture of OMT Research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2720

New frontiers in medical education: simulation technology at Campbell University School of Osteopathic Medicine
Maddox, R. W., Schmid, R. J.
North Carolina Medical Journal, 2014/01
2721

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01
2722

Patterns of misrepresentation of clinical findings on patient notes during the COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Gallagher, L. A., Langenau, E. E.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2723

Der lebendige Fuß des Menschen aus osteopathischer Sicht
(The living human foot from an osteopathic perspective)
Wales, A., Mitha, N., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2724

Der Osteopath am Fuße des Patienten
(The osteopath at the foot of the patient)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2725

Die Mechanik des Fußes
(The mechanics of the foot)
Zwierzchowska, Z., Vieten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2726

Die Galea aponeurotica als fasziale Struktur
(The galea aponeurotica as a fascial structure)
Barty, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2727

Ein neuer Ansatz zur Behandlung von Haltungsstörungen
(A new approach to the treatment of postural disorders)
Beck, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2728

Osteopathic Manual Treatment and Ultrasound Therapy for Chronic Low Back Pain: An Illustration of Osteopathic Semantic Confusion
Cymet, T. C.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2729

Osteopathic manual therapy as an adjunct treatment for the self-management of breast cancer related lymphoedema: A prospective case series
Eydt, E.
Unpublished MSc thesis, 2014/01
Free full text
2730

Corrigendum to “Osteopathic Manipulative Treatment (OMT) for Lower Urinary Tract Symptoms (LUTS) in women” [J. Bodyw. Mov. Ther. 17 (2013) 11–18]
Franke, H., Hoesele, K.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text
2731

Osteopathy and low back pain, acupuncture and in vitro fertilization, Tai Chi and osteoarthritis, Andrographis paniculata and ulcerative colitis, and acupressure and vertigo
Pettit, J., Glickman-Simon, R.
Explore (NY), 2014/01
2732

Osteopathic manipulative treatment of congenital talipes equinovarus: a case report
Andreoli, E., Troiani, A., Tucci, V., Barlafante, G., Cerritelli, F., Pizzolorusso, G., Renzetti, C., Vanni, D., Pantalone, A., Salini, V.
Journal of Bodywork and Movement Therapies, 2014/01
2733

Effects of 7-Technique Osteopathic Manipulative Protocol on Patients With COPD
Carter Decker, J., Tylski, E., Stevens Coe, J., McClain, R., Gautam, D., McClain, E. K., Ogden, R., Kolo, G.
The Journal of the American Osteopathic Association, 2014/01
2734

Efficacy of Osteopathic Manipulative Treatment on Pulmonary Function in Healthy Adult Male Subjects
Hines, P. J., Heinking, K., Henderson, K.
The Journal of the American Osteopathic Association, 2014/01
2735

Effect of Osteopathic Manipulative Treatment on Blood Lactate Clearance After High Intensity Exercise
Khuc, B. M., Mendez, J., Wong, T. S., Hiserote, R. M.
The Journal of the American Osteopathic Association, 2014/01
2736

Efectividad de la técnica osteopática BLT en el tratamiento conservativo del pie equinovaro infantil
(Efficacy of the osteopathic technique BLT in the conservative treatment of pediatric clubfoot)
Kimmerle, F.E.
Unpublished thesis, 2014
2737

Prevention curricula assessment of osteopathic medical schools in the United States
Dombrowski, H. T., Vincent, O. D., Wiley, C. L.
International Journal of Osteopathic Medicine, 2013/12
2738

Should we start carrying out HVT on disc herniations?
Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2013/12
2739

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12
2740

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12
2741

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12
2742

Emotional processing and its relationship to chronic low back pain
Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12
2743

OMT especially recommended for severe low back pain
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/12
2744

The OSCE in a pre-registration osteopathy program: Introduction and psychometric properties
Vaughan, B., Florentine, P.
International Journal of Osteopathic Medicine, 2013/12
2745

Does the diaphragm fatigue more easily in patients with recurrent low back pain?
Walker, S.
International Journal of Osteopathic Medicine, 2013/12
2746

Investigation of standardized patient ratings of humanistic competence on a medical licensure examination using Many-Facet Rasch Measurement and generalizability theory
Zhang, X., Roberts, W. L.
Advances in Health Sciences Education : Theory and Practice, 2013/12
2747

Preventive osteopathic manipulative treatment and stress fracture incidence among collegiate cross-country athletes
Brumm, L. F., Janiski, C., Balawender, J. L., Feinstein, A.
The Journal of the American Osteopathic Association, 2013/12
Free full text
2748

Vertebral Implantation of NELL-1 Enhances Bone Formation in Osteoporotic Sheep
Chiang, M. M.Y.
Unpublished MSc thesis, 2013/12
Free full text
2749

Use of OMT to Treat Patient with Ramsay Hunt Syndrome and HIV: A Case Study
Baker, J. P.
The AAO Journal, 2013/12
Free full text
2750

Potential New Dimensions in Dermatology: The Osteopathic Approach to Cutaneous Disease
Michunovich, A. M., Stern, R.
The AAO Journal, 2013/12
Free full text
2751

The Effect of the Student American Academy of Osteopathy Summer Preceptorship Program on Students’ Perception of Osteopathic Manipulative Treatment
Vazzana, K. M., Chan, V., Wenzel, C. H., Yao, S. C.
The AAO Journal, 2013/12
Free full text
2752

Lymphatic Pump Treatment Repeatedly Enhances the Lymphatic and Immune Systems
Schander, A., Padro, D., King, H. H., Downey, H. F., Hodge, L. M.
Lymphatic Research and Biology, 2013/12
2753

Patients' expectations of private osteopathic care in the UK
Chippendale, E.
International Journal of Osteopathic Medicine, 2013/12
2754

Treatment of refractory irritable bowel syndrome with visceral osteopathy: short-term and long-term results of a randomized trial
Attali, T. V., Bouchoucha, M., Benamouzig, R.
Journal of Digestive Diseases, 2013/12
2755

The effectiveness of the ‘Bruce Jones sacroiliac technique’ in treatment of people with chronic low back pain: a single cohort design
Hanson, G.
Unpublished MSc thesis, 2013/12
Free full text
2756

Outcomes of osteopathic manual treatment for chronic low back pain according to baseline pain severity: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Minotti, D. E.
Manual Therapy, 2013/12
Free full text
2757

Subcutaneous Pellet Testosterone Replacement Therapy: The “First Steps” in Treating Men With Spinal Cord Injuries
Gray, K. M., DeRosa, A.
The Journal of the American Osteopathic Association, 2013/12
Free full text
2758

Das biodynamische Konzept im Rahmen der Osteopathie
(The biodynamic concept in the framework of osteopathy)
Weber, K.H.
Osteopathische Medizin, 2013/11
2759

Rib-Raising-Technik verringert den Atemwegswiderstand
(Rib raising technique reduces airway resistance)
Braun, G.
Osteopathische Medizin, 2013/11
2760

Prevalence of visits to five types of complementary and alternative medicine practitioners by the general population: a systematic review
Cooper, K. L., Harris, P. E., Relton, C., Thomas, K. J.
Complementary Therapies in Clinical Practice, 2013/11
2761

Role of osteopathic structural diagnosis and osteopathic manipulative treatment for diabetes mellitus and its complications
Johnson, A. W., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2013/11
Free full text
2762

Pursuit of Complementary and Alternative Medicine Treatments in Adolescents With Cerebral Palsy
Majnemer, A., Shikako-Thomas, K., Shevell, M. I., Poulin, C., Lach, L., Schmitz, N., Law, M., Group the, Q.
Journal of Child Neurology, 2013/11
2763

Don't Throw the Baby Out With the Bath Water
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2764

Systematic Review of OMTh for Lower Urinary Tract Symptoms in Women Shows Benefit
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2765

Systematic Review of CAM Approaches to Otitis Media: The Otolaryngology Perspective
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2766

Gegenüberstellung von vizeralen Lehrsystemen verschiedener Osteopathieschulen in Deutschland. Eine Umfrage.
(Comparison of visceral approaches in different osteopathic schools in Germany. Survey)
Clostermann, A.
Unpublished D.O. thesis, 2013/10
2767

Influence of Manual Therapy on Functional Mobility After Joint Injury in a Rat Model
Ruhlen, R. L., Snider, E. J., Sargentini, N. J., Worthington, B. D., Singh, V. K., Pazdernik, V. K., Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2768

Response to “Letter to the Editor Regarding ‘The Somatic Connection: Manual Therapy Is Beneficial for Cervical Radiculopathy””
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2769

Effectiveness of osteopathic treatment in pregnant women suffering from low back pain (LBP). A randomized controlled trial
Gundermann, S.
Unpublished D.O. thesis, 2013/10
2770

Bewegung und Stille in der Arbeit mit Kindern
(Movement and stillness while working with children)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
2771

Abseits ausgetretener Pfade: Ein neuer Blick auf die Faszie
(Off the beaten paths: a new look at the fascia)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
2772

Gesichtsfeldeinschränkung nach Unfall
(Visual field impairment after accident)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
2773

Pattern and predictors of complementary and alternative medicine (CAM) use among pediatric patients with epilepsy
Doering, J. H., Reuner, G., Kadish, N. E., Pietz, J., Schubert-Bast, S.
Epilepsy & Behavior, 2013/10
2774

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2775

Prevention of progressive back-specific dysfunction during pregnancy: an assessment of osteopathic manual treatment based on Cochrane Back Review Group criteria
Licciardone, J. C., Aryal, S.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2776

Retrospective medical record review of an osteopathic manipulative medicine hospital consultation service
Snider, K. T., Snider, E. J., DeGooyer, B. R., Bukowski, A. M., Fleming, R. K., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2777

The effects of osteopathic treatment on common femoral artery blood flow and skin temperature in spinal cord injured and able-bodied individuals
Murray, D.
Unpublished MSc thesis, 2013/10
Free full text
2778

Patients' appraisals of public and private healthcare: a qualitative study of physiotherapy and osteopathy
Bradbury, K. J., Bishop, F. L., Yardley, L., Lewith, G.
Journal of Health Psychology, 2013/10
2779

A Prognostic approach to defining chronic pain across a range of musculoskeletal pain sites
Mason, J.
International Journal of Osteopathic Medicine, 2013/09
2780

Correlating increased stimulus sensitivity with objective biomarkers of spinal nociceptive hyperexcitability in chronic pain
Rickards, L. D.
International Journal of Osteopathic Medicine, 2013/09
2781

Osteopathic manipulative treatment (OMT) during labor facilitates a natural, drug-free childbirth for a primigravida patient: A case report
Smallwood, C. R., Borgerding, C. J., Cox, M. S., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2013/09
2782

Benefits of osteopathic manual treatment on chronic low back pain – At last, a large high quality clinical trial!
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/09
2783

Adding chiropractic manipulative therapy to standard medical care for patients with acute low back pain
Vaughan, B.
International Journal of Osteopathic Medicine, 2013/09
2784

Thoracic and abdominal lymphatic pump techniques inhibit the growth of S. pneumoniae bacteria in the lungs of rats
Creasy, C., Schander, A., Orlowski, A., Hodge, L. M.
Lymphatic Research and Biology, 2013/09
Free full text
2785

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: an illustration of osteopathic semantic confusion. Author reply
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text
2786

Osteopathic Management of a Family with Inherited Cervical Dystonia
Mancini, J. D., Burns, D. K.
The AAO Journal, 2013/09
Free full text
2787

Usefulness of Video Learning for Osteopathic Manipulative Medicine (OMM) Techniques in the Educational and Clinical Setting
Meghpara, M. K., Terzella, M. J., Flaum, T. B., Jung, M.K., Yao, S. C.
The AAO Journal, 2013/09
Free full text
2788

Frequency of counterstrain tender points in osteopathic medical students
Snider, K. T., Glover, J. C., Rennie, P. R., Ferrill, H. P., Morris, W. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text
2789

The importance of residency program size and location on American Osteopathic Board of Surgery In-Training Examination outcomes
Falcone, J. L., Rosen, M. E.
Journal of Surgical Research, 2013/09
2790

A single systems research design to examine the effectiveness of osteopathic treatment for people with osteoarthritis of the hip
Howat, T.
Unpublished MSc thesis, 2013/09
Free full text
2791

Offer and use of complementary and alternative medicine in hospitals of the French-speaking part of Switzerland
Carruzzo, P., Graz, B., Rodondi, P. Y., Michaud, P. A.
Swiss Medical Weekly, 2013/09
Free full text
2792

Interventions for preventing and treating pelvic and back pain in pregnancy
Pennick, V., Liddle, S. D.
Cochrane Database of Systematic Reviews, 2013/08
Free full text
2793

Traction for low-back pain with or without sciatica
Wegner, I., Widyahening, I. S., van Tulder, M. W., Blomberg, S. E., de Vet, H. C., Bronfort, G., Bouter, L. M., van der Heijden, G. J.
Cochrane Database of Systematic Reviews, 2013/08
Free full text
2794

The effect of OMT on postoperative medical and functional recovery of coronary artery bypass graft patients
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/08
Free full text
2795

Conservative approach to tardive dyskinesia-induced neck and upper back pain
Reifsnyder, J. W., Tettambel, M. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text
2796

Mathematical analysis of the flow of hyaluronic acid around fascia during manual therapy motions
Roman, M., Chaudhry, H., Bukiet, B., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2013/08
Free full text
2797

Effects of Osteopathic Manipulative Treatment on Self-Perceived Stress in First-Year Osteopathic Medical Students
Bianchi, W., Cooper, M., Roberts, C., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08
2798

Demonstration of Increased Vascular Characteristics Using Bilateral, Multiparameter Sensors After Controlled Vertebral Osteopathic Manipulative Treatment
Heath, D. M., Makin, I. R. S., Pedapati, C., Mast, T. D.
The Journal of the American Osteopathic Association, 2013/08
2799

Reducing Medical Student Fatigue With Osteopathic Manipulative Treatment
Wiegand, S., Jordan, L., Van Tiem, M., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08
2800

Peripheral Skin Blood Flow Changes After Different Controlled Cervical Osteopathic Mobilizations: A Pilot Study
Zegarra Parodi, R., Kvam, V., Park, P., Shurtz, N. R., Webb, S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/08
2801

Further Demonstration of the Benefit of Osteopathic Manipulative Therapy in Pediatric Care
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
2802

Osteopathic Manipulative Therapy Affects the Position of Internal Organs in Humans
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
2803

Osteopathic Manipulative Treatment Is Efficacious for Management of Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text
2804

Die osteopathische Behandlung der Geburtserfahrung
(Osteopathic treatment of the birth experience)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2805

Langfristige Begleitung eines Kindes mit spastischer Hemiparese
(Long-term treatment of a child with spastic hemiparesis)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2806

Okulomotorik und visuelle Teilleistungsstörungen
(Oculomotor and partial visual impairment)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2807

Effects of craniosacral therapy as adjunct to standard treatment for pelvic girdle pain in pregnant women: a multicenter, single blind, randomized controlled trial
Elden, H., Ostgaard, H. C., Glantz, A., Marciniak, P., Linner, A. C., Olsen, M. F.
ACTA Obstetricia et Gynecologica Scandinavica, 2013/07
Free full text
2808

Osteopathic manipulative treatment for facial numbness and pain after whiplash injury
Genese, J. S.
The Journal of the American Osteopathic Association, 2013/07
Free full text
2809

Die frühkindliche Bewegungsentwicklung
(Early childhood movement development)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2810

The short-term effect of a lymphatic pump protocol on blood cell counts in nursing home residents with limited mobility: a pilot study
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text
2811

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07
2812

Osteopathic manipulative treatment for pediatric conditions: a systematic review
Posadzki, P., Lee, M. S., Ernst, E.
Pediatrics, 2013/07
2813

Osteopathische Diagnostik und Behandlung bei Stillproblemen
(Osteopathic diagnostics and treatment for breastfeeding problems)
Haller, L.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2814

Efficacy of osteopathy and other manual treatment approaches for malocclusion – A systematic review of evidence
Andresen, T., Bahr, C., Ciranna-Raab, C.
International Journal of Osteopathic Medicine, 2013/06
2815

Osteopathic intervention for chronic pain, remaining thoracic stiffness and breathing impairment after thoracoabdominal oesophagus resection: A single subject design study
Bjerså, K., Sachs, C., Hyltander, A., Fagevik Olsén, M.
International Journal of Osteopathic Medicine, 2013/06
2816

Upper cervical manual techniques and measures of autonomic nervous system control
Chippendale, E.
International Journal of Osteopathic Medicine, 2013/06
2817

Alterations in the multifidus structure and activity in individuals with unilateral recurrent low back pain, despite being pain free and functionally recovered
Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2013/06
2818

Acute low back pain patient satisfaction one year after presenting to primary care
Macfarlane, C.
International Journal of Osteopathic Medicine, 2013/06
2819

Does lumbar spinal movement differ between patients who are healthy, those with simple low back pain and those with degenerative or pre-operative spinal conditions?
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2013/06
2820

Osteopathie und Unfruchtbarkeit
(Osteopathy and infertility)
Kermorgant, G.
Osteopathische Medizin, 2013/06
2821

Lungenentzündung – das Behandlungskonzept von A.T. Still
(Pneumonia - The treatment concept of A.T. Still)
Halasz, C.
Osteopathische Medizin, 2013/06
2822

Compliance with clinical guidelines for whiplash improved with a targeted implementation strategy: a prospective cohort study
Rebbeck, T., Macedo, L. G., Maher, C. G.
BMC Health Services Research, 2013/06
Free full text
2823

Osteopathic treatment of patients with long-term sequelae of whiplash injury: effect on neck pain disability and quality of life
Schwerla, F., Kaiser, A. K., Gietz, R., Kastner, R.
The Journal of Alternative and Complementary Medicine, 2013/06
2824

Osteopathic manipulative treatment and nutrition: An alternative approach to the irritable bowel syndrome
Collebrusco, L., Lombardini, R.
Health, 2013/06
Free full text
2825

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text
2826

Osteopathic manual treatment in patients with diabetes mellitus and comorbid chronic low back pain: subgroup results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2013/06
Free full text
2827

Treatment of a posterior rib utilizing a multimodal sequence of osteopathic manipulative treatments
Baker, J. P., Ely, R.
The AAO Journal, 2013/06
Free full text
2828

Distance learning and osteopathic manipulative medicine
Blumer, J. U.
The AAO Journal, 2013/06
Free full text
2829

Relief of persistent jaw pain with the use of osteopathic manipulative medicine
Lipton, J. A., Covington, J. D.
The AAO Journal, 2013/06
Free full text
2830

Osteopathic evaluation of somatic dysfunction and craniosacral strain pattern among preterm and term newborns
Pizzolorusso, G., Cerritelli, F., D', Orazio, M., Cozzolino, V., Turi, P., Renzetti, C., Barlafante, G., D', Incecco, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
2831

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
2832

Complementary and alternative medicine for pediatric otitis media
Levi, J. R., Brody, R. M., McKee-Cole, K., Pribitkin, E., O'Reilly, R.
International Journal of Pediatric Otorhinolaryngology, 2013/06
2833

Use of the SMART Balance Master to quantify the effects of osteopathic manipulative treatment in patients with dizziness
Fraix, M., Gordon, A., Graham, V., Hurwitz, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
2834

The effect of osteopathic manipulative treatment on postoperative medical and functional recovery of coronary artery bypass graft patients
Wieting, J. M., Beal, C., Roth, G. L., Gorbis, S., Dillard, L., Gilliland, D., Rowan, J.
The Journal of the American Osteopathic Association, 2013/05
Free full text
2835

Sham manual medicine protocol for cervical strain-counterstrain research
Brose, S. W., Jennings, D. C., Kwok, J., Stuart, C. L., O', Connell, S. M., Pauli, H. A., Liu, B.
PM&R: The Journal of Injury, Function and Rehabilitation, 2013/05
2836

Back to back: postnatal osteopathic care
Johnson, C.
The Practising Midwife, 2013/05
2837

La prise en charge medicale et osteopathique de l'enuresie nocturne primalre isolee.
(The medical and osteopathic management of isolated primary nocturnal enuresis)
Burguete, E., Dubois, T.
Soins Pédiatrie/Puériculture, 2013/05
2838

Manual Therapy May Benefit Women With Primary Dysmenorrhea
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2839

Severity of Irritable Bowel Syndrome Symptoms Is Reduced by Osteopathy
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2840

Manual Therapy May Benefit Women With Interstitial Cystitis and Pelvic Floor Pain
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2841

Patientenrechtegesetz: Was bedeutet es für Behandelnde?
(Patients' Rights Act: What does it mean for practitioners?)
Kämper, S.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
2842

Osteopathic intervention in chronic non-specific low back pain: a systematic review
Orrock, P. J., Myers, S. P.
BMC Musculoskeletal Disorders, 2013/04
Free full text
2843

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text
2844

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2845

Ohio osteopathic residency directors' self-reported administrative knowledge and skills before and after participation in an administrative training program
Sheehan, O. O., Brannan, G.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2846

Developing a chronic pain self-management clinic at the British School of Osteopathy: Quantitative pilot study results
Abbey, H., Nanke, L.
International Journal of Osteopathic Medicine, 2013/03
2847

Evaluation of behavioural and gastrointestinal symptoms in autistic children after visceral osteopathic treatment
Castellarin, I. B., Drysdale, I. P., Patel, V.
International Journal of Osteopathic Medicine, 2013/03
2848

Is osteopathic manipulative treatment effective in migraine?
Cerritelli, F., Caprari, E., Di Vincenzo, M., Ginevri, L. R., Messi, G., Renzetti, C., Cozzolino, V., Frattesi, C., Barlafante, G., Foschi, N.
International Journal of Osteopathic Medicine, 2013/03
2849

Osteopathic principles in the modern world
Cotton, A.
International Journal of Osteopathic Medicine, 2013/03
2850

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03
2851

From distinct to indistinct, the life cycle of a medical heresy. Is osteopathic distinctiveness an anachronism?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2013/03
2852

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03
2853

Lymphatic pump treatment enhances the clearance of pneumonia
Scander, A., Hodge, L. M.
International Journal of Osteopathic Medicine, 2013/03
2854

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
2855

Clinical reasoning and therapeutic approaches of experienced osteopaths
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
2856

Enuresis als Folge eines erhöhten Drucks in den Kavitäten – ein Fallbeispiel
(Enuresis as a consequence of an increased pressure in the cavities – A case study)
Klein, M.
Osteopathische Medizin, 2013/03
2857

Untersuchung des Einflusses der Osteopathie auf das obstruktive Schlafapnoesyndrom
(Study of the influence of osteopathy on obstructive sleep apnea syndrome)
Dahlke, J.
Osteopathische Medizin, 2013/03
2858

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Minotti, D. E., Gatchel, R. J., Kearns, C. M., Singh, K. P.
Annals of Family Medicine, 2013/03
Free full text
2859

An Exploration of Emerging Professional Identity in Women Osteopathic Medical Students: Does Gender Matter?
Dunatov, L. J.
Unpublished Dissertation, 2013/03
2860

Effect of osteopathic manipulative treatment on incidence of postoperative ileus and hospital length of stay in general surgical patients
Baltazar, G. A., Betler, M. P., Akella, K., Khatri, R., Asaro, R., Chendrasekhar, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text
2861

Somatic hygiene: osteopathic manipulative medicine as preventive treatment
Bowers, R. J.
The Journal of the American Osteopathic Association, 2013/03
Free full text
2862

Osteopathic manipulative treatment for colonic inertia
Cohen-Lewe, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text
2863

Osteopathic manipulative treatment for Lyme disease-induced Bell’s palsy: A case study
Baker, J. P., Baker, C. D.
The AAO Journal, 2013/03
Free full text
2864

Evaluating teaching methods and assessment tools of high velocity low amplitude techniques for undergraduate osteopathic manipulative treatment of the spine
Channell, M. K.
The AAO Journal, 2013/03
Free full text
2865

Osteopathic manipulative treatment of pes anserine bursitis using the triple technique: A case report
Chmielewski, R., Peña, N., Capalbo, G.
The AAO Journal, 2013/03
Free full text
2866

Sensory integration syndrome or developmental coordination disorder: A case report
Crow, T.
The AAO Journal, 2013/03
Free full text
2867

Gait disturbance in the elderly: Contribution of an osteopathic treatment
Huard, Y.
The AAO Journal, 2013/03
Free full text
2868

Normalization of thoracoabdominal fascial and autononic tone: A case study for the diagnosis and treatment of atypical chest pain
Litman, R. G.
The AAO Journal, 2013/03
Free full text
2869

Sequelae of traumatic closed-head injury: A case report of a 71-year-old male seen forty years later
Litman, R. G.
The AAO Journal, 2013/03
Free full text
2870

‘POSTE’ study (Patients OSTeopathic Experience): A UK national survey of patients: Part III
Drysdale, I. P., Rolfe, K. J., Hinkley, H.
International Journal of Osteopathic Medicine, 2013/03
2871

Langzeiteffekte osteopathischer Behandlungen bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom : 5-Jahres-Follow-up einer randomisiert kontrollierten Studie und Uberlegungen zum pathophysiologischen Kontext.
(Long-term effects of osteopathic treatment of chronic prostatitis with chronic pelvic pain syndrome: a 5-year follow-up of a randomized controlled trial and considerations on the pathophysiological context)
Marx, S., Cimniak, U., Rutz, M., Resch, K.L.
Urologe A, 2013/03
2872

OMT: Reducing Pain and Changing International Patient Perception
Lim, L., Gordon, T., Sergent, S., Hawkins, J., Simon, J., Bajoka, B., Favazza, L., Wiseman, K., Schrotenboer, A., Cameroamortegui, F., Willyerd, G., Gorbis, S.
The Journal of the American Osteopathic Association, 2013/03
2873

Achieving Effective and Efficient Musculoskeletal Pain Relief Through TCM and OMM
Moy, C., Yu, J., Chiu, R., Hwang, Y. C., Lin, W., Lin, S.L., Burns, J., Lin, A.
The Journal of the American Osteopathic Association, 2013/03
2874

Referrals to chiropractors and osteopaths: a survey of general practitioners in rural and regional New South Wales, Australia
Wardle, J. L., Sibbritt, D. W., Adams, J.
Chiropractic & Manual Therapies, 2013/02
Free full text
2875

Strain-counterstrain to treat restrictions of the mobility of the cervical spine in patients with neck pain: a sham-controlled randomized trial
Klein, R., Bareis, A., Schneider, A., Linde, K.
Complementary Therapies in Medicine, 2013/02
Free full text
2876

Charakteristik von Nebenwirkungen, die im Rahmen der Osteopathieausbildung bei Studenten auftreten (im Vergleich zu Nebenwirkungen, die im Rahmen der Chiropraxisausbildung auftreten)
(Adverse events sustained by osteopathic students during their undergraduate training at an osteopathic school (compared with adverse events sustained by chiropractic students during their undergraduate training))
Steger, S.
Unpublished MSc thesis, 2013/02
2877

Predictors of scoring at least 600 on COMLEX-USA Level 1: successful preparation strategies
Vora, A., Maltezos, N., Alfonzo, L., Hernandez, N., Calix, E., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2013/02
Free full text
2878

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
2879

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
2880

Efeitos da técnica de strain-counterstrain sobre os músculos mastigatórios em mulheres com disfunção temporomandibular
(Effects of strain-counterstrain technique in masticatory muscles of women with temporomandibular disorder: a randomized double-blind placebo-controlled trial)
Stefanelli, V. C.
Unpublished MSc thesis, 2013/02
Free full text
2881

Headache in children: update on complementary treatments
Schetzek, S., Heinen, F., Kruse, S., Borggraefe, I., Bonfert, M., Gaul, C., Gottschling, S., Ebinger, F.
Neuropediatrics, 2013/02
Free full text
2882

Comparison of gait training versus cranial osteopathy in patients with Parkinson's disease: a pilot study
Muller, T., Pietsch, A.
NeuroRehabilitation, 2013/02
2883

Exercise Shown Effective for Management of Neck Pain—Who Needs OMT?
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text
2884

Frozen Shoulder Treatment—Different Strokes for Different Folks
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text
2885

Trauma: Betrachtung aus osteopathischer Sicht
(Trauma: Viewed from an osteopathic perspective)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
2886

Polytrauma durch Motorradunfall
(Polytrauma due to motorcycle accident)
Koop, J. P.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
2887

Osteopathic Fascial Manipulation Reduces Low Back Pain and Increases Kidney Mobility
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/01
Free full text
2888

Abdominal Visceral Manipulation Prevents and Reduces Peritoneal Adhesions
Seffinger, M. A., Martin, A. J.
The Journal of the American Osteopathic Association, 2013/01
Free full text
2889

Patienten mit Demenz: Das sollten Sie im Umgang mit ihnen beachten
(Patients with dementia: What you should bear in mind when dealing with them)
Maier, R., Mayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
2890

Die Rolle des Diaphragmas bei der lymphatischen Absorption aus der Peritonealhöhle
(The role of the diaphragm in lymphatic absorption from the peritoneal cavity)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
2891

Der Einfluss einer manipulativen Technik auf den Occiput-Atlas-Axis-Komplex (OAA) im Vergleich zu einer lokalen Wärmebehandlung des OAA-Bereiches auf die habituelle Okklusion
(The influence of manipulative treatment of the Occiput Atlas Axis (OAA) Complex in comparison to a local heat application of the OAA Complex on habitual occlusion)
Haase, H.
Unpublished MSc thesis, 2013/01
2892

Untersuchung der Wirksamkeit der Osteopathie im Rahmen der gesundheitsbedingten Lebensqualität im Wochenbett
(Investigating the efficacy of Osteopathy in Childbed - regarding the health related quality of life of the mothers)
Dlugos, J. M.
Unpublished MSc thesis, 2013/01
Free full text
2893

Beschwerden in der Schwangerschaft – Kann Osteopathie die Lebensqualität beeinflussen?
(Complaints during pregnancy – Can osteopathy influence the patient’s quality of life?)
Göttlich, G.
Unpublished MSc thesis, 2013/01
Free full text
2894

Osteopathic manipulative treatment (OMT) for lower urinary tract symptoms (LUTS) in women
Franke, H., Hoesele, K.
Journal of Bodywork and Movement Therapies, 2013/01
2895

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text
2896

Die Rolle der Osteopathie im Umgang mit Trauma – ein persönlicher Bericht
(The role of osteopathy in dealing with trauma - a personal account)
Brown, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
2897

Biotensegrity: a unifying theory of biological architecture with applications to osteopathic practice, education, and research--a review and analysis
Swanson, R. L.
The Journal of the American Osteopathic Association, 2013/01
Free full text
2898

A comparative study of cervical hysteresis characteristics after various osteopathic manipulative treatment (OMT) modalities
Barnes, P. L., Laboy, F., Noto-Bell, L., Ferencz, V., Nelson, J., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2013/01
2899

Visceral massage reduces postoperative ileus in a rat model
Chapelle, S. L., Bove, G. M.
Journal of Bodywork and Movement Therapies, 2013/01
2900

The suitability of sham treatments for use as placebo controls in trials of spinal manipulative therapy: a pilot study
Lougee, H., Johnston, R. G., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2013/01
Free full text
2901

Manual therapy for childhood respiratory disease: a systematic review
Pepino, V. C., Ribeiro, J. D., Ribeiro, M. A., de Noronha, M., Mezzacappa, M. A., Schivinski, C. I.
Journal of Manipulative and Physiological Therapeutics, 2013/01
2902

Investigating inter-relationships between pain, mobility, and posture following osteopathic treatment in patients with chronic neck pain
Frith, K. L.
Unpublished MSc thesis, 2013/01
Free full text
2903

Use of OMT in Recreational Runners as Preventive Medicine
Daly, J., Zhu, C., Hanna, J.
The Journal of the American Osteopathic Association, 2013/01
2904

Die Gesundheit im Trauma entdecken
(Discovering health within trauma)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
2905

Survey of Patient Knowledge of Osteopathic Physicians and Osteopathic Manipulative Treatment
Snell, P. D., AbdurRaqeeb, O. A., Smith, T. L., Huckabee, M. M., Keenum, A.
The Journal of the American Osteopathic Association, 2013/01
2906

Prevalencia de incontinencia urinaria en mujeres que consultan por dolor lumbopélvico: estudio multicéntrico
(Prevalence of urinary incontinence in women consulting for lumbopelvic pain: a multicenter study.)
Gavira Pavón, A.
Unpublished PhD thesis, 2013
2907

An investigation of cranial motion through a review of biomechanically based skull deformation literature
Seimetz, C. N., Kemper, A. R., Duma, S. M.
International Journal of Osteopathic Medicine, 2012/12
2908

Manual therapy for chronic obstructive airways disease: a systematic review of current evidence
Heneghan, N. R., Adab, P., Balanos, G. M., Jordan, R. E.
Manual Therapy, 2012/12
Free full text
2909

Nouvelle technique passive d’ouverture de la trompe d’Eustache. Évaluation par tympanométrie de l’effet d’une nouvelle manipulation sur l’ouverture de la trompe d’Eustache chez les enfants de moins de six ans atteints d’une otite moyenne avec ou sans effusion
(New passive technique for opening the Eustachian tube. Evaluation by tympanometry of the effect of a new manipulation on the opening of the Eustachian tube in children under six years of age with otitis media with or without effusion)
El Hachem, N., Halimi, M.
Kinésithérapie, la Revue, 2012/12
Free full text
2910

Osteopathic diagnosis and treatment of sacral fracture: A case study
Dean, A. L.
The AAO Journal, 2012/12
Free full text
2911

Osteopathische manuelle Behandlung von Scharlach bei Kindern im 19. und 20. Jahrhundert
(Osteopathic manual treatment of scarlet fever in children in the 19th and 20th centuries)
Liem, T., Ciranna-Raab, C.
Osteopathische Medizin, 2012/12
2912

Methods of assessment used by osteopathic educational institutions
Vaughan, B., Sullivan, V., Gosling, C., McLaughlin, P., Fryer, G., Wolff, M., Gabb, R.
International Journal of Osteopathic Medicine, 2012/12
2913

Manipulative therapies for infantile colic
Dobson, D., Lucassen, P. L., Miller, J. J., Vlieger, A. M., Prescott, P., Lewith, G.
Cochrane database of systematic reviews, 2012/12
Free full text
2914

A systematic review to evaluate the clinical benefits of craniosacral therapy
Jäkel, A., von Hauenschild, P.
Complementary Therapies in Medicine, 2012/12
2915

Establishing the content validity of palpatory examination for the assessment of the lumbar spine using ultrasonography: a pilot study
Shaw, K. A., Dougherty, J. J., Treffer, K. D., Glaros, A. G.
The Journal of the American Osteopathic Association, 2012/12
Free full text
2916

Depression, somatization, and somatic dysfunction in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Gatchel, R. J., Kearns, C. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2012/12
Free full text
2917

Touch - more than a basic science
Lalonde, F.
The Journal of the American Osteopathic Association, 2012/12
Free full text
2918

Manipulation of the coccyx with anesthesia for the management of coccydynia
Emerson, S. S., Speece III., A. J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
2919

The effect of osteopathic manual therapy on the vascular supply to the lower extremity in individuals with knee osteoarthritis: A randomized trial
Jardine, W. M., Gillis, C., Rutherford, D.
International Journal of Osteopathic Medicine, 2012/12
2920

A research protocol to determine if OMM is effective in decreasing pain in chronic pain patients and decreasing opioid use: Brief report
Smith, J. B., Ridpath, L. C., Steele, K. M.
The AAO Journal, 2012/12
Free full text
2921

Isolated calcaneofibular ligament injuries treated with osteopathic manipulative treatment: A case series
Olds, K., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/12
2922

Bibliometric measures and National Institutes of Health funding at colleges of osteopathic medicine, 2006-2010
Suminski, R. R., Hendrix, D., May, L. E., Wasserman, J. A., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/11
Free full text
2923

Complementary and Alternative Therapies in Surgical Care
Bjerså, K.
Unpublished PhD thesis, 2012/11
Free full text
2924

Osteopathic manipulative treatment: much more than simply a “hands-on“ phenomenon
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text
2925

Die osteopathische Behandlung von Frauen mit Gebärmuttersenkung. Randomisierte kontrollierte Studie.
(Osteopathic treatment of women with pelvic organ prolapse. A randomized controlled trial)
Amendt, J., Thannheimer, Y.
Unpublished D.O. thesis, 2012/10
2926

Die möglichen Effekte von osteopathischen Behandlungen bei komatösen Patienten mit erhöhtem Hirndruck
(Possible effects of osteopathic treatments in comatose patients with intracranial hypertension. Exploratory Observational Study)
Arens, O., Blum, A., Braun, S.
Unpublished D.O. thesis, 2012/10
2927

Bemerkenswerte Fortschritte bei behinderten Patienten durch „evolutionäre Osteopathie“
(Remarkable progress in disabled patients through “evolutionary osteopathy“)
Deslee, E., Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
2928

Einfluss der osteopathischen Behandlung auf die Lebensqualität von Kindern und Jugendlichen mit Asthma. Prä-Post Studie.
(The influence of osteopathic treatment on quality of life in children and adolescents with asthma. A pre-post study)
Berning, F., Hagoort, J.
Unpublished D.O. thesis, 2012/10
2929

Effektivität der osteopathischen Behandlung bei Patienten mit „Trockenem Auge“. Randomisierte kontrollierte Studie.
(The effectiveness of osteopathic treatment in patients suffering from dry eye disease (DED). A randomized controlled study)
Biwer, A.
Unpublished D.O. thesis, 2012/10
2930

Osteopathische Behandlung von Patienten mit Restless-Legs-Syndrom. Randomisierte kontrollierte Studie.
(Osteopathic treatment of patients with restless legs syndrome. Randomized controlled trial)
Bonacker, M., Gabriel, S., Ruchser, J.
Unpublished D.O. thesis, 2012/10
2931

Why reservations remain: a critical reflection about the systematic review and meta-analysis “Osteopathic manipulative treatment for low back pain“ by Licciardone et al
Franke, H.
Journal of Bodywork and Movement Therapies, 2012/10
2932

(Evaluation of the Effectiveness of Osteopathic Treatment on Cholesterol Levels in Patients Suffering from Hypercholesterolemia. A randomized controlled study)
Eggers, G.
Unpublished D.O. thesis, 2012/10
2933

Die Auswirkungen von osteopathischen Behandlungen bei Patient/innen mit dem Fibromyalgiesyndrom. Prä-Post Studie.
(Osteopathic treatment effects in patients with fibromyalgia. Pre-Post Study)
Gleich, A., Klein, C., Sheriff, S.
Unpublished D.O. thesis, 2012/10
Free full text
2934

(Osteopathic treatment of patients with shoulder pain. A randomized controlled study)
Hinse, T., Klosterkamp, M.
Unpublished D.O. thesis, 2012/10
2935

Können osteopathische Behandlungen die Symptomatik sowie die Häufigkeit des chronischen Spannungskopfschmerzes verbessern? Randomisierte kontrollierte Studie.
(Can osteopathic treatments improve the symptoms and the frequency of Chronic Tension-Type headache (CTTH)? A randomized controlled trial)
Koralewski, D., Kothe, M., Schröter, C.
Unpublished D.O. thesis, 2012/10
2936

Wirkung von osteopathischen Behandlungen bei Kindern mit Rechenstörungen in der 3. Klasse Grundschule. Eine randomisierte kontrollierte Studie.
(To evaluate the effectiveness of osteopathic treatment in 3rd elementary school class children suffering from dyscalculia. A randomized controlled trial)
Nickels-Kratz, K.
unpublished D.O. thesis, 2012/10
2937

Die osteopathische Behandlung bei Frauen mit persistierenden Rückenschmerzen post partum. Randomisierte kontrollierte Studie.
(Osteopathic treatment in women with persistent low back pain after childbirth. A randomized controlled trial)
Rother, D., Rother, K.
Unpublished D.O. thesis, 2012/10
2938

Die Beweglichkeit des Dünndarms bei In- und Exspiration
(The mobility of the small intestine during inspiration and expiration)
Schröter, F.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
2939

Wirksamkeit osteopathischer Behandlungen bei Kindern mit habitueller, idiopathischer Epistaxis. Randomisierte kontrollierte Studie
Effectiveness of osteopathic treatment in children with . A randomized controlled trial.
Bergau, R, Strunk, A
Unpublished D.O. thesis, 2012/10
2940

The immediate effects of sigmoid colon manipulation on pressure pain thresholds in the lumbar spine
McSweeney, T. P., Thomson, O. P., Johnston, R.
Journal of Bodywork and Movement Therapies, 2012/10
Free full text
2941

971 Neonatology-Osteopathy (Ne-O) Study: RCT on the Effect of Osteopathic Manipulative Treatment on Los
Accorsi, A., Lucci, C., Pizzolorusso, G., Tubaldi, L., Cerritelli, F., Perri, F. P.
Archives of Disease in Childhood, 2012/10
2942

Osteopathic manipulative treatment in obese patients with chronic low back pain: a pilot study
Vismara, L., Cimolin, V., Menegoni, F., Zaina, F., Galli, M., Negrini, S., Villa, V., Capodaglio, P.
Manual Therapy, 2012/10
Free full text
2943

Posture and chronic gonalgia in the elderly: contribution of osteopathic treatment
Huard, Y.
Computer Methods in Biomechanics and Biomedical Engineering, 2012/10
2944

Geographic patterns in primary care visits provided by osteopathic physicians
Licciardone, J. C.
Family Medicine, 2012/10
2945

Osteopathic manipulative treatment: novel application to dermatological disease
Campbell, S. M., Winkelmann, R. R., Walkowski, S.
Journal of Clinical and Aesthetic Dermatology, 2012/10
2946

Heterotaxien in der menschlichen Entwicklung
(Heterotaxies in human development)
Doll, S.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
2947

Combined manual therapy techniques for the treatment of women with infertility: a case series
Kramp, M. E.
The Journal of the American Osteopathic Association, 2012/10
Free full text
2948

Inter and intra-rater reliability of rating criteria for the Floor Sitting Posture Screen
Houvenagel, M.
Unpublished MSc thesis, 2012/10
Free full text
2949

Die physiologische Entwicklung in den ersten Lebensjahren
(The physiological development in the first years of life)
Guerassimiouk, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
2950

Consent in osteopathy: A cross sectional survey of patients' information and process preferences
Daniels, G., Vogel, S.
International Journal of Osteopathic Medicine, 2012/09
2951

Osteopathic manipulative treatment of somatic dysfunction as an integral component in the care of patients with chronic medical disease: A thirty-month study in rural Appalachia
Litman, R. G.
The AAO Journal, 2012/09
Free full text
2952

An open letter to those in purely osteopathic manipulative medicine practices on reimbursement strategies
Jorgensen, D. J.
The AAO Journal, 2012/09
2953

Somatic dissatisfaction - Somatic dysfunction and the role of intention in treatment
Comeaux, Z. J.
The AAO Journal, 2012/09
Free full text
2954

Follow-up to: OMT and exercises for a patient with limited knee range of motion prior to knee replacement: A case report
Clark, R. C.
The AAO Journal, 2012/09
Free full text
2955

Using manual and conventional therapies to enhance musculoskeletal health: highlights of the Osteopathic Research Center's 10th Anniversary Conference
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/09
Free full text
2956

Osteopathie bei Infantiler Zerebralparese – Pilotstudie Kann durch craniale Behandlung ein positiver Effekt auf die Gelenksbeweglichkeit bei Infantiler Zerebralparese erzielt werden?
(Osteopathic Treatment in Cases of Infantile Cerebral Palsy – Pilot Study Does cranial treatment achieve a positive effect on joint mobility in cases of infantile cerebral palsy?)
Palko, P.
Unpublished MSc thesis, 2012/09
Free full text
2957

Die Anamnese in der Osteopathie - Theorie und Praxis
(Case History Taking in Osteopathy - Theory and Practice)
Mena, J. E.R.
Unpublished MSc thesis, 2012/09
Free full text
2958

Osteopathie und ihre Effektivität bei Fasciitis plantaris
(Osteopathy and its effectiveness in fasciitis plantaris)
Burmeister, S.
Unpublished MSc thesis, 2012/09
Free full text
2959

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving the quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Gulisano, V., Orfei, S.
Clinical Cases in Mineral and Bone Metabolism, 2012/09
Free full text
2960

Einfluss der osteopathischen Behandlung auf die Blutdruckwerte bei Patienten mit essentieller arterieller Hypertonie
(Influence of Osteopathic Treatment on Blood Pressure Values of Patients with Essential Arterial Hypertension)
Wasserfaller, A.
Unpublished MSc thesis, 2012/09
Free full text
2961

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text
2962

Advancing osteopathic medicine through research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2012/09
Free full text
2963

Associations of cytokine concentrations with key osteopathic lesions and clinical outcomes in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Bergamini, M. V.
The Journal of the American Osteopathic Association, 2012/09
Free full text
2964

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text
2965

Precompetition manipulative treatment and performance among Virginia Tech athletes during 2 consecutive football seasons: a preliminary, retrospective report
Brolinson, P. G., Smolka, M., Rogers, M., Sukpraprut, S., Goforth, M. W., Tilley, G., Doolan, K. P.
The Journal of the American Osteopathic Association, 2012/09
Free full text
2966

Neuropathy of the inferior alveolar nerve: A case report
Seals, R. A., Crow, T.
The AAO Journal, 2012/09
Free full text
2967

Assessing the effectiveness of OMT provided by predoctoral teaching fellows as measured by a visual analog pain scale
Sarkaria, J. A., Render, R. M., Lerma, C. M., Henley, N., Seffinger, M. A., Hruby, R. J.
The AAO Journal, 2012/09
Free full text
2968

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the USMLE
Lenchus, J. D.
The Journal of the American Osteopathic Association, 2012/08
Free full text
2969

What puts the adverse in 'adverse events'? Patients' perceptions of post-treatment experiences in osteopathy - a qualitative study using focus groups
Rajendran, D., Bright, P., Bettles, S., Carnes, D., Mullinger, B.
Manual Therapy, 2012/08
2970

Spinal manipulations for tension-type headaches: A systematic review of randomized controlled trials
Posadzki, P., Ernst, E.
Complementary Therapies in Medicine, 2012/08
2971

Osteopathy improves the severity of irritable bowel syndrome: a pilot randomized sham-controlled study
Florance, B. M., Frin, G., Dainese, R., Nebot-Vivinus, M. H., Marine Barjoan, E., Marjoux, S., Laurens, J. P., Payrouse, J. L., Hebuterne, X., Piche, T.
European Journal of Gastroenterology & Hepatology, 2012/08
Free full text
2972

Psoas syndrome: a frequently missed diagnosis
Tufo, A., Desai, G. J., Cox, W. J.
The Journal of the American Osteopathic Association, 2012/08
Free full text
2973

Preventative Osteopathic Manipulative Treatment and the Elderly Nursing Home Resident: A Pilot Study
Snider, K. T., Snider, E. J., Johnson, J. C., Hagan, C., Schoenwald, C.
The Journal of the American Osteopathic Association, 2012/08
Free full text
2974

Touch: vital to patient-physician relationships
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/08
Free full text
2975

Frequency of specific osteopathic manipulative treatment modalities used by candidates while taking COMLEX-USA Level 2-PE
Langenau, E. E., Dowling, D. J., Dyer, C., Roberts, W. L.
The Journal of the American Osteopathic Association, 2012/08
Free full text
2976

Neonatology-Osteopathy (NE-O) Study: A Randomized Controlled Trial on the Effect of Osteopathic Manipulative Treatment on Length of Stay
Accorsi, A., Lucci, C., Lancellotti, J., Pizzolorusso, G., Santini, N., Durastanti, C., Barlafante, G., Tubaldi, L., Perri, F. P., Cerritelli, F.
The Journal of the American Osteopathic Association, 2012/08
2977

Lymphatic Pump Technique Enhances Pulmonary Immunity and Facilitates the Clearance of Respiratory Infection With Streptococcus pneumoniae
Schander, A., Orlowski, A., Hodge, L.
The Journal of the American Osteopathic Association, 2012/08
2978

Three-Dimensional Analysis of OMT in the Post–Total Arthroplasty Knee
Simela, A.
The Journal of the American Osteopathic Association, 2012/08
2979

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text
2980

Acute Effects of Osteopathic Manipulative Treatment on Persistent Hindlimb Flexion
Winterson, B., McDevitt Ray, B., Assadollahzadeh, M., Chipman, M. A.
The Journal of the American Osteopathic Association, 2012/08
2981

Quels traitements pour les coliques du nourrisson?
(Which treatments for infantile colics?)
Bruyas-Bertholon, V., Lachaux, A., Dubois, J.P., Fourneret, P., Letrilliart, L.
La Presse Médicale, 2012/07-08
2982

Topografie des weiblichen Beckens
(Topography of the female pelvis)
Lütjen-Drecoll, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
2983

Selbst anzuwendende Übungen für Patienten im osteopathischen Kontext
(Home-based exercises for patients in the osteopathic context)
Resch, A.
Unpublished MSc thesis, 2012/07
Free full text
2984

Stressinkontinenz nach einer Geburt
(Stress incontinence after childbirth)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
2985

„Sacral Sag“ und mögliche klinische Folgen
(“Sacral Sag“ and possible clinical consequences)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
2986

We have met the enemy and he is us
Vanderburgh, A. J.
The Journal of the American Osteopathic Association, 2012/07
Free full text
2987

Increase of lower esophageal sphincter pressure after osteopathic intervention on the diaphragm in patients with gastroesophageal reflux
da Silva, R. C., de Sa, C. C., Pascual-Vaca, A. O., de Souza Fontes, L. H., Herbella Fernandes, F. A., Dib, R. A., Blanco, C. R., Queiroz, R. A., Navarro-Rodriguez, T.
Diseases of the Esophagus, 2012/07
Free full text
2988

Kreuzschmerzen während der Schwangerschaft
(Low back pain during pregnancy)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
2989

Osteopathic manipulative treatment to resolve head and neck pain after tooth extraction
Meyer, P. M., Gustowski, S. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
2990

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
2991

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
2992

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text
2993

The safety and efficacy of osteopathic manipulation in the treatment of mTBI (mild traumatic brain injury) in U.S. service members as validated by SPECT scan: A report of planned research
Nevins, N. A., Fraix, M.
The AAO Journal, 2012/06
Free full text
2994

A consideration of the elbow as a tensegrity structure
Scarr, G.
International Journal of Osteopathic Medicine, 2012/06
2995

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06
2996

Was ist Gesundheit? Was ist Krankheit? Überlegungen zu einem Problemkomplex
(What is health? What is disease? Deliberations about a complex of problems)
Flatscher, M., Liem, T.
Osteopathische Medizin, 2012/06
2997

Kommentar zur HVT-Technik bei Säuglingen und Kleinkindern
(Comment on the HVT technique in infants and small children)
Gillemot, B.
Osteopathische Medizin, 2012/06
2998

Assessment of the influence of osteopathic myofascial techniques on normalization of the vocal tract functions in patients with occupational dysphonia
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Malinska, J., Golusinski, W., Sliwinska-Kowalska, M.
International Journal of Occupational Medicine and Environmental Health, 2012/06
2999

Osteopathic manipulative medicine for carpal tunnel syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3000

Osteopathic manipulative treatment in pregnant women
Lavelle, J. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3001

Empathy in osteopathic medical students: a cross-sectional analysis
Kimmelman, M., Giacobbe, J., Faden, J., Kumar, G., Pinckney, C. C., Steer, R.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3002

Application of osteopathic manipulative treatment to a patient with unremitting chest pain and shortness of breath undergoing “Rule-Out Myocardial Infarction” protocol for one week
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/06
3003

Pudendal nerve entrapment in a bareback rodeo cowboy: A case study
Lafave, M. R., Sutter, B.
International Journal of Osteopathic Medicine, 2012/06
3004

Efficacy of osteopathic manipulative treatment for low back pain in euhydrated and hypohydrated conditions: a randomized crossover trial
Parker, J., Heinking, K. P., Kappler, R. E.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3005

Iliacus tender points in young adults: a pilot study
Liu, Y., Palmer, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3006

Osteopathic treatment of chronic gonalgia in the elderly: Changes in pain and posture
Huard, Y.
The AAO Journal, 2012/04
Free full text
3007

Kopfschmerzen: Behandlung nach dem Fasziendistorsionsmodell
(Headache: treatment according to the fascial distortion model)
Nagel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
3008

Zeitmanagement – Entschleunigen Sie Ihr Leben!
(Time management - slow down your life!)
Schopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
3009

Im Gespräch mit … Lorenz Wilkens
(In dialog with Lorenz Wilkens)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
3010

Assessment of Low Back and Pelvic Pain after applying the Pelvis Global Manipulation Technique in Patients with Primary Dysmenorrhea: A Pilot Study
Molins-Cubero, S., Boscá-Gandia, J. J., Rus-Martinez, M. A.
European Journal Osteopathy & Related Clinical Research, 2012/04
Free full text
3011

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text
3012

Wie Vorstellungen die Beschwerden der Patienten beeinflussen
(How beliefs influence patient discomforts)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
3013

Dysfunktionen der Faszien als beschwerdeunterhaltender Faktor
(Dysfunctions of the fascia as a complaint-sustaining factor)
Forner, K.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
3014

Prediction of Osteopathic Medical School Performance on the basis of MCAT score, GPA, sex, undergraduate major, and undergraduate institution
Dixon, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
3015

Das Fasziendistorsionsmodell – Pro und Kontra
(The fascial distortion model - Pro and contra)
Anker, S.
Osteopathische Medizin, 2012/03
3016

Osteopathische Therapie in der Migränebehandlung: eine randomisierte kontrollierte Studie über die Wirksamkeit
(Osteopathic medicine: Osteopathic therapy in the treatment of migraine: A randomized controlled study about the effectiveness)
Burmeister, U., Beck, M., Voigt, K., Liebnitzky, J., Bergmann, A.
Osteopathische Medizin, 2012/03
3017

Kontra: Die Palpationsfähigkeit des Osteopathen wird zu wenig genutzt
(Contra: The palpation skill of osteopaths is insufficiently used)
Liem, T.
Osteopathische Medizin, 2012/03
3018

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03
3019

Chiropractic or Osteopathic Manipulation for Children in the United States: An Analysis of Data from the 2007 National Health Interview Survey
Ndetan, H., Evans, M. W., Hawk, C., Walker, C.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text
3020

Osteopathic medical student learning competency
Bell, H., Donohue, W., Liang, Y. J., Kim, J., Cettin, M.
Family Medicine, 2012/03
3021

Stress reduction with osteopathy assessed with GDV electrophotonic imaging: effects of osteopathy treatment
Korotkov, K., Shelkov, O., Shevtsov, A., Mohov, D., Paoletti, S., Mirosnichenko, D., Labkovskaya, E., Robertson, L.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text
3022

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text
3023

Anterior hip pain – Have you considered femoroacetabular impingement?
Chakraverty, J. K., Snelling, N. J.
International Journal of Osteopathic Medicine, 2012/03
3024

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03
3025

The dorsal sacral rami and branches: Sonographic visualisation of their vascular signature
McGrath, M.C., Jeffery, R., Stringer, M. D.
International Journal of Osteopathic Medicine, 2012/03
3026

A pilot study to compare the views of traditionally trained and CAM-trained therapists using the clinical exemplar of the management of neck/upper limb pain to assess barriers to effective integration of approaches
Denyer, K., Smith, H., Davies, K., Horne, R., Hankins, M., Walker-Bone, K.
Complementary Therapies in Medicine, 2012/02-04
3027

Osteopathic manipulative treatment effectiveness in severe chronic obstructive pulmonary disease: a pilot study
Zanotti, E., Berardinelli, P., Bizzarri, C., Civardi, A., Manstretta, A., Rossetti, S., Fracchia, C.
Complementary Therapies in Medicine, 2012/02-04
Free full text
3028

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the United States Medical Licensing Examination
Hasty, R. T., Snyder, S., Suciu, G. P., Moskow, J. M.
The Journal of the American Osteopathic Association, 2012/02
Free full text
3029

Strain counterstrain: current concepts and clinical evidence
Wong, C. K.
Manual Therapy, 2012/02
3030

Über den Zugang von Osteopathen zu erwachsenen Patienten im neurologischen Bereich in Österreich
(About the access of osteopaths to adult patients in the neurological field in Austria)
Müntner, A.
Unpublished MSc thesis, 2012/02
Free full text
3031

Ankommen in der Gegenwart oder ist die Osteopathie noch zu retten?
(Arriving in the present or can osteopathy still be saved?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3032

A randomized, controlled trial of osteopathic manipulative treatment for acute low back pain in active duty military personnel
Cruser d, A., Maurer, D., Hensel, K., Brown, S., White, K., Stoll, S.
Journal of Manual & Manipulative Therapy, 2012/02
3033

Osteopathische Einflussmöglichkeiten auf die fetale Kopfposition im mütterlichen Becken bei Erstgebärenden
(Osteopathic possibilities to influence the fetal head position in the maternal pelvis in primipara)
Wünsch, A.
Unpublished MSc thesis, 2012/02
Free full text
3034

Oral health awareness for osteopathic medical students--a medical and dental collaborative effort
Rosenheck, A. H., Scott, G. J., Dombrowski, H. T., Cohen, H. V., York, J. A., Kleiman, A., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/02
Free full text
3035

Fasziendistorsionsmodell nach Typaldos im Routinebetrieb eines Ambulatoriums
(Fascial distortion model according to Typaldos in routine operation of an outpatient clinic)
Gallei, L.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3036

Osteopathie und ihre Wirkung auf lumbale, diskogene Radikulopathien bei CT -gezielt periradikulär infiltrierten Patienten
(Osteopathy and its effect on lumbar radicular pain related to patients with CT-guided nerve root infiltrations)
Rachinger, J.
Unpublished MSc thesis, 2012/01
Free full text
3037

Osteopathie und Palpation – ein psychophysikalischer Hintergrund
(Osteopathy and Palpation – A Psychophysical Approach)
Larcher-Schleich, K.
Unpublished MSc thesis, 2012/01
Free full text
3038

Untersuchung des Einflusses der Osteopathie auf das obstruktive Schlafapnoesyndrom
(Examination of the influence of osteopathy on the Obstructive Sleep Apnoea Syndrome)
Dahlke, J.
Unpublished MSc thesis, 2012/01
Free full text
3039

Visceral mobilization can lyse and prevent peritoneal adhesions in a rat model
Bove, G. M., Chapelle, S. L.
Journal of Bodywork and Movement Therapies, 2012/01
3040

Use of therapies other than disease-modifying agents, including complementary and alternative medicine, by patients with multiple sclerosis: a survey study
Stoll, S. S., Nieves, C., Tabby, D. S., Schwartzman, R.
The Journal of the American Osteopathic Association, 2012/01
Free full text
3041

The immediate effect of osteopathic ‘rib raising’ technique on heart rate variability: a randomised sham controlled experiment
White, N.
Unpublished MSc thesis, 2012/01
Free full text
3042

Effect of OMT on Heart Rate in Normotensive and Prehypertensive Individuals
Siu, V. N., Cooper, A., Rezk, M., Terzella, M., Yao, S. C., Gilliar, W.
The Journal of the American Osteopathic Association, 2012/01
3043

Ligamentous Articular Strain Technique – a manual treatment approach for ligamentous articular injuries and the whole body
Libbey, R.
Journal of Prolotherapy, 2012
Free full text
3044

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12
3045

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
3046

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text
3047

Consulting parents about the design of a randomized controlled trial of osteopathy for children with cerebral palsy
Edwards, V., Wyatt, K., Logan, S., Britten, N.
Health Expectations, 2011/12
3048

Subjektive Krankheitstheorien bei Patienten mit lumbalem Rückenschmerz
(Subjective theories of illness of patients with low back pain)
Penger, S.
Unpublished MSc thesis, 2011/12
Free full text
3049

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12
3050

Interview mit Jean-Pierre Barral: „Nur das Gewebe weiß Bescheid“
(Interview with Jean-Pierre Barral: “only the tissue knows“)
Barral, J.P.
Osteopathische Medizin, 2011/12
3051

OMT and exercises for a patient with limited knee range of motion prior to knee replacement: A case report
Clark, R. C.
The AAO Journal, 2011/12
Free full text
3052

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text
3053

Palpation des kraniosakralen Rhythmus
(Palpation of the craniosacral rhythm)
Liem, T.
Osteopathische Medizin, 2011/12
3054

Wirksamkeit einer osteopathischen Behandlung bei Kinetose
(Effectiveness of an osteopathic treatment of motion sickness)
Thiel, O. L.
Osteopathische Medizin, 2011/12
3055

Exploring the impact of osteopathic treatment on cranial asymmetries associated with nonsynostotic plagiocephaly in infants
Lessard, S., Gagnon, I., Trottier, N.
Complementary Therapies in Clinical Practice, 2011/11
Free full text
3056

Einfluss der Osteopathie bei Patienten mit schichtarbeitsbedingten Schlafstörungen
(Influence of osteopathy on patients with shiftwork-caused sleep disorders)
Brübach, S.
Unpublished MSc thesis, 2011/11
Free full text
3057

Atmung und obere Thoraxöffnung
(Breathing and upper thoracic opening)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
3058

Patienteninfo: Obstruktive Bronchitis im Kindesalter
(Patient information: Obstructive bronchitis in childhood)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
3059

Chronischer Schlafmangel aufgrund von Atmungsproblemen
(Chronic sleep deprivation due to respiratory problems)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
3060

Osteopathische Behandlung der Lungenentzündung: schneller gesund, weniger Komplikationen
(Osteopathic treatment of pneumonia: faster recovery, fewer complications)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
3061

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text
3062

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09
3063

The effect of strain counterstrain (SCS) on forearm strength compared to sham positioning
Wong, C. K., Moskovitz, N., Fabillar, R.
International Journal of Osteopathic Medicine, 2011/09
3064

Ultrasonography-guided osteopathic manipulative treatment for a patient with thoracic outlet syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 2011/09
Free full text
3065

Das autonome Nervensystem in der Osteopathie: Überblick über die therapeutischen Optionen
(The autonomic nervous system in osteopathy: Overview of therapeutic options)
Beck, A.K.
Osteopathische Medizin, 2011/09
3066

Zahnmedizinische Begriffe für Osteopathen – eine Einführung
(Dental concepts for osteopaths - An introduction)
Hippel, S.
Osteopathische Medizin, 2011/09
3067

Interview mit Jim Jealous über Mentoren in der Osteopathie
(Interview with Jim Jealous on mentors in osteopathy)
Jealous, J. S.
Osteopathische Medizin, 2011/09
3068

Medición de la emisión biofotónica antes y después de la intervención osteopática en pacientes con lumbalgia mecánica
(Measurement of biophotonic emission before and after osteopathic intervention in patients with mechanical low back pain)
Prieto Murillo, E. F.
Unpublished MSc thesis, 2011/09
Free full text
3069

Dynamics of indicators of quality of life in patients with chronic pain syndrome in the lumbus and lower extremities after osteopathic treatment
Yakovets, G. V., Novoseltsev, S. V.
The AAO Journal, 2011/09
Free full text
3070

Spondylogenic-cranial biomechanic disorders in patients with chronic cerebrovascular insufficiency in the vertebrobasilar basin and their osteopathic correction
Novoseltsev, S. V.
The AAO Journal, 2011/09
3071

Efecto de las técnicas de articulación y manipulación sobre los apoyos plantares en el antepié varo infantil
(Effect of articulation and manipulation techniques on plantar support in varus forefoot in children)
Ángeles Franco, M., Villarroya, A., Marcén, Y., Gómez-Gámez, A.
Osteopatía Científica, 2011/09
3072

Técnica articular para disfunción de malar en eversión
(Articular technique for zygoma in eversion dysfunction)
Antolinos Campillo, P. J., Baño Alcaraz, A., Pascual-Vaca, J. O.
Osteopatía Científica, 2011/09
3073

Osteopathic manual treatment of children with scarlet fever in the nineteenth and twentieth centuries
Liem, T., Ciranna-Raab, C.
The AAO Journal, 2011/09
Free full text
3074

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09
3075

Sprache und Kommunikation in der Osteopathie: Glossare im Internet
(Language and communication in osteopathy: glossaries on the Internet)
Risch, A. J.
Osteopathische Medizin, 2011/09
3076

Revisión sistemática del tratamiento manipulativo para el hombro doloroso
(A systematic review of manipulative therapy for the treatment of shoulder pain)
Pribicevic, M., Pollar, H., Bonell, R., de Luca, K.
Osteopatía Científica, 2011/09
3077

Research and treatment bulletin 1/2011
Blanchard, P.
International Journal of Osteopathic Medicine, 2011/09
3078

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?
Shaw, H. H.
The Journal of the American Osteopathic Association, 2011/08
Free full text
3079

A Possible Contribution of Osteopathic Medicine in the Management of Children Affected by ADD/ADHD
Accorsi, A., Chiara, L., Di Mattia, L., Granchelli, C., Cozzolino, V., Cerritelli, F., Pizzolorusso, G., Barlafante, G.
The Journal of the American Osteopathic Association, 2011/08
3080

What Drew You to Osteopathic Medicine? A Survey of Osteopathic Medical Students From 10 Schools
Draper, B. B., Johnson, J. C., Chamberlain, N.
The Journal of the American Osteopathic Association, 2011/08
3081

Evaluation of Osteopathic Manipulative Medicine Pretreatment for the Prevention of Acute Mountain Sickness
Li, R.C., Hwang, J., Shultz, L., Burns, J. M., Garcia-Russell, N.
The Journal of the American Osteopathic Association, 2011/08
3082

Lymphatic Pump Technique Facilitates the Clearance of Respiratory Infection With Streptococcus pneumonia
Schander, A., Gummelt, K. L., Hodge, L.
The Journal of the American Osteopathic Association, 2011/08
3083

Lymphatic Pump Treatment of Rats With Adjuvant-Induced Arthritis
Shah, P., Zanotti, B., Woods, J. M., Volin, M.
The Journal of the American Osteopathic Association, 2011/08
3084

Lymphofaszialer Release (LFR) – Faszie und Fluida in einem
(Lympho-fascia release (LFR) - fascia and fluids in one)
Chikly, B., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3085

Lymphstau im linken Bein
(Lymphatic congestion in the left leg)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3086

Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes
Langenau, E. E., Sandella, J. M.
The Journal of the American Osteopathic Association, 2011/07
Free full text
3087

Osteopathische Behandlung von Neugeborenen und Kleinkindern
(Osteopathic treatment of newborns and infants)
Nagel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3088

Patienteninfo: Lastenschiffer und Polizei – Lymphe und Lymphsystem
(Patient information: Cargo shippers and police - lymph and lymphatic system)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3089

Den Fluch der somatischen Dysfunktion überwinden
(Overcoming the curse of somatic dysfunction)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3090

The Hawthorne effect: stronger than the placebo effect?
Berthelot, J. M., Le Goff, B., Maugars, Y.
Joint Bone Spine, 2011/07
Free full text
3091

Re: The Fall of the postural-structural-biomechanical model in manual therapy: exemplified by lower back pain. A response to reviewers and further thoughts
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/07
3092

A pilot study of the prevalence of leg pain among women with endometriosis
Missmer, S. A., Bove, G. M.
Journal of Bodywork and Movement Therapies, 2011/07
Free full text
3093

Therapie chronischer Rückenschmerzen: Vergleich der Wirksamkeit von Weichteilosteopathie gegenüber klassischer Krankengymnastik sowie einer Kombination beider Therapiearten mit einem Herzratenvariabilitätstraining
(Therapy of chronic back pain: Comparison of the effectivity of soft part osteopathy with conventional physiotherapy and a combination of both treatments with a heart rate variability training)
Beutinger, D.
Unpublished PhD thesis, 2011/07
Free full text
3094

A review of the breastfeeding literature relevant to osteopathic practice
Cornall, D.
International Journal of Osteopathic Medicine, 2011/06
3095

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06
3096

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06
3097

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06
3098

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text
3099

Effects of comprehensive osteopathic manipulative treatment on balance in elderly patients: a pilot study
Lopez, D., King, H. H., Knebl, J. A., Kosmopoulos, V., Collins, D., Patterson, R. M.
The Journal of the American Osteopathic Association, 2011/06
Free full text
3100

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text
3101

Is it feasible and effective to provide osteopathy and acupuncture for patients with musculoskeletal problems in a GP setting? A service evaluation
Cheshire, A., Polley, M., Peters, D., Ridge, D.
BMC Family Practice, 2011/06
Free full text
3102

Effect of osteopathic manipulative treatment on gastrointestinal function and length of stay of preterm infants: an exploratory study
Pizzolorusso, F., Turi, P., Barlafante, G., Cerritelli, F., Renzetti, C., Cozzolino, V., D'Orazio, M., Fusilli, P., Carinci, F., D'Incecco, C.
Chiropractic & Manual Therapies, 2011/06
Free full text
3103

Osteopathic manipulative treatment in patients with low back pain
Licciardone, J. C.
Clinical Rheumatology, 2011/06
3104

Analysis of AOA/ACGME accredited family medicine residency programs
Terry, R., Hill, F.
Family Medicine, 2011/06
3105

Spinal manipulations for cervicogenic headaches: a systematic review of randomized clinical trials
Posadzki, P., Ernst, E.
Headache: The Journal of Head and Face Pain, 2011/06
3106

Osteopathie bei Kindern und Jugendlichen mit juveniler idiopathischer Arthritis
(Osteopathy for children and adolescents with juvenile idiopathic arthritis)
Strohmayer, A.
Unpublished MSc thesis, 2011/06
Free full text
3107

Die Behandlung des Reizdarmsyndroms mit Osteopathie
(Treatment of irritable bowel syndrome with osteopathy)
Scheuchl, F. G.
Unpublished MSc thesis, 2011/06
Free full text
3108

The effectiveness of osteopathic treatment in women with endometriosis-related pain
Schneider-Milo, U.
Unpublished MSc thesis, 2011/06
Free full text
3109

Einfluss osteopathischer Behandlungen auf den Gesundheitszustand von Schichtarbeiter/innen in der baden-württembergischen Automobilindustrie, die in der Fließfertigung arbeiten
(Evaluation of the hypothesis whether osteopathic treatments have an influence on the general state of health of male and female shift workers working in flow production in the automotive industry of Baden-Wuerttemberg)
Mende-Geyer, E.
Unpublished MSc thesis, 2011/06
Free full text
3110

The iliolumbar ligaments: A literature study
Peeters, L.
The AAO Journal, 2011/06
Free full text
3111

The use of videos in teaching psychomotor skills: A look at a new way of teaching osteopathic manipulative treatment to a remote campus
Ferronato, M., Hruby, R. J.
The AAO Journal, 2011/06
Free full text
3112

Patients’ perceptions of post-treatment experiences in osteopathy: A qualitative study using focus groups
Bright, P., Rajendran, D., Bettles, S., Carnes, D., Mullinger, B.
European Journal of Integrative Medicine, 2011/06
Free full text
3113

Osteopathic approach to a patient with chronic fatigue syndrome
Chong, A., Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text
3114

Wechselseitige Beziehungsdynamiken und subjektive Ansätze in der Osteopathie
(Dynamics of reciprocal correlations and subjective approaches in osteopathy)
Liem, T.
Osteopathische Medizin, 2011/06
3115

Der unmittelbare Einfluss der Osteopathie auf die Atemleistung von Mitgliedern der Feuerwehr
(The immediate effect of osteopathy on fire fighters lung function)
Hellich, W.
Unpublished MSc thesis, 2011/05
Free full text
3116

Kann die Osteopathische Behandlung das Auftreten und die Ausprägung allergischer Reaktionen bei körperlicher Belastung beeinflussen?
(Osteopathy and its effects on frequency and severity of exercise induced anaphylactic symptoms?)
Kremser, S.
Unpublished MSc thesis, 2011/05
Free full text
3117

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text
3118

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?: a pilot study
Newberry, M. A., Bowen, G. S., Trubey, K., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2011/05
Free full text
3119

The effect of lymphatic pump treatment on anti-tumor immune responses
McCauley, L.
Unpublished MSc thesis, 2011/05
3120

Are clinical protocols for osteopathic manipulative procedures truly “osteopathic“?
Kirsch, J. R.
The Journal of the American Osteopathic Association, 2011/05
Free full text
3121

Tug technique de escafoides para escafoides en rotación externa
(The Tug navicular technique for externally rotated navicular bones)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
3122

Efectos de las técnicas de anclaje miofascial y energía muscular en pacientes con bruxismo
(Effects of the myofascial anchorage and muscular energy techniques in patients with bruxism)
Cejo, P. E., Legal, L.
Osteopatía Científica, 2011/05
3123

Técnica de thrust para disfunción posterior unilateral del cóndilo occipital
(Thrust technique for unilateral posterior dysfunction of the occipital condyle)
Pérez Cátedra, P., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
3124

Kieferbeschwerden aus Sicht des Fasziendistorsionsmodells (FDM)
(Jaw complaints from the point of view of the fascial distortion model (FDM))
Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
3125

Psychosomatik des Kiefergelenks
(Psychosomatics of the temporomandibular joint)
Lieberman, J.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
3126

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3127

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3128

Is a postural-structural-biomechanical model, within manual therapies, viable?: A JBMT debate
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04
3129

A rich seam
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04
3130

Invited response: (without science, there must be art)
Hannon, J. C.
Journal of Bodywork and Movement Therapies, 2011/04
3131

Invited response (the postural structural model, with boundary conditions)
Irvin, R. E.
Journal of Bodywork and Movement Therapies, 2011/04
3132

The fall of the postural-structural-biomechanical model in manual and physical therapies: exemplified by lower back pain
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/04
3133

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04
3134

Osteopathic manipulative treatment is effective on pain control associated to spinal cord injury
Arienti, C., Dacco, S., Piccolo, I., Redaelli, T.
Spinal Cord, 2011/04
Free full text
3135

An Osteopathic Approach to Chronic Sinusitis
Lee-Wong, M., Karagic, M., Doshi, A., Gomez, S., Resnick, D.
Journal of Allergy & Therapy, 2011/04
Free full text
3136

Invited response
McGill, S.
Journal of Bodywork and Movement Therapies, 2011/04
3137

Helical tensegrity as a structural mechanism in human anatomy
Scarr, G.
International Journal of Osteopathic Medicine, 2011/03
3138

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03
3139

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
3140

Impact of osteopathic manipulative treatment on secretory immunoglobulin a levels in a stressed population
Saggio, G., Docimo, S., Pilc, J., Norton, J., Gilliar, W.
The Journal of the American Osteopathic Association, 2011/03
Free full text
3141

Osteopathic manipulative treatment in developing countries: a call for education and research
Szkwarko, D.
The Journal of the American Osteopathic Association, 2011/03
Free full text
3142

Somatische Dysfunktion
(Somatic dysfunction)
Adler-Michaelson, P.
Osteopathische Medizin, 2011/03
3143

Osteopathische Behandlung bei Schwindel: eine Pilotstudie
(Osteopathic treatment for vertigo: A pilot study)
Fraix, M.
Osteopathische Medizin, 2011/03
3144

Osteopathie an Kliniken (Interviews)
(Osteopathy in hospitals)
Hogrefe, H.C., Graf, A., Bockius, D.
Osteopathische Medizin, 2011/03
3145

Efficacy of osteopathic manipulative treatment of female patients with migraine: results of a randomized controlled trial
Voigt, K., Liebnitzky, J., Burmeister, U., Sihvonen-Riemenschneider, H., Beck, M., Voigt, R., Bergmann, A.
The Journal of Alternative and Complementary Medicine, 2011/03
Free full text
3146

Osteopathic Manipulative Treatment of Isolated Chronic Sphenoidal Sinusitis in a Post-Sinus Surgery Patient: A Case Report
Shah, R., Berkowitz, M. R.
The AAO Journal, 2011/03
Free full text
3147

From The Archives: From: Fryette, HH. Principles of Osteopathic Technique. Carmel, CA: American Academy of Osteopathy, 1954. 61-64.
Fryette, H.H.
The AAO Journal, 2011/03
Free full text
3148

A preliminary investigation of the effect of the osteopathic lymphatic pump technique on salivary immunoglobulin A levels in asymptomatic subjects: A single systems design pilot study
Ehrlenbach, H.
Unpublished MSc thesis, 2011/03
Free full text
3149

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03
3150

Research and treatment bulletin 2/2011
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2011/03
3151

Internationaler Konsens zur Osteopathie - die Benchmarks der WHO
(International consensus regarding osteopathy - WHO's benchmarks)
Dräger, K.
Osteopathische Medizin, 2011/03
3152

Manual therapy of the mandibular accessory ligaments for the management of temporomandibular joint disorders
Cuccia, A. M., Caradonna, C., Caradonna, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text
3153

Großbänder des hinteren Beckenrings: Sakrotuberal- und Sakrospinalband
(Major ligaments of the posterior pelvic girdle: sacrotuberous and sacrospinal ligaments)
Hammer, N., Bechmann, I., Steinke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
3154

Osteopathische Interventionen bei Erkrankungen der Prostata
(Osteopathic interventions in diseases of the prostate gland)
Marx, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
3155

Chronische Prostatitis: Gemeinsam geht's besser! 
(Chronic prostatitis: Let's work together!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
3156

Management of Dupuytren contracture with ultrasound-guided lidocaine injection and needle aponeurotomy coupled with osteopathic manipulative treatment
Sampson, S., Meng, M., Schulte, A., Trainor, D., Montenegro, R., Aufiero, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text
3157

Low back pain, somatic dysfunction, and segmental bone mineral density T-score variation in the lumbar spine
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J.
The Journal of the American Osteopathic Association, 2011/02
Free full text
3158

Cranial osteopathy for children with cerebral palsy: a randomised controlled trial
Wyatt, K., Edwards, V., Franck, L., Britten, N., Creanor, S., Maddick, A., Logan, S.
Archives of Disease in Childhood, 2011/02
Free full text
3159

Osteopathy for musculoskeletal pain patients: a systematic review of randomized controlled trials
Posadzki, P., Ernst, E.
Clinical Rheumatology, 2011/02
Free full text
3160

Management of suppurative cervical lymphadenitis in a healthy 24-year-old man
Hernandez, M., Chowdhury, R., Woods, J., Cabrera, J., Hardigan, P. C.
The Journal of the American Osteopathic Association, 2011/01
Free full text
3161

Osteopathic manipulative treatment for the treatment of hospitalized premature infants with nipple feeding dysfunction
Lund, G. C., Edwards, G., Medlin, B., Keller, D., Beck, B., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text
3162

Relationship between encounter time and candidate performance on COMLEX-USA Level 2-PE
Sandella, J. M., Roberts, W. L., Langenau, E. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text
3163

Osteopathic manipulation as a complementary treatment for the prevention of cardiac complications: 12-Months follow-up of intima media and blood pressure on a cohort affected by hypertension
Cerritelli, F., Carinci, F., Pizzolorusso, G., Turi, P., Renzetti, C., Pizzolorusso, F., Orlando, F., Cozzolino, V., Barlafante, G.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text
3164

Objective Measure of Effect of Osteopathic Manipulative Treatment on Balance
Gordon, A. N., Graham, V., Hurwitz, E., Fraix, M. P., Seffinger, M.
The Journal of the American Osteopathic Association, 2011/01
3165

Biomechanical assessment of kinematic measures associated with an osteopathic cervical diagnosis and treatment technique
Rutledge, B. A.
Unpublished MSc thesis, 2011/01
Free full text
3166

Osteopathic Manipulative Medicine in the Andes Mountains of Peru
Harding, S. E., Morse, J. S., Berkowitz, M. R., Tidwell, C., Bishop, K., Tidewell, B., Cruz, M. L., Morris-Mitchell, M.
The Journal of the American Osteopathic Association, 2011/01
3167

OMM and TCM: Comparisons of Manipulative Treatment
Zhang, A., Chen, S., Yen, H.R.
The Journal of the American Osteopathic Association, 2011/01
3168

Influencia de la thumb move de C7/T1 combinada con el stretching del ligamento anular del carpo sobre el área de sección transversal del nervio mediano en un caso de STC bilateral
(Influence of the thumb move at C7/T1 combined with stretching of the carpal annular ligament on a cross sectional area of the median nerve in a case of bilateral carpal tunnel syndrome)
Aguirrea, F. B., Boscá Gandíaa, J. J., Brizb, Vicente H., Pascual-Vacaa, J. O.
Osteopatía Científica, 2011/01
3169

Alteraciones en las concentraciones de amonio sérico después de la aplicación de la técnica osteopática sobre el hígado según Ralph-Faylor
(Changes in plasma ammonia levels after aplication of Ralph Failor's liver pumping technique)
Alberto de Sousa, L.
Osteopatía Científica, 2011/01
3170

The identification, assessment and management of somatisation in clients of osteopathic practitioners in New Zealand
You, H. Y.
Unpublished MSc thesis, 2011/01
Free full text
3171

Técnica semidirecta de thrust para una disfunción somática no neutra en ERS izquierda de la tercera vértebra cervical
(Thrust technique for left ERS somatic dysfunction of the third cervical vertebra)
Guerrero, A. M., Rodríguez, R. P.
Osteopatía Científica, 2011/01
3172

Women’s attitudes to and experiences of osteopathic care during pregnancy
Kurth, A.
Unpublished MSc thesis, 2011/01
Free full text
3173

An exploration of the experience of parents in the osteopathic treatment of their infants
Gardner, K.
Unpublished MSc thesis, 2011/01
Free full text
3174

Efectos neuroFisiológicos de la manipulación vertebral
(Neurophysiological effects of spinal manipulation)
Pickar, J. G.
Osteopatía Científica, 2011/01
3175

The effect of home-exercise with and without additional osteopathic treatment for those with shoulder impingement syndrome
Darragh, T.
Unpublished MSc thesis, 2011/01
Free full text
3176

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011
3177

Osteopathic Treatment for Irritable Bowel Syndrome. A Systematic Review.
Müller, A.
Unpublished MSc thesis, 2011
Free full text
3178

Veränderung der Wurfgenauigkeit und Wurfgeschwindigkeit bei Handballspielerinnen nach osteopathischer Intervention
(Changes in the Throwing Accuracy and Throwing Velocity of Competitive Female Handball Players after Osteopathic Intervention)
Bitter, H.
Unpublished MSc thesis, 2010/12
Free full text
3179

The accuracy of diagnostic palpation: the comparison of soft tissue findings with random blood sugar in diabetic patients
Nelson, K. E., Mnabhi, A. K. S., Glonek, T.
Osteopathic Family Physician, 2010/12
3180

An Osteopathic Approach to Hypothyroidism
Burns, D. K.
The AAO Journal, 2010/12
Free full text
3181

Restoration of a McManis Treatment Stool
Clark, R. C.
The AAO Journal, 2010/12
Free full text
3182

Atypical Pathologic Somatic Dysfunctions: Techniques Revisited
Miller, D. S.
The AAO Journal, 2010/12
Free full text
3183

Langjährige Schilddrüsenunterfunktion und muskuläre Beschwerden: Ist Osteopathie für die betroffenen Frauen von Nutzen?
(Long-term hypothyroidism and muscle diseases: Is osteopathy of use to the afflicted women?)
Sonberg, M., Mullinger, B., Rajendran, D.
Osteopathische Medizin, 2010/12
3184

Progression through osteopathic training in Australia: The student experience
Hartup, J. K., Murphy, R. A., Plowman, L. M., Myers, R.
International Journal of Osteopathic Medicine, 2010/12
3185

Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways
Watson, L. A., Pizzari, T.
International Journal of Osteopathic Medicine, 2010/12
3186

Osteopathie und ihre Wirkung auf die „Spastizität“ bei posttraumatischer Rückenmarksläsion
(Osteopathy and its effect on “spasticity“ related to post-traumatic spinal cord lesions)
Riedl, B.
Unpublished MSc thesis, 2010/12
Free full text
3187

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 2: Treatment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
3188

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 1: Assessment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
3189

Kann mit Osteopathie der Stimmumfang von Sängerinnen der Stimmlage Sopran vergrößert werden?
(Can osteopathy expand the vocal compass of female singers with the voice type soprano?)
Amlinger, E.
Unpublished MSc thesis, 2010/11
Free full text
3190

Efficacy of a standardized osteopathic manipulative therapy protocol on pulmonary function and symptomatology in moderate persistent asthmatic children
Brady, N. S.
Annals of Allergy, Asthma and Immunology, 2010/11
3191

Medical business education in colleges of osteopathic medicine
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2010/11
Free full text
3192

American Osteopathic Association guidelines for osteopathic manipulative treatment (OMT) for patients with low back pain
Seffinger, M. A., Buser, B. R., Licciardone, J. C., Lipton, J. A., Lynch, J. K., Patterson, M. M., Snow, R., Troutman, M. E.
The Journal of the American Osteopathic Association, 2010/11
Free full text
3193

How the AOA established the first national guidelines for OMT
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2010/11
Free full text
3194

Anatomische Gesichtspunkte zur harten Hirnhaut
(Anatomical viewpoints on the hard meninges)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
3195

Response to “Relationship between COMLEX and USMLE scores among osteopathic medical students who take both examinations“
Gimpel, J. R.
Teaching and Learning in Medicine, 2010/10
3196

Die ligamentären Verbindungen der Harnblase in lateraler Ausrichtung. Anatomische Grundlagenstudie.
(The relationship of the urinary bladder and its lateral ligamentous attachments. A basic anatomical study)
Bültmann, A., Webb, R.
Unpublished D.O. thesis, 2010/10
3197

Hat die osteopathische Behandlung Einfluss auf Immunparameter bei Patienten mit chronischen Rückenschmerzen? Prä-Post Pilotstudie
(Does osteopathic treatment influence immune parameters in patients with chronic low back pain? A pre-post pilot trial)
Conrady, A., Döring, R.
Unpublished D.O. thesis, 2010/10
3198

Osteopathische Behandlung von Frauen mit Harninkontinenz. Eine kontrollierte klinische Studie.
(Osteopathic treatment in women suffering from urinary incontinence. A controlled clinical trial)
Grönwald, C., Pantel, M.
Unpublished D.O. thesis, 2010/10
3199

Können osteopathische Behandlungen einen Beitrag zur Verbesserung von Miktionsbeschwerden (LUTS) bei Patienten mit benignem Prostatasyndrom (BPS) leisten? Randomisierte kontrollierte Studie.
(Do osteopathic treatments influence the lower urinary tract symptoms (LUTS) in patients with benign prostatic syndrome (BPS)? A randomized controlled trial)
Kramer, S., Schüle, G., Welzel, M.
Unpublished D.O. thesis, 2010/10
3200

Wirkt die osteopathische Behandlung bei Patienten mit Psoriasis vulgaris? Randomisierte kontrollierte Studie
(Does osteopathic treatment affect the symptoms of psoriasis vulgaris? A randomized controlled trial)
Martin, J.
Unpublished D.O. thesis, 2010/10
3201

Hat osteopathische Behandlung einen Effekt auf Schlafstörungen bei Kindern zwischen drei und zehn Jahren? Prä-Post-Pilostudie.
(Does osteopathic treatment influence sleep disturbances in children between three and ten years? Pre-post pilot trial)
Schulmeyer, A.
Unpublished D.O. thesis, 2010/10
3202

Systematische Übersichtsarbeit über Definition, Nomenklatur und Klassifikation der Säuglingsasymmetrie bzw. Schiefhals bei Säuglingen.
(A Systematic Review on the Definition, Nomenclature and Classification on Infantile Asymmetry, respectively, Torticolllis in Infants)
Wagner, C.
Unpublished D.O. thesis, 2010/10
3203

Realigning the JAOA to sharpen our focus
Capobianco, P. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3204

Effects of rib raising on the autonomic nervous system: a pilot study using noninvasive biomarkers
Magoun Jr., H. I.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3205

OMT relieves low back pain during pregnancy
Kleman, P. G.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3206

Development, implementation, and outcomes of an initiative to integrate evidence-based medicine into an osteopathic curriculum
Laird, S., George, J., Sanford, S. M., Coon, S.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3207

Plagiozephalie bei frühgeborenem Mädchen
(Plagiocephaly in premature baby girl)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
3208

Komplementäre Behandlung der idiopathischen Säuglingsasymmetrie
(Complementary treatment of idiopathic infant asymmetry)
Peschke, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
3209

Test-dependent osteopathic treatment of patients with tinnitus and craniomandibular dysfunctions (CMD): A pre-post pilot trial
Salomon, J., Kronau, S., Moshövel, N., Niggemeier, H., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09/
3210

Osteopathische Erfahrungswerte mit idiopathischen Skoliosen
(Experiences regarding osteopathic treatment of idiopathic scoliosis)
Loibner-Gruendler, B.
Unpublished MSc thesis, 2010/09
Free full text
3211

Osteopathic manipulative treatment in a patient with idiopathic dysautonomia: a case presentation
Cromeens, B., Gamber, R.
Osteopathic Family Physician, 2010/09
3212

Placebo: Missverständnisse und Vorurteile
(Placebo: Misconceptions and prejudices)
Breidert, M., Hofbauer, K.
Osteopathische Medizin, 2010/09
3213

Alexander-Technik – Grundlagen und Parallelen zur Osteopathie
(The Alexander Technique Principles and parallels to osteopathy)
Eisenreich, U.
Osteopathische Medizin, 2010/09
3214

Baby-Shiatsu – eine energetische Ergänzung zur osteopathischen Behandlung
(Baby Shiatsu: An energetic supplement to osteopathic treatment)
Kalbantner-Wernicke, K., Wernicke, T.
Osteopathische Medizin, 2010/09
3215

Dig on: A Case Study
Kolkhorst, A. B., Kary, D. J.
The AAO Journal, 2010/09
Free full text
3216

Attitudes and Confidence Levels of Fourth Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T., Best, M., Fotopoulos, T. J., Ball, L. D., Ruston, V. J.
The AAO Journal, 2010/09
Free full text
3217

Wie viel Placebo steckt in der Osteopathie?
(How much placebo remains in osteopathy?)
Resch, K.L.
Osteopathische Medizin, 2010/09
3218

(No Placebo!)
Wührl, P.
Osteopathische Medizin, 2010/09
3219

The innervation of iliolumbar ligament
Bahal, G.
International Journal of Osteopathic Medicine, 2010/09
3220

Adverse events in manual therapy: A systematic review
Carnes, D., Mars, T. S., Mullinger, B., Underwood, M.
International Journal of Osteopathic Medicine, 2010/09
3221

Effect of osteopathic treatment on the gastrointestinal system function of autistic children
Castellarin, I. B., Hucklebridge, F., Patel, V. B., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2010/09
3222

Osteopathic treatment of patients with lower urinary tract symptoms and benign prostatic hyperplasia: A pre-post pilot trial
Conrad, U., Scheuer, K., Hebgen, E., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09
3223

Somatic dysfunctions in newborns: prevalence and interoperator correlation
Cozzolino, V., Boccuzzi, M., Evangelista, S., Germinario, G., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09
3224

Impact of OMT on reducing length of stay in a population of pre-term infants
Cozzolino, V., La Mola, E., Ciardelli, F., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09
3225

Investigating the role of vision and touch in the diagnosis of somatic dysfunction
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2010/09
3226

The use of spinal and sacroiliac joint assessment and treatment procedures within the British osteopathic profession
Fryer, G., Johnson, J. C.
International Journal of Osteopathic Medicine, 2010/09
3227

Osteopathic manipulative treatment for chronic neck pain: A randomized placebo controlled trial on the effect on pain and disability
Mandara, A., Ceriani, A., Guzzetti, G., Gulisano, V., Fusaro, A., Bado, F.
International Journal of Osteopathic Medicine, 2010/09
3228

Osteopathy as a therapy during pregnancy: A randomised controlled trial
Nistler, G., Deutschmann, U., Lenz, D., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09
3229

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Mosca, G., Orfei, S.
International Journal of Osteopathic Medicine, 2010/09
3230

Lymphatic pump treatment reduces pulmonary tumors in the rat
Pedrueza, M., Zhang, X., Jones, H. P., Hodge, L. M.
International Journal of Osteopathic Medicine, 2010/09
3231

Osteopathic treatment of women with primary dysmenorrhoea: A randomised controlled trial
Pinter-Haas, A., Schach-Hirte, A., Wirthwein, P., Metcalfe, D., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09
3232

Osteopathic treatment of women with voiding dysfunction: A randomized controlled trial
Ringkamp, C., Rodriquez, B., Alberts, K., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09
3233

Lymphatic Pump Manipulation Mobilizes Inflammatory Mediators into Thoracic and Intestinal Duct Lymph
Schander, A., Downey, H. F., Hodge, L. M.
International Journal of Osteopathic Medicine, 2010/09
3234

Osteopathic treatment of patients with shoulder pain: A randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2010/09
3235

Adverse events and treatment reactions in osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2010/09
3236

Osteopathic management of an adult patient suffering from trigeminal neuralgia after a post-operative Arnold Chiari type 1 decompression: Case report
Zegarra-Parodi, R., Allamand, P.
International Journal of Osteopathic Medicine, 2010/09
3237

Manuelle Behandlung des Kniegelenks - veraltetes Verfahren oder alternative Option?
(Manual treatment of the knee joint – an outdated procedure or an alternative option?)
Franke, H.
Naturheilpraxis, 2010/09
Free full text
3238

Técnica de lift-off para dorsales medias (T4-T10)
(Lift off technique in medium dorsal vertebrae (T4-T10))
Iglesias, J. G., del Cerro, L. P., Rodríguez Blanco, C.
Osteopatía Científica, 2010/09
3239

Efectos de la desactivación de los puntos-gatillo de los músculos de la pantorrilla en las fascitis plantares
(The effects of calf muscle trigger-points disactivation in plantar fasciitis)
Renan Ordine, R., Alburquerque Sendín, F.
Osteopatía Científica, 2010/09
3240

A ‘system based’ approach to risk assessment of the cervical spine prior to manual therapy
Taylor, Alan J., Kerry, R.
International Journal of Osteopathic Medicine, 2010/09
3241

Admission characteristics and academic performance of podiatric and osteopathic medical students at Des Moines University
Yoho, R. M., Vardaxis, V., Comstock, K.
Journal of the American Podiatric Medical Association, 2010/08-07
Free full text
3242

The Use of Osteopathic Manipulative Treatment in the Enhancement of Pulmonary Function in an Impoverished Urban Sector of Duran, Ecuador
Barnes, P. L., Dilzer, E. J., McAuley, D. A., Kuchera, M. L., Venditto, M. A.
The Journal of the American Osteopathic Association, 2010/08
3243

Establishment of DO-Touch.NET, an OMM Practice-Based Research Network
Degenhardt, B. F., Johnson, J. C., Hagan, C., Halma, K. D.
The Journal of the American Osteopathic Association, 2010/08
3244

Characterizing Osteopathic Manipulative Techniques Used in Treating Pneumonia During the MOPSE Study
Degenhardt, B. F., Johnson, J. C., Yang, Q., Pamperin, K. L., Noll, D. R.
The Journal of the American Osteopathic Association, 2010/08
3245

Lymphatic Pump Treatment Increases Leukocyte Trafficking and Inhibits Tumor Formation in the Lungs of Rats
Hodge, L., Harden, L., Pedrueza, M., Zhang, X., Jones, H., Minotti, D. E.
The Journal of the American Osteopathic Association, 2010/08
3246

The Effects of Cranial Osteopathy on Neuronal Damage After Juvenile Seizures
LaTorre, G. N., Copel, E., Hallas, B. H.
The Journal of the American Osteopathic Association, 2010/08
3247

The Link Between Osteopathic Intervention, Endocannabiniods, and Developmental Epilepsy
LaTorre, G. N., Lipoff, D., Rudenko, V., Dileo, J., Ramos, R. L., Hallas, B. H.
The Journal of the American Osteopathic Association, 2010/08
3248

A Study of 80 Healthy Subjects: Can OMM Effects and Outcomes Be Measured Objectively Using Pulmonary Function Tests?
Morine, E., Yao, S. C., Liu, T., Werley, J., Sheikh, M. W., Gilliar, W.
The Journal of the American Osteopathic Association, 2010/08
3249

The Effect of OMT on Blood Pressure in Nonhypertensive Subjects
Rezk, M., Siu, V. N., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2010/08
3250

Standardized Patients and Osteopathic Manipulative Treatment During COMLEX-USA Level 2-PE
Sandella, J. M., Pugliano, G.
The Journal of the American Osteopathic Association, 2010/08
3251

The Effects of Repeated Lymphatic Pump Treatment on Thoracic Duct Lymph Flux and Its Clinical Application
Schander, A., Downey, H. F., Hodge, L.
The Journal of the American Osteopathic Association, 2010/08
3252

Der Gesichtsschädel
(Patient information: The viscerocranium)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3253

Osteopathic manipulative treatment and vertigo: a pilot study
Fraix, M.
PM&R: The Journal of Injury, Function and Rehabilitation, 2010/07
3254

Nasen- und Darmschleimhaut in der osteopathischen Behandlung
(Nasal and intestinal mucosa in osteopathic treatment)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3255

Der osteopathisch ganzheitliche Ansatz zur Homöostase (Teil 2)
(The osteopathic holistic approach to homeostasis, part 2)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3256

Encouraging OFP editorial staff to present information and articles on the use of Osteopathic manipulative care
Urse, G. N.
Osteopathic Family Physician, 2010/07
3257

Characteristics of pediatric patients seen in medical school-based osteopathic manipulative medicine clinics
Lund, G., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/07
Free full text
3258

Osteopathische Techniken bei Nasennebenhöhlenentzündung
(Osteopathic techniques in sinusitis)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3259

CRPS und Osteopathie – Möglichkeiten und Grenzen
(CRPS and osteopathy - possibilities and limits)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3260

Idiopathische Trigeminusneuralgie
(Idiopathic trigeminal neuralgia)
Liem, T., Kühn, D.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3261

No effect of osteopathic treatment on trunk morphology and spine flexibility in young women with adolescent idiopathic scoliosis
Hasler, C., Schmid, C., Enggist, A., Neuhaus, C., Erb, T.
Journal of Children's Orthopaedics, 2010/06
Free full text
3262

The application of osteopathic treatments to pediatric sports injuries
Bolin, D. J.
Pediatric Clinics of North America, 2010/06
Free full text
3263

Continuing Professional Development Activity
Moran, R.
International Journal of Osteopathic Medicine, 2010/06
3264

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text
3265

Low Back Pain in Rowers
Fleming, R. K., Snider, K. T.
The AAO Journal, 2010/06
Free full text
3266

Osteopathic Diagnosis and Treatment of Dorsalgia Caused by Disturbance of Proprioception in the Cervical Spine
Lepin, A. L., Mokhov, D. E., Novoseltsev, S. V.
The AAO Journal, 2010/06
Free full text
3267

Body Adjustment in der Frauenheilkunde
(Body adjustment in gynecology)
Masters, P.
Osteopathische Medizin, 2010/06
3268

Median Arcuate Ligament Syndrome – Literature Study and Osteopathic Considerations
Peeters, L.
The AAO Journal, 2010/06
Free full text
3269

Somatic Dysfunction Following Sigmoid Colon Resection for Diverticulitis: A Case Report
Ridgeway, V., Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text
3270

Interview mit Angela Schleupen und Karl Heinz Riedl zur Osteopathie in der Frauenheilkunde
(An interview with Angela Schleupen and Karl Heinz Riedl on osteopathy in gynecology)
Schleupen, A., Riedl, K. H.
Osteopathische Medizin, 2010/06
3271

Methoden der osteopathischen Diagnostik und der Reflexdiagnostik bei Zervikalgiepatienten
(Methods of osteopathic diagnostics and reflex diagnostics in patients with cervicalgia)
Usupbékova, B. C., Mokhov, D. E., Vasilenko, A. M., Paoletti, S.
Osteopathische Medizin, 2010/06
3272

Teaching osteopathic students technique; using research to identify good teaching practice
Browning, S.
International Journal of Osteopathic Medicine, 2010/06
3273

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06
3274

Diagnostyka fizjoterapeutyczna i osteopatyczna w zawodowych zaburzeniach glosu.
(The application of physiotherapeutic and ostheopatic diagnostics in occupational voice disorders)
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Kowalska, M. S.
Medycyna Pracy, 2010/06
3275

The Influence of Rib Raising on the Lung Function of Chronic Obstructive Pulmonary Disease Patients
Friedrich, S.
Unpublished MSc thesis, 2010/06
Free full text
3276

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05
3277

L'osteopathie pour soulager certaines douleurs.
(Osteopathy for relieving certain pain)
Gnaho, S.
Revue de l'infirmiere, 2010/05
3278

Commentary on the globalization of osteopathic medicine
Qureshi, Y., Kusienski, A. M.
Osteopathic Family Physician, 2010/05
3279

Estudio comparativo sobre la eficacia de las técnicas de thrust y energía muscular en el músculo piriforme
(Comparative study on the efficacy of thrust and muscle energy techniques in the piriformis muscle)
Hunt, G. M., Legal, L.
Osteopatía Científica, 2010/05
3280

Fe de errores de “El efecto en el umbral del dolor en un miotoma tras la manipulación vertebral del nivel correspondiente, ¿es infl uenciable por las expectativas del sujeto?”
(Erratum to “The effect on the pain threshold in a myotome after a spinal manipulation… is it influenced by the subject's expectations?“)
Manso, M. G., Rodríguez Díaz, J.
Osteopatía Científica, 2010/05
3281

Repercusión de la maniobra lift de vejiga sobre el punto gatillo miofascial del músculo tibial anterior y de la apófisis espinosa de lumbar 5
(Repercussions of the urinary bladder lift manipulation on the myofascial trigger point of the tibialis anterior muscle and fifth lumbar spinous process)
Marchuk, C., Legal, L.
Osteopatía Científica, 2010/05
3282

Osteopathic diagnosis of an acetabular injury
Morthland, T., Cote, N. S., Humphrey, J., Fulk, D.
The Journal of the American Osteopathic Association, 2010/05
Free full text
3283

Modificaciones radiológicas del espacio entre el occipucio y el cuerpo del atlas tras una manipulación global (OAA) de Fryette
(Radiological changes in the atlanto-occipital space after Fryette global manipulation (OAA))
Otaño, L., Legal, L.
Osteopatía Científica, 2010/05
3284

Brief report of a clinical trial on the duration of middle ear effusion in young children using a standardized osteopathic manipulative medicine protocol
Steele, K. M., Viola, J., Burns, E., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text
3285

Osteopathische Behandlung von homonymen Gesichtsfeldausfällen bei Erwachsenen mit erworbener Hirnschädigung im Zuge des stationären Rehabilitationsaufenthaltes
(Osteopathy relating to homonymous hemianoptic failures with adults with acquired brain damage in the course of the stationary rehabilitation phase)
Fäßlacher, W.
Unpublished MSc thesis, 2010/05
Free full text
3286

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text
3287

Osteopathic manual therapy versus conventional conservative therapy in the treatment of temporomandibular disorders: a randomized controlled trial
Cuccia, A. M., Caradonna, C., Annunziata, V., Caradonna, D.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text
3288

Formbarkeit von Faszien und Membranen: Behandlung innerer Brücken im Kontext der Forschung
(Plasticity of Fascias and Membranes: Treatment of Inner Bridges in the Context of Research)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3289

Störungsketten im Bindegewebe
(Patient information: Disruptive chains in the fascia)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3290

Diagnose und Behandlung von Zahnschmerzen nach dem Fasziendistorsionsmodell (FDM)
(Diagnosis and treatment of dental pain according to the Fascial Distortion Model (FDM))
Stein, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3291

Ursprung, Raum und Wirklichkeit faszialer Motilität
(Origin, Space and Reality of Fascial Motility)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3292

Was ist eigentlich... intrinsische Bewegung?
(What actually is intrinsic movement?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3293

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3294

Diagnosis and management of primary pulmonary leiomyosarcoma
Arnold III., L. M., Burman, S. D., H., O-Yurvati A.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3295

Effect of pedal pump and thoracic pump techniques on intracranial pressure in patients with traumatic brain injuries
Cramer, D., Miulli, D. E., Valcore, J. C., Taveau, J. W., Do, N., Hutton, D. S., Sonti, G., Wogu, E., Boorman, C. F., Panchal, R. R.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3296

Effect of osteopathy in the cranial field on visual function--a pilot study
Sandhouse, M. E., Shechtman, D., Sorkin, R., Drowos, J. L., Caban-Martinez III., A. J., Patterson, M. M., Shallo-Hoffmann, J., Hardigan, P., Snyder, A.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3297

Musculoskeletal dysfunction and drop foot: diagnosis and management using OMM
Sucher, B. M.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3298

Mikro- und makroskopische Betrachtung der Faszienfunktionen
(Microscopic and Macroscopic Reflections on the Functions of Fascias)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3299

Assessment of ADHD documentation from candidates requesting Americans With Disabilities Act (ADA) accommodations for the National Board of Osteopathic Medical Examiners COMLEX exam
Joy, J. A., Julius, R. J., Akter, R., Baron, D. A.
Journal of Attention Disorders, 2010/04
3300

An introduction to clinical research in osteopathic medicine
Earley, B. E., Luce, H.
Primary Care: Clinics in Office Practice, 2010/03
Free full text
3301

Continuing Professional Development Activity
Moran, R.
International Journal of Osteopathic Medicine, 2010/03
3302

Kommentar der Deutsch-Amerikanischen Akademie für Osteopathie e.V. (DAAO)
(Comment of the German-American Academy of Osteopathy (DAAO))
Adler-Michaelson, P.
Osteopathische Medizin, 2010/03
3303

Forum zum Artikel: “Wissenschaftliche Bewertung osteopathischer Verfahren”
(Forum on the article: “Scientific assessment of osteopathic procedures“. Comment of the German Society of Chiropractic and Osteopathy (DGCO))
Daichendt, D.
Osteopathische Medizin, 2010/03
3304

Holistic Osteopathic Approach Reveals Unusual Etiology for Vertigo with Co-morbid Headache: A Case Report
Berkowitz, M. R.
The AAO Journal, 2010/03
Free full text
3305

Case Study: Exhalation Somatic Dysfunction after Multiple Rib Fractures and Pneumothorax
Calman, J.
The AAO Journal, 2010/03
Free full text
3306

The Effect of Early Clinical Exposure on Future OMT Use
Dalprat, J., Thompson, C., Hruby, R.
The AAO Journal, 2010/03
Free full text
3307

Kommentar des Verbands der Osteopathen Deutschland e.V. (VOD)
(Comment of the German Osteopathic Association (VOD))
Fuhrmann, M.
Osteopathische Medizin, 2010/03
3308

Kommentar des Deutschen Registers Osteopathische Medizin (DROM)
(Comment of the German Register of Osteopathic Medicine (DROM))
Hartwig, B.
Osteopathische Medizin, 2010/03
3309

Kommentar der Deutschen Gesellschaft für Osteopathische Medizin e.V. (DGOM)
(Comment of the German Society of Osteopathic Medicine (DGOM))
Hogrefe, C.
Osteopathische Medizin, 2010/03
3310

Leserbrief zum Artikel „Osteopathische Behandlung entwicklungsbedingter Hüftdysplasie bei Säuglingen während des ersten Lebensjahres”
(Letter to the editor in regards to the article: 'Osteopathic treatment of developmental hip dysplasia in infants during the first year of life')
Lasovetskaya, L., Karpova, T.
Osteopathische Medizin, 2010/03
3311

Osteopathic Manipulative Treatment In the Emergency Department: A Two-Dimensional Curriculum
Mesisca, M., Hoffman, K., Fenati, G., Hruby, R. J.
The AAO Journal, 2010/03
Free full text
3312

(Comment on the letter to the editor)
Mayer, J.
Osteopathische Medizin, 2010/03
3313

Biomechanical Disorders in the Patients with Lumbar Discal Hernias and Their Osteopathic Correction
Novoseltsev, S. V., Vcherashny, D. B.
The AAO Journal, 2010/03
Free full text
3314

Kommentar des Verbands Osteopathie Schule Deutschland (VOSD)
(Comment of the Association of the Osteopathic School in Germany (VOSD))
Nagel, M.
Osteopathische Medizin, 2010/03
3315

Kommentar des Register der Traditionellen Osteopathen in Deutschland GmbH (ROD)
(Comment of the Registry of Traditional Osteopathy in Germany (ROD))
Prediger, G.
Osteopathische Medizin, 2010/03
3316

Kommentar der Akademie für Osteopathie AFO
(Comment of the Academy of Osteopathy (AFO))
Schwerla-Goeggel, B. S.
Osteopathische Medizin, 2010/03
3317

Leserbrief zum Artikel „Osteopathische Behandlung entwicklungsbedingter Hüftdysplasie bei Säuglingen während des ersten Lebensjahres”
(Letter to the editor about the article: “Osteopathic treatment of development-conditioned hip dysplasia in infants during the first year of life“)
Spittank, H.
Osteopathische Medizin, 2010/03
3318

Wissenschaftliche Bewertung osteopathischer Verfahren: Der Vorstand der Bundesärztekammer hat in seiner Sitzung vom 28. August 2009 folgende Ausarbeitung des Wissenschaftlichen Beirats zustimmend zur Kenntnis genommen
(Scientific assessment of osteopathic procedures)
Osteopathische Medizin, 2010/03
3319

Osteopathic neuromuscular re-abilitation
Lederman, E.
International Journal of Osteopathic Medicine, 2010/03
3320

Composite sacroiliac joint pain provocation tests: A question of clinical significance
McGrath, M. C.
International Journal of Osteopathic Medicine, 2010/03
3321

Can osteopathy help women with a history of hypothyroidism and musculoskeletal complaints? Outcome of a preliminary, prospective, open investigation
Sonberg, M., Mullinger, B., Rajendran, D.
International Journal of Osteopathic Medicine, 2010/03
3322

The effect of Osteopathic Treatment on Chronic Constipation – A Pilot Study
Brugman, R., Fitzgerald, K., Fryer, G.
International Journal of Osteopathic Medicine, 2010/03
3323

Efficacy of osteopathic manipulation as an adjunctive treatment for hospitalized patients with pneumonia: a randomized controlled trial
Noll, D. R., Degenhardt, B. F., Morley, T. F., Blais, F. X., Hortos, K. A., Hensel, K., Johnson, J. C., Pasta, D. J., Stoll, S. T.
Osteopathic Medicine and Primary Care, 2010/03
Free full text
3324

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text
3325

Use of osteopathic manipulative treatment to manage compensated trendelenburg gait caused by sacroiliac somatic dysfunction
Gilliss, A. C., Swanson II., R. L., Janora, D., Venkataraman, V.
The Journal of the American Osteopathic Association, 2010/02
Free full text
3326

Performing arts medicine--instrumentalist musicians, Part II--examination
Dommerholt, J.
Journal of Bodywork and Movement Therapies, 2010/01
3327

The relationship between a statewide preceptorship program and family medicine residency selection
Kubal, V. S., Zweifler, J., Hughes, S., Reilly, J. M., Newman, S.
Journal of the American Board of Family Medicine, 2010/01
Free full text
3328

Akute Irritation des Nervus cutaneus femoris lateralis
(Acute irritation of the lateral cutaneous femoral nerve)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
3329

Relationship between COMLEX and USMLE scores among osteopathic medical students who take both examinations
Chick, D. A., Friedman, H. P., Young, V. B., Solomon, D.
Teaching and Learning in Medicine, 2010/01
3330

Using standardized patients to assess the communication skills of graduating physicians for the comprehensive osteopathic medical licensing examination (COMLEX) level 2-performance evaluation (level 2-PE)
Weidner, A. C., Gimpel, J. R., Boulet, J. R., Solomon, M.
Teaching and Learning in Medicine, 2010/01
3331

Osteopathic manipulative treatment of back pain and related symptoms during pregnancy: a randomized controlled trial
Licciardone, J. C., Buchanan, S., Hensel, K. L., King, H. H., Fulda, K. G., Stoll, S. T.
American Journal of Obstetrics & Gynecology, 2010/01
Free full text
3332

Dolor y estrategias terapéuticas en osteopatía (IV)
(Pain and therapeutics approaches in osteopathy (IV))
Hernández Xumet, J. E.
Osteopatía Científica, 2010/01
3333

El efecto en el umbral del dolor de un miotoma tras la manipulación vertebral del nivel correspondiente, ¿es influenciable por las expectativas del sujeto?
(The effect on the pain threshold in a myotome after a spinal manipulation… is it influenced by the subject's expectations?)
Manso, M. G., Rodríguez Díaz, J.
Osteopatía Científica, 2010/01
3334

Influencia de la técnica de bombeo del globo ocular en la presión intraocular en sujetos hipertensos sometidos a medicación
(Influence of the eye pumping technique on intraocular pressure in hypertensive subjects under medication)
Sánchez Jorge, S., Palomeque del Cerro, L.
Osteopatía Científica, 2010/01
3335

Modificaciones inmediatas en la dinámica uterina tras la realización de la técnica de equilibración de la sincondrosis esfenobasilar según Upledger
(Immediate changes in the uterine dynamics after application of the balancing technique in the sphenobasilar synchondrosis according Upledger)
Vecino Rodríguez, A., Martínez Loza, E.
Osteopatía Científica, 2010/01
3336

Using Osteopathic Manipulations to Decrease the Incidence of Acute Mountain Sickness
Abo, B. N., Garcia-Russell, N., Hiserote, R. M., Wong, T., Hakopian, D. K., Burns, J. M., Ekholm, R. K.
The Journal of the American Osteopathic Association, 2010/01
3337

The Relationship Between Osteopathic Family Physicians’ Use of Manipulative Therapy and Their Perceived Empathy for Patients
Brown, J. L., Mann, D.
The Journal of the American Osteopathic Association, 2010/01
3338

The Efficacy of OMT by Osteopathic Medical Students on Musculoskeletal Pain and Somatic Findings
Hallas, S. J., Seffinger, M., Hurwitz, E.
The Journal of the American Osteopathic Association, 2010/01
3339

Osteopathic Manipulative Treatments in the Emergency Department: Osteopathic Emergency Physicians’ Perspectives
Holbrook, N. B., Fryer, G., Johnson, J. C., Holbrook, C.
The Journal of the American Osteopathic Association, 2010/01
3340

Diseño de un modelo de atención en osteopatía desde el componente de la prestación de servicios, orientado hacia el manejo de pacientes con lumbalgia de tipo mecánico, para instituciones prestadoras de servicios de salud de mediana complejidad en Colombia
(Design of an osteopathic care model from the service delivery component, oriented towards the management of patients with mechanical low back pain, for medium complexity health care institutions in Colombia)
Mejía Arango, A.
Unpublished MSc thesis, 2010/01
Free full text
3341

Anterior Cruciate Ligament Function in Osteopathic Medical Education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2010/01
3342

Das Fasziendistorsionsmodell nach Stephen Typaldos
(The Fascial Distortion Model According to Stephen Typaldos)
Fischer, T., Rossmy, C., Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
3343

Effect of a novel osteopathic technique on the axial length of the eye
Huang, J. H.I.
Unpublished MSc thesis, 2010/01
Free full text
3344

Osteopathische Betrachtung der Narbenbehandlung
(Osteopathic Reflection on the Treatment of Scars)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
3345

Contribution of the osteopathy on the flexibility of the lumbar column and intensity of pain in young adult patients with acute low back pain
Rocha, R., Pereira, J. S.
Revista Terapia Manual, 2010
3346

Osteopathic Treatment of Patients with Chronic Non-Specific Neck Pain: Development of a Study Protocol
Schwerla, F.
Unpublished MSc thesis, 2010
Free full text
3347

Osteopathic Treatment of Female Incontinence
Hösele, K.
Unpublished MSc thesis, 2010
Free full text
3348

Effectiveness of the osteopathic treatment of women with uterine fibroids: Development of a study protocol of a randomized controlled trial
Salomon, J.
Unpublished MSc thesis, 2010
Free full text
3349

Development of a Study Protocol on the Osteopathic Treatment of Late Whiplash Syndrome
Kaiser, A.K.
Unpublished MSc thesis, 2010
Free full text
3350

Continuing Professional Development Activity
Moran, R.
International Journal of Osteopathic Medicine, 2009/12
3351

Musculoskeletal dysfunction and drop foot: diagnosis and management using osteopathic manipulative medicine
Lavelle, J. M., McKeigue, M. E.
The Journal of the American Osteopathic Association, 2009/12
Free full text
3352

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12
3353

Preliminary investigation of a measure of dysfunctional breathing symptoms: The Self Evaluation of Breathing Questionnaire (SEBQ)
Courtney, R., Greenwood, K. M.
International Journal of Osteopathic Medicine, 2009/12
3354

Feel, think, treat – A review of the German Osteopathic Congress Berlin Nov 20–23 2008
Donnelly, D.
International Journal of Osteopathic Medicine, 2009/12
3355

Carpal tunnel syndrome: ultrasonographic imaging and pathologic mechanisms of median nerve compression
Sucher, B. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text
3356

Die Integration der Osteopathie in die öffentliche Gesundheitsversorgung in Südtirol
(The integration of osteopathy in the public health care system in South Tyrol)
Morandell, R.
Unpublished MSc thesis, 2009/12
Free full text
3357

Beziehung und Bindung in der osteopathischen Kinderbehandlung
(Relationship and attachment in osteopathic treatment of children)
Dräger, K., Dräger, C.
Osteopathische Medizin, 2009/12
3358

Osteopathische Behandlung entwicklungsbedingter Hüftdysplasie bei Säuglingen während des ersten Lebensjahres
(Osteopathic treatment of developmental hip dysplasia in infants during the first year of life)
Lasovetskaya, L., Karpova, T.
Osteopathische Medizin, 2009/12
3359

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text
3360

Analyse critique de l’enseignement de techniques manipulatives rachidiennes basées sur les « lois de Fryette »
(Critical analysis of teaching spinal manipulation techniques based on the “Fryette laws“)
Zegarra-Parodi, R., Fabre, L.
Kinésithérapie, la Revue, 2009/12
3361

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text
3362

Empathie als Teil des Wahrnehmungsprozesses in der Osteopathie Teil II
(Empathy as part of the perception process in osteopathy, part 2)
Fiedler, I. C.
Unpublished MSc thesis, 2009/12
Free full text
3363

Der osteopathische Ansatz bei der gastroösophagealen Refluxerkrankung im Säuglingsalter
(The osteopathic approach to gastroesophageal reflux in infants)
Haindl, M.
Unpublished MSc thesis, 2009/12
Free full text
3364

Osteopathy and Evidence Based Medicine. Analysis of Studies Investigating Benefits of Osteopathy as Treatment of Back Pain
Richter, A.
Unpublished MSc thesis, 2009/12
Free full text
3365

Der Einfluss der osteopathischen Behandlung auf die respiratorische Leistung bei Kindern mit Asthma bronchiale
(The influence of osteopathic treatment on the respiratory capabilities of children suffering from asthma)
Schäfer, E.M.
Unpublished MSc thesis, 2009/12
Free full text
3366

Can intraocular pressure be influenced by osteopathic treatment?
van de Kraats, A.
Unpublished MSc thesis, 2009/12
Free full text
3367

Lymphatic pump treatment enhances pulmonary immunity and inhibits solid tumor formation in the lung
Pedrueza, M.
Unpublished MSc thesis, 2009/12
3368

Effects of an osteopathic clinical based approach for the treatment of chronic non-specific low back pain in factory workers: A single cohort, pilot study
Yardley, S.
Unpublished MSc thesis, 2009/12
Free full text
3369

Billing and coding for OMT
Doss, Y. L., Snider, K. T.
The Journal of the American Osteopathic Association, 2009/11
Free full text
3370

Osteopathic manipulative treatment in the management of notalgia paresthetica
Richardson, B. S., Way, B. V., Speece III., A. J.
The Journal of the American Osteopathic Association, 2009/11
Free full text
3371

Kann eine Strain Counterstrain Technik die Beschwerden beim Restless-Legs-Syndrom lindern?
(Can a Strain Counterstrain technique help to alleviate the symptoms of the Restless Legs Syndrome?)
Kroll, T.
Unpublished MSc thesis, 2009/11
Free full text
3372

Clearly distinct: outcomes of initiative to increase integration of osteopathic principles and practice at West Virginia School of Osteopathic Medicine
Steele, K. M., Baker, H. H.
The Journal of the American Osteopathic Association, 2009/11
Free full text
3373

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text
3374

Complementary and alternative health care use in young children with physical disabilities waiting for rehabilitation services in Canada
April, K. T., Feldman, D. E., Zunzunegui, M. V., Descarreaux, M., Grilli, L.
Disability and Rehabilitation, 2009/11
3375

Chronische Prostatitis/chronisches Beckenschmerzsyndrom. Einfluss osteopathischer Behandlungen - eine randomisiert kontrollierte Studie.
(Chronic prostatitis/chronic pelvic pain syndrome. Influence of osteopathic treatment - a randomized controlled study)
Marx, S., Cimniak, U., Beckert, R., Schwerla, F., Resch, K.L.
Urologe A, 2009/11
3376

Osteopathie bei akuter Hörminderung im Tieftonbereich
(Osteopathic treatment of acute hearing loss in the low-frequency range)
Raanaas, H.
Unpublished MSc thesis, 2009/11
Free full text
3377

Schulmedizin – Osteopathie Das Wissen zur Osteopathie und deren Akzeptanz bei Ärzten im Kanton Zürich
(Conventional Medicine vs. Osteopathy: Knowledge of Osteopathy and its Acceptance by Conventionally Trained Physicians in the Canton of Zurich)
Wiesend, K.
Unpublished MSc thesis, 2009/11
Free full text
3378

Personality types and performance on aptitude and achievement tests
Kimmelman, M., Giacobbe, J., Switala, C. A.
The Journal of the American Osteopathic Association, 2009/10
Free full text
3379

Therapeutische Wirksamkeit der osteopathischen Behandlung bei Patienten mit funktioneller Stimmstörung
(Therapeutic effectiveness of osteopathic treatment in patients with functional dysphonia)
Braun, G., Seibl, G., Skrivanek, J.
Unpublished D.O. thesis, 2009/10
3380

Einfluss von osteopathischer und physiotherapeutischer Behandlung auf die idiopathische Säuglingsasymmetrie. Eine randomisierte kontrollierte Studie
(Evaluation of the effectiveness of osteopathic and physiotherapeutic intervention on idiopathic infantile asymmetry. A randomized controlled trial)
Brockmeyer, I., Exner-Panne, K., Peschke, K
Unpublished D.O. thesis, 2009/10
3381

Osteopathische Behandlung von Patienten mit Schulterschmerz. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of patients with shoulder pain. A randomized controlled trial)
Bube, J., Hettasch, J.
Unpublished D.O. thesis, 2009/10
3382

Untersuchung der therapeutischen Wirksamkeit osteopathischer Behandlungen bei Patienten mit chronischen Nackenschmerzen nach einem posttraumatischen Zervikalsyndrom durch ein Beschleunigungstrauma.
(Evaluation of the effectiveness of osteopathic treatments in patients with chronic neck pain after a posttraumatic cervical syndrome following a whiplash injury. A randomized controlled trial)
Engemann, K., Hofmeier, G.
Unpublished D.O. thesis, 2009/10
3383

Einfluss osteopathischer Behandlungen auf craniomandibuläre Dysfunktionen. Eine randomisierte kontrollierte Studie
(Influence of osteopathic treatments on Craniomandibular Dysfunction. A randomized controlled trial)
Gerber, B., Kästner, K., Schrammek, T.
Unpublished D.O. thesis, 2009/10
3384

The immediate effect of individual manipulation techniques on pulmonary function measures in persons with chronic obstructive pulmonary disease
Noll, D. R., Johnson, J. C., Baer, R. W., Snider, E. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text
3385

Auswirkung von osteopathischen Behandlungen auf das Metabolische Syndrom
(Effectiveness of osteopathic treatment on the Metabolic Syndrome)
Kaske, R., Wittchow, R.
Unpublished D.O. thesis, 2009/10
3386

Haben osteopathische Behandlungen einen positiven Einfluss auf das Symptombild von Frauen, die an Endometriose erkrankt sind? Eine randomisierte kontrollierte Studie
(Do osteopathic treatments influence the symptom-pattern in women suffering from endometriosis positively?)
Koop Dick, S.
Unpublished D.O. thesis, 2009/10
3387

(Does osteopathic treatment influence thoracolumbar junction back pain positively?)
Lützelberger, N.
Unpublished D.O. thesis, 2009/10
3388

The effects of osteopathic treatment on constipation in children with cerebral palsy: a pilot study
Tarsuslu, T., Bol, H., Simsek, I. E., Toylan, I. E., Cam, S.
Journal of Manipulative and Physiological Therapeutics, 2009/10
Free full text
3389

Osteopathische Behandlung von Frauen mit Blasenentleerungsstörungen (BES). Eine randomisierte kontrollierte Studie
(Osteopathic treatment of women with voiding dysfunction. A randomized controlled trial)
Ringkamp, C., Rodriquez, B.
Unpublished D.O. thesis, 2009/10
3390

Osteopathie bei saisonal bedingter allergischer Rhinokonjunktivitis. Eine randomisierte kontrollierte Studie
Osteopathic treatment on Seasonal Allergic Rhinoconjuntivitis. A randomized controlled trial
Sachse-Sterlemann, K., Wernicke, K.
Unpublished D.O. thesis, 2009/10
3391

Effekte osteopathischer Behandlung auf Adipositias im Jugenalter. Eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment on adolescent obesity. A randomized controlled trial)
Schöndorfer, S., Wentzke, S.
Unpublished D.O. thesis, 2009/10
3392

Leben ist Bewegung
(Life is movement)
Gillemot, B., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3393

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3394

Osteopathie für Pferd und Reiter
(Osteopathy for Horse and Rider)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3395

Erfahrungsbericht aus dem Basketball–Trainingslager
(Report on the Experiences Gained During the Basketball Training Camp of the Men's National Team)
Kaufmann, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3396

Akuter Bandscheibenvorfall
(Acute spinal disk herniation)
Klein, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3397

Manipulation vor dem Wettkampf?
(Manipulative treatment before the competition?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3398

Osteopathie im Sport
(Osteopathy in sports)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3399

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3400

Migräne bei Kindern und Jugendlichen. Eine randomisierte kontrollierte Studie
(Migraine in children and adolescents. A randomized controll trial)
Aarts, U., Sterenberg, M., Wijnen, A.
Unpublished D.O. thesis, 2009/10
3401

Management of chronic posttraumatic headache: a multidisciplinary approach
Channell, M. K., Mueller, L. L., Hahn, R.
The Journal of the American Osteopathic Association, 2009/09
Free full text
3402

Continuing Professional Development Activity
Moran, R.
International Journal of Osteopathic Medicine, 2009/09
3403

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
3404

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09
3405

Comparison of the Manual Assessment of Respiratory Motion (MARM) and the Hi Lo Breathing Assessment in determining a simulated breathing pattern
Courtney, R., Cohen, M., Reece, J.
International Journal of Osteopathic Medicine, 2009/09
3406

Trager® Psychophysische Integration
(Trager® Psychophysical Integration)
Heigl, M.
Osteopathische Medizin, 2009/09
3407

Kräfteverteilungen im Körper des Menschen am Beispiel von Gewichthebern – Tensegrity als Erklärungsmodell
(The distribution of forces in the human body using the example of a weightlifter - Tensegrity as explanatory model)
Siemsen, C.H., Dittrich, H.
Osteopathische Medizin, 2009/09
3408

Ligamente als Entstehungsort berufsbedingter Störungen
(The ligaments as points of origin of occupational diseases)
Solomonow, M.
Osteopathische Medizin, 2009/09
3409

Osteopathie nach HWS-Schleudertrauma
(Osteopathy after whiplash injury)
Tempelhof, S.
Osteopathische Medizin, 2009/09
3410

Application of Osteopathy in the Cranial Field to Successfully Treat Vertigo: A Case Series
Berkowitz, M. R.
The AAO Journal, 2009/09
Free full text
3411

A case report of Osteopathic Manipulative Treatment in a 14 year-old girl with McCune-Albright Syndrome
Colonvega, M., Hensel, K., Minotti, D. II., Williams, S.
The AAO Journal, 2009/09
Free full text
3412

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
3413

La langue : déglutition, fonctions oro-faciales, croissance crânio-faciale
(The tongue: deglutition, orofacial functions and craniofacial growth)
Landouzy, J.M., Sergent Delattre, A., Fenart, R., Delattre, B., Claire, J., Biecq, M.
International Orthodontics, 2009/09
3414

Uncontrolled Asthma: Osteopathic Manipulative Treatment Applied in a Rural Setting
Sanchez, J. Jr.
The AAO Journal, 2009/09
Free full text
3415

Ist die Ernährung Bestandteil der osteopathischen Untersuchung und Behandlung von selbständigen Osteopathen?
(Do self-employed osteopaths take nutrition into account when conducting diagnosis and treatment?)
Meuser-Scheliga, M.
Unpublished MSc thesis, 2009/09
Free full text
3416

Inter-examiner reliability of palpation for tissue texture abnormality in the thoracic paraspinal region
Paulet, T., Fryer, G.
International Journal of Osteopathic Medicine, 2009/09
3417

Influencias de la relación maxilomandibular en el tratamiento postural mediante inhibición muscular
(Influence of maxillomandibular relationship in postural treatment involving muscle inhibition)
Rodríguez Blanco, C., Torres-Lagares, D., Munuera-Martínez, P. V., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09
3418

Fibromyalgia Treatment Trial With Gabapentin and Osteopathic Manipulative Medicine
Bernard, N., Marske, C. S., Palacios, A., Preiss, B., Bhattacharya, S., Brown, M., Wheeler, C., Fatunde, T.
Journal of Osteopathic Medicine, 2009/08
3419

Impact of osteopathic manipulative treatment on cost of care for patients with migraine headache: a retrospective review of patient records
Schabert, E., Crow, W. T.
The Journal of the American Osteopathic Association, 2009/08
Free full text
3420

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text
3421

The Effects of Lymphatic Pump Manipulation on Tumor Development and Metastasis
Huff, J. B., Pedrueza, M., Jones, H., Hodge, L.
The Journal of the American Osteopathic Association, 2009/08
3422

The Development of a Rodent Model to Study the Effects of Lymphatic Pump Treatment on the Lymphatic and Immune System
Huff, J. B., Winterrowd, K., King, H. H., Hodge, L.
The Journal of the American Osteopathic Association, 2009/08
3423

Creation of a Database Template for Performing a Retrospective Chart Review of an OMM Hospital Consultation Service
Snider, K. T., Snider, E. J., Bukowski, A. M., Johnson, J. C., DeGooyer, B. R.
The Journal of the American Osteopathic Association, 2009/08
3424

Retrospective Chart Review of the OMM Hospital Consultation Service at NRMC - Preliminary Results
Snider, K. T., Snider, E. J., DeGooyer, B. R., Johnson, J. C., Bukowski, A. M.
The Journal of the American Osteopathic Association, 2009/08
3425

MRI Assessment of Responses to Manipulative Treatment of Individuals With Low Back Pain
Walkowski, S. A., Eland, D. C., Clark, B. C., Conatser Jr., R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2009/08
3426

Amelioration of Oxidative Stress and Motor Deficits With Osteopathic Manipulative Treatment in a Mouse Model for Human Parkinson Disease
Zakhary, S., Jose, R., Dileo, J., Ayubcha, D., Hallas, B. H., Torres, G., Leheste, J.
The Journal of the American Osteopathic Association, 2009/08
3427

Lymphatic Pump Manipulation Mobilizes Inflammatory Mediators into Lymphatic Circulation
Huff, J. B., Schander, A., King, H. H., Downey, H. F., Hodge, L.
The Journal of the American Osteopathic Association, 2009/08
3428

Cranial palpation pressures used by osteopathy students
Kary, D.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3429

Letter to the Editor (2) Regarding “Brachial Plexus Injuries in Neonates”
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3430

Survey results: OMT and CAM
Ramos, R. L., Sharma, S., Lipoff, D. M.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3431

Osteopathy in the cranial field provides an important contribution to the practice of medicine as a clinical application of osteopathic principles
Rosen, M. E.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3432

Brachial plexus injuries in neonates
Sucher, B. M.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3433

Headache (chronic tension-type)
Krishnan, A., Silver, N.
BMJ Clinical Evidence, 2009/07
Free full text
3434

An investigation into the regulation of intra-cranial pressure and its influence upon the surrounding cranial bones
Gard, G.
Journal of Bodywork and Movement Therapies, 2009/07
3435

Osteopathische Behandlung akuter Erkrankungen
(Osteopathic Treatment of Acute Diseases)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3436

Forum zur aktuellen Entwicklung in der Osteopathie
(Forum on the current development in osteopathy)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3437

Hand anlegen beim akuten Schulterschmerz?
(Lay a hand on acute shoulder pain?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3438

Akute Krankheitsbilder – Möglichkeiten und Grenzen der klinischen Osteopathie heute
(Acute Clinical Pictures – Chances and Limits of Today's Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3439

Aufruf Arbeitskreis klinische Osteopathie
(Appeal for a Working Group Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3440

Sinusitis
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3441

Akute Halswirbelsäulenerkrankungen – Grenzbereiche
(Frontiers – Acute Diseases of the Cervical Spine)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3442

Continuing Professional Development Activity
Lucas, N.
International Journal of Osteopathic Medicine, 2009/06
3443

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text
3444

Monitoring self-reported adverse events: A prospective, pilot study in a UK osteopathic teaching clinic
Rajendran, D., Mullinger, B., Fossum, C., Collins, P., Froud, R.
International Journal of Osteopathic Medicine, 2009/06
3445

The effects of high-velocity low-amplitude thrust manipulation and mobilisation techniques on pressure pain threshold in the lumbar spine
Thomson, O. P., Haig, L., Mansfield, H.
International Journal of Osteopathic Medicine, 2009/06
3446

Einfluss von osteopathischen Behandlungen auf die Leistungsfähigkeit von Hobbyläufern: Masterthesis zur Erlangung des Masters of Science Osteopathie an der Donauuniversität Krems 2007
(Effect of osteopathic treatment on the athletic performance of hobby runners)
Haberl, F. J.
Osteopathische Medizin, 2009/06
3447

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text
3448

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text
3449

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text
3450

Osteopathic medical graduates in ACGME residencies: another way to embrace the osteopathic philosophy.
Reed, K.
Academic Medicine, 2009/06
Free full text
3451

Strukturelle Integration durch Rolfing® und Normal Function
(Structural integration with Rolfing® and normal function)
Specka, I.
Osteopathische Medizin, 2009/06
3452

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
3453

Schwindel in der osteopathischen Praxis
(Dizziness in osteopathy practice)
Thomas, D.
Osteopathische Medizin, 2009/06
3454

Accreditation standards of osteopathic and allopathic medical schools: could they affect educational quality?
Wood, D. L., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
3455

Osteopathic manual medicine for vertigo: review of literature, case report, and future research
Fraix, M.
The AAO Journal, 2009/06
Free full text
3456

Scapular Glide: Functional relationships, dysfunction and treatment
Kary, D. J.
The AAO Journal, 2009/06
Free full text
3457

OMT as an adjunct therapy for post-traumatic headache in U.S. soldiers: A case series
Kozminski, M., Kozminski, T.
The AAO Journal, 2009/06
Free full text
3458

Osteopathic Manipulative Management in Sudden Infant Death Syndrome
MacDonald, R. C.
The AAO Journal, 2009/06
Free full text
3459

Osteopathic approach to the spleen
Peeters, L., Lason, G.
The AAO Journal, 2009/06
Free full text
3460

Case Study: An Osteopathic Approach to Management of a Patient with Charcot-Marie Tooth Syndrome Type II
Thoreson, M.
The AAO Journal, 2009/06
Free full text
3461

O efeito imediato da manipulação talocrural na estabilidade unipodal de tornozelo
(Immediate effects of talocrural manipulation on ankle monopodalic stability)
Xavier, M., Pires, V. A., Albertini, R. A., Arrieiro, A. N., Manuard, P., Almeida, L. C., de, Souza R. A.
Revista terapia manual, 2009/05-06
3462

Contraindications in Osteopathy
Gatterbauer, A.
Unpublished MSc thesis, 2009/05
Free full text
3463

Treatment approaches in osteopathy for the therapy of migraine
Michal, I.
Unpublished MSc thesis, 2009/05
Free full text
3464

Umstellung von Physiotherapie auf Osteopathie – ein problembelasteter Prozess für Therapeuten in Deutschland?
(Re-orientation of a Practice from Physiotherapy to Osteopathy - A problematic process for therapists in Germany?)
Wieligmann, J.
Unpublished MSc thesis, 2009/05
Free full text
3465

Osteopathic manipulative medicine in pregnancy: Acute physiological and biomechanical effects
Hensel, K. L.
Unpublished PhD thesis, 2009/05
3466

Osteopathic manipulative treatment and carpal tunnel syndrome: Analysis of pathogenesis, mechanisms of treatment and applicability to specific and general populations
Walz, B. D.
Unpublished MSc thesis, 2009/05
3467

Efectos inmediatos del estiramiento de los músculos isquiosurales en el sistema estomatognático en la cervicalgia mecánica
(The immediate effects of hamstring muscle stretching on the stomatognathic system in mechanical neck pain)
Bretischwerdt, C., Rivas, L., Palomeque, L., Alburquerque, F.
Osteopatía Científica, 2009/05
3468

Impacto de las técnicas manuales usadas en osteopatía sobre los propioceptores musculares: revisión de la literatura científica
(Impact of manual osteopathic techniques on muscle proprioceptors: a literature review)
González, I.
Osteopatía Científica, 2009/05
3469

Estenosis foraminal con radiculopatía debida a hernia de disco cervical en un varón de 33 años tratado con manipulación de flexión-distracción de Cox de descompresión
(Foraminal stenosis with radiculopathy from a cervical disc herniation in a 33-year-old man treated with flexion distraction decompression manipulation)
Gudavalli, S., Kruse, R. A.
Osteopatía Científica, 2009/05
3470

Dolor y estrategias terapéuticas en osteopatía (III)
(Pain and therapeutic approaches in osteopathy (III))
Hernández Xumet, J. E.
Osteopatía Científica, 2009/05
3471

Técnica semidirecta de thrust con kick para lesión de ilíaco anterior izquierdo
(Semidirect thrust kick technique in left anterior iliac dysfunction)
Mancha, J. A. D., Martín, C. O.
Osteopatía Científica, 2009/05
3472

Repercusiones sintomáticas de la técnica dog en extensión bilateral sobre D5/D6 en pacientes dispépticos
(Symptomatic impact of the bilateral extension dog technique on T5-T6 in dyspeptic patients)
Sánchez Jiménez, E., Díaz, J. R.
Osteopatía Científica, 2009/05
3473

Estimating cost of care for patients with acute low back pain: a retrospective review of patient records
Crow, W. T., Willis, D. R.
The Journal of the American Osteopathic Association, 2009/04
Free full text
3474

Modificaciones en la presión intraocular y la presión arterial en pacientes con diabetes mellitus tipo 1 tras la manipulación global occipucio-atlas-axis según Fryette. Ensayo clínico aleatorizado
(Modifications in intraocular and blood pressure in type I diabetics after Fryette's occiput-atlas-axis manipulation. A randomized clinical trial)
Díaz Cerrato, I., Martínez Loza, E., Martín-Ampudia Ugena, M. I.
Osteopatía Científica, 2009/04
3475

Spinal and sacroiliac assessment and treatment techniques used by osteopathic physicians in the United States
Fryer, G., Morse, C. M., Johnson, J. C.
Osteopathic Medicine and Primary Care, 2009/04
Free full text
3476

Dolor y estrategias terapéuticas en osteopatía (II)
(Pain and therapeutic approaches in osteopathy (II))
Hernández Xumet, J. E.
Osteopatía Científica, 2009/04
3477

Pruebas para la detección de hipersensibilidad sensorial o hiperexcitabilidad central asociada al dolor cervical
(Testing for sensory hypersensitivity or central hyperexcitability associated with cervical spine pain)
Sterling, M.
Osteopatía Científica, 2009/04
3478

Osteopatía en un trastorno grave de la deglución
(Osteopathic medicine in severe swallowing dysfunction)
Velasco Roldán, O., Pascual-Vaca, J. O., Solana Díaz, M. T., Outón Ruíz, L., Sebastián Rausell, J. M.
Osteopatía Científica, 2009/04
3479

An investigation into the effects of manual technique targeted towards psoas major muscle on lumbar range of motion
Gabin, M.
Unpublished MSc thesis, 2009/03
Free full text
3480

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3481

Prevention, diagnosis, and management of osteoporosis-related fracture
Fakih, M.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3482

Continuing Professional Development Activity
Moran, R.
International Journal of Osteopathic Medicine, 2009/03
3483

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques
Noll, D. R.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3484

Does osteopathic manipulative treatment (OMT) improves outcomes in patients who develop postoperative ileus: A retrospective chart review
Crow, W. T., Gorodinsky, L.
International Journal of Osteopathic Medicine, 2009/03
3485

Therapeutic needling in osteopathic practice: An evidence-informed perspective
Rickards, L. D.
International Journal of Osteopathic Medicine, 2009/03
3486

A Case History of Recent Problem Breathing and Special OMT for the Heart
Chapello, I. A.
The AAO Journal, 2009/03
Free full text
3487

The Use Of Heel Lifts and Custom Orthotics In Reducing Self-Reported Chronic Musculoskeletal Pain Scores
Lipton, J. A., Flowers-Johnson, J., Bunnell, M. T., Carter, L.
The AAO Journal, 2009/03
Free full text
3488

Comparison of osteopathy with manual therapy (according to the CRAFTA® concept) for the treatment of patients with craniomandibular dysfunctions (CMD)
Hörster, A.
Unpublished MSc thesis, 2009/03
Free full text
3489

Treatment of the monosymptomatic Nocturnal enuresis
Scheible, B.
Unpublished MSc thesis, 2009/03
Free full text
3490

Osteopathic Manipulative Treatment as Adjuvant Therapy in Peripheral Arterial Disease.
Lombardini, R., Collebrusco, L.
Manual Therapy, 2009/03
Free full text
3491

Wie gestalten Osteopathen die Beziehung zu ihren Patienten? – Eine qualitative Studie
(How do osteopaths form relationships with their patients? - A qualitative study)
Novy, R., Sommerfeld, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
3492

Anamnesegesteuerte Palpation
(Anamnesis-guided palpation)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
3493

Palpation zwischen Struktur und Energie
(Palpation between Structure and Energy)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
Free full text
3494

Brachial plexus injuries in neonates: an osteopathic approach
Mason, D. C., Ciervo, C. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text
3495

Grenzen des Konzepts der Symmetrie in der osteopathischen Beurteilung: Eine Erweiterung des Konzepts in Hinblick auf Proportionalität führt zu besseren klinischen Ergebnissen
(The limits of the concept of symmetry in osteopathic diagnostics: Expanding the concept in regards to proportionality leads to improved clinical results)
Brooks, W.
Osteopathische Medizin, 2009/02
3496

Spracherwerb und osteopathische Gedanken zur Dyslalie
(Language acquisition and osteopathic thought in regards to dyslalia)
Riedel, M.
Osteopathische Medizin, 2009/02
3497

Osteopathy and pregnancy
Hyde, D.
The Practising Midwife, 2009/02
3498

The meaning of the German terms ‘HEIL’ (wellbeing, salvation, blessedness etc.) / ‘HEILUNG’ (healing) in osteopathy with regard to the modality of LEIBLICHKEIT
Suppanz, H.
Unpublished MSc thesis, 2009/02
Free full text
3499

Hat eine osteopathische Behandlung Einfluss auf den emotionalen Gefühlszustand?
(Does an osteopathic treatment have any influence on emotions?)
Dettling, C.
Unpublished MSc thesis, 2009/02
Free full text
3500

Criteria to Determine Intervals of Treatment
Halasz, C.
Unpublished MSc thesis, 2009/02
Free full text
3501

Osteopathy - the way from therapy to prevention
May, M.
Unpublished MSc thesis, 2009/02
Free full text
3502

Is the osteopathic treatment to be seen as an alternative method for treating and successfully supporting opiate addicts during withdrawal and detoxication?
Neuhold, G.
Unpublished MSc thesis, 2009/02
Free full text
3503

The effect of osteopathic manipulative techniques on diaphragm movement and respiratory function in asymptomatic subjects
Hosking, S.
Unpublished MSc thesis, 2009/01
Free full text
3504

An investigation of the experience of osteopathically treating babies with breastfeeding problems
Carey, L.
Unpublished MSc thesis, 2009/01
Free full text
3505

Reliability of visual assessment of forward head posture in standing
Aitken, A. W.
Unpublished MSc thesis, 2009/01
Free full text
3506

Osteopathic Manipulative Medicine Efficacy on Pulmonary Function as Measured by Spirometry
Liu, T., Werley, J., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2009/01
3507

Salivary IgA Fluctuations in Response to Stress and Osteopathic Manipulative Treatment
Norton, J., Pilc, J., Saggio, G., Gilliar, W.
The Journal of the American Osteopathic Association, 2009/01
3508

Ist die Osteopathie eine sinnvolle Maßnahme in Kombination mit Hippotherapie bei einem CP-Kind?
Is Osteopathy combined with Hippotherapy a Sensible Therapeutic Measure for the Treatment of Children with Cerebral Palsy?
Günter, P.
Unpublished MSc thesis, 2009/01
Free full text
3509

The Use of Osteopathic Manipulation in a Clinic and Home Setting to Address Pulmonary Distress as Related to Asthma in Southwest Virginia
Latter, M. L.
Unpublished PhD thesis, 2009/01
3510

Wie lassen sich osteopathische Techniken für die Behandlung von Kindern adaptieren? – Die Herangehensweise des Osteopathischen Zentrums für Kinder in Wien
(How Can Osteopathic Techniques Be Adapted for the Treatment of Children?)
Burian–Lang, E., Mückler, A., Urbanek, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
3511

Osteopathie bei Frühgeborenen
(Osteopathy with Premature Infants)
Lamberts, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
3512

Deutsche Gesellschaft für Kinderosteopathie (DGKO) gegründet
(German Society for Pediatric Osteopathy (DGKO) founded)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
3513

Neurobiologische Prinzipien und klinische Aspekte der Säuglingsentwicklung – Teil 2: Umgebungsfaktoren
(Neurobiological principles and clinical aspects of infant development - Part 2: Environmental factors)
Philippi, H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
3514

Continuing Professional Development Activity
Vogel, S.
International Journal of Osteopathic Medicine, 2008/12
3515

Healing Hands: Using Osteopathic Manipulative Treatment to Address Visceral Structures through Somatovisceral Reflexes: A Case Study in Gastroesophageal Reflux Disease
Branyon, B.
The AAO Journal, 2008/12
Free full text
3516

The Detection and Recording of Cranial Rhythmic Impulse in Acupuncture Points using Surface Scanning Laser Displacement Meter and its Significance
Pribadi, K. S.
The AAO Journal, 2008/12
Free full text
3517

Contemplations on the Art of OMT After Thirty Years of Practice: 2008 Northup Lecture
Steele, K. M.
The AAO Journal, 2008/12
Free full text
3518

Muscle Impulse, A Muscle Energy Variant
van Buskirk, R. L.
The AAO Journal, 2008/12
Free full text
3519

Test-dependent osteopathic treatment of somatoform autonomic dysfunction of the cardiovascular system: A pre-post pilot trial
Zorgman, M., Sauerburger, S., Ruetz, M., Schwerla, F.
International Journal of Osteopathic Medicine, 2008/12
3520

Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with chronic rhino sinusitis (CRS)? A randomized controlled trial
Steinbauer, U., Roos, S., Amann, P., Schwerla, F., Resch, K.L.
International Journal of Osteopathic Medicine, 2008/12
3521

Study on the effectiveness of a test-dependent osteopathic treatment for women with persistent post partum back pain: A randomized controlled trial
Recknagel, C., Roß, J., Recknagel, A., Ruetz, M., Schwerla, F.
International Journal of Osteopathic Medicine, 2008/12
3522

A randomised controlled trial on the effectiveness of osteopathic manipulative treatment of chronic low back pain
Mandara, A., Fusaro, A., Musicco, M., Bado, F.
International Journal of Osteopathic Medicine, 2008/12
3523

The assessment of clinical practice in osteopathic education: Is there a need to define a gold standard?
London, S.
International Journal of Osteopathic Medicine, 2008/12
3524

How do patients feel post-treatment? pilot study at a UK osteopathic teaching clinic of self-reported adverse events
Froud, R., Rajendran, D., Fossum, C., Collins, P., Mullinger, B.
International Journal of Osteopathic Medicine, 2008/12
3525

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12
3526

Osteopathic lymphatic pump treatment and exercise increase lymph flow in conscious dogs with normal and expanded extracellular fluid volume
Downey, H. F., Durgam, P., Williams Jr, A. G., Rajmane, A., King, H. H., Stoll, S. T.
International Journal of Osteopathic Medicine, 2008/12
3527

Pilot clinical study of osteopathic manipulative treatment in pregnant patients with acute low back pain
Caragan, C., Tang, P.Y., Slack, M., Leiber, J. D., Koskinen, J., Zust, D., Cragun, T.
International Journal of Osteopathic Medicine, 2008/12
3528

Assessing clinical competence in osteopathic education: Analysis of outcomes of different assessment strategies at the British School of Osteopathy
Abbey, H.
International Journal of Osteopathic Medicine, 2008/12
3529

Cambios en la presión arterial y frecuencia cardíaca después de una presión sobre la válvula aórtica en sujetos con hipertensión arterial esencial
(Changes in arterial pressure and cardiac frequency after pressure on the aortic valve in patients with essential hypertension)
Benito, M. M., Marín, R. C.
Osteopatía Científica, 2008/12
3530

Eficacia de una técnica de thrust para la disfunción glenohumeral en superioridad
(Efficacy of a thrust technique for upward glenohumeral dysfunction)
García Vila, S. F., Sánchez, C. C.
Osteopatía Científica, 2008/12
3531

Dolor y estrategias terapéuticas en osteopatía (I)
(Pain and therapeutic approaches in osteopathy (I))
Hernández Xumet, J. E.
Osteopatía Científica, 2008/12
3532

Eficacia del tratamiento osteopático en la rinosinusitis crónica del adulto
(Efficacy of osteopathic treatment in adult chronic rhinosinusitis)
Méndez Sánchez, R.
Osteopatía Científica, 2008/12
3533

Spinal and sacroiliac joint assessment and treatment within the American osteopathic profession
Fryer, G., Morse, C., Johnson, J. C.
International Journal of Osteopathic Medicine, 2008/12
3534

The introduction of a novel approach to the teaching and assessment of osteopathic manipulative medicine assessment skills
Fossum, C., Snider, E., Fryer, G., Gillette, N., Degenhardt, B.
International Journal of Osteopathic Medicine, 2008/12
3535

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12
3536

The hands of the osteopaths. Thinking fingers. Their special training
Hansak, S.
Unpublished MSc thesis, 2008/11
Free full text
3537

How often are thrust techniques used in practice
Pingitzer, T.
Unpublished MSc thesis, 2008/11
Free full text
3538

Neurobiologische Aspekte eines Knackgeräusches im Rahmen einer HVLA Technik
(Neurobiological aspects of a cracking noise within the framework of an HVLA technique)
Beck, M.
Osteopathische Medizin, 2008/11
3539

Osteopathie zur Optimierung des Golfschwunges
(Osteopathy for the optimization of the golf swing)
Marcucci, S.
Osteopathische Medizin, 2008/11
3540

Reflections on the impact of Title VII funding at the University of New England College of Osteopathic Medicine
Shannon, S. C.
Academic Medicine, 2008/11
3541

Kalzifikation der Supraspinatussehne- ein osteopathischer Ansatz?
(Calcification of the Supraspinatus muscle - an osteopathic approach?)
Schwarz, H.
Unpublished MSc thesis, 2008/11
Free full text
3542

Mobility and other parameters of the musculoskeletal system before and after an osteopathic treatment of the eye and its directly connected structures with patients having myopia, hyperopia and/or astigmatism
Pesendorfer, M.
Unpublished MSc thesis, 2008/11
Free full text
3543

Osteopathie in der Pädiatrie, Teil 4: Sakrum und Os sphenoidale
(Osteopathy in Pediatrics Part 4: Sacrum and Os Sphenoidale)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3544

Der Einfluss osteopathischer Behandlungsmethoden bei craniomandibulären Dysfuntionen
(The influence of osteopathic treatment on temporomandibular disorders)
Radosai, F.
Unpublished MSc thesis, 2008/11
Free full text
3545

Can osteopathic treatments improve the overall picture of the patient with a common migraine?
Spannbauer, M.
Unpublished MSc thesis, 2008/11
Free full text
3546

Die Wirksamkeit einer osteopathischen Intervention bei Patienten mit einem einseitigen Tinnitus-aurium
(The effectiveness of osteopathic intervention at patients with a single-sided tinnitus aurium)
Twigt, P.
Unpublished MSc thesis, 2008/11
Free full text
3547

Is Sacral Listening Applied in a Uniform Way?
Krapp, B.
Unpublished MSc thesis, 2008/11
Free full text
3548

Kinder!
(Children!)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3549

The living matrix: a model for the primary respiratory mechanism
Lee, R. P.
Explore (NY), 2008/11
3550

The Influence of a Mobilisation of the Lesser Omentum on the Capacity of the Portal Vein, Measured with Echo-Doppler
Halbeisen, H.
Unpublished MSc thesis, 2008/11
Free full text
3551

Spastische Diparese
(Spastic paresis)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3552

Diagnosis and management of piriformis syndrome: an osteopathic approach
Boyajian-O'Neill, L. A., McClain, R. L., Coleman, M. K., Thomas, P. P.
The Journal of the American Osteopathic Association, 2008/11
Free full text
3553

Neurobiologische Prinzipien und klinische Aspekte der Säuglingsentwicklung, Teil 1
(Neurobiological principles and clinical aspects of infant development - Part 1)
Philippi, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3554

Functional gestational problems and osteopathy
Steinbauer, S.
Unpublished MSc thesis, 2008/11
Free full text
3555

Die drei Säulen der Y–Fuge der Säuglingshüfte
(The Three Pillars of the Hypsiloid Cartilage of the Hip of Infants)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3556

Säuglinge sind Viszera
(Infants are Viscera)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3557

Patient perception of osteopathic manipulative treatment in a hospitalized setting: a survey-based study
Pomykala, M., McElhinney, B., Beck, B. L., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2008/11
Free full text
3558

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques: a pilot crossover trial
Rivers, W. E., Treffer, K. D., Glaros, A. G., Williams, C. L.
The Journal of the American Osteopathic Association, 2008/11
Free full text
3559

Manuelle Medizin an der Halswirbelsäule: Atraumatische Weichtechnik der Chirotherapie und HVLA-Technik der Osteopathie im Synergismus
(Manuel medicine targeting the cervical spine: Synergies between atraumatic chiropractic techniques and osteopathy's HLVA-technique)
Stahlhofer, H.
Osteopathische Medizin, 2008/11
3560

Haben osteopathische Behandlungen einen Einfluss auf die Artikulationsfähigkeit bei Vorschulkindern mit Sigmatismus / Schetismus? Eine randomisierte kontrollierte Studie
(Can osteopathic treatments improve the capability of articulation and speech of children between four and six years suffering from speech disorders (Dyslalia). A randomized controlled trial)
Beckewitz-Hübner, M., Kraus, M.
Unpublished D.O. thesis, 2008/10
3561

Osteopathische Behandlungen von Patienten mit Miktionsbeschwerden (LUTS) bei benigner Prostatahyperplasie
(Osteopathic treatment of patients with lower urinary tract symptoms and benign prostatic hyperplasia)
Conrad, U., Scheuer, K.
Unpublished D.O. thesis, 2008/10
3562

Osteopathie bei chronischem Schmerz
(Osteopathy applied to chronic pain patients)
Deichmeier, A., von Fischern, F., Heinbücher, I.
Unpublished D.O. thesis, 2008/10
3563

Der Einfluss der osteopathischen Behandlung bei funktioneller Stimmstörung. Eine randomisierte kontrollierte Studie
(The Influence of Osteopathic Treatment in Functional Vocal Dysfunction. A randomized controlled trial)
Fleischer, F., Weese, P.
Unpublished D.O. thesis, 2008/10
3564

Empathie und Osteopathie. Eine Begriffsbestimmung der Empathie und eine Untersuchung der Empathiefähigkeit und deren Bedeutung im Therapeuten-Patienten-Verhältnis derzeit tätiger Osteopathen
(Empathy and Osteopathy. A systematic review and cross-sectional survey)
Hähn-Jakobs, C.
Unpublished D.O. thesis, 2008/10
3565

Patients' perceptions and satisfaction with treatment in a UK osteopathic training clinic
Strutt, R., Shaw, Q., Leach, J.
Manual Therapy, 2008/10
3566

Osteopathische Behandlung des Icterus neonatorum bei gesunden Neugeborenen. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of the neonatal jaundice of the healthy newborn. A randomised controlled trial)
Kenter, A., Schmieder, S.
Unpublished D.O. thesis, 2008/10
3567

Die osteopathische Behandlung von Frauen mit Descensus uteri
(Osteopathic treatment of women with uterine prolapse. A randomized controlled trial)
Kocheise-Miller, B, Quell, K.
Unpublished D.O. thesis, 2008/10
3568

Die osteopathische Behandlung von kindlichen und juvenilen Wachstumsschmerzen. Eine randomisierte kontrollierte Studie
(The osteopathic treatment of infantile and juvenile growing pains. A randomized controlled trial)
Löhr, M., Treinies, T.
Unpublished D.O. thesis, 2008/10
3569

Die osteopathische Behandlung von Säuglingen zwischen dem 4. und 12. Lebensmonat mit kongenitaler Tränenwegsstenose. Eine randomisierte kontrollierte Studie
(The osteopathic treatment in infants (4 to 12 month) with congenital nasolacrimal duct obstruction. A randomized controlled trial)
Heinisch, M., Oberhuber, H.
Unpublished D.O. thesis, 2008/10
3570

Osteopathische Behandlung bei somatoformen autonomen Funktionsstörungen des Herz- und Kreislaufsystems
(Osteopathic treatment of patients with cardiovascular somatoform autonomic dysfunctions (SAD). A randomized controlled trial)
Mühlen, N.
Unpublished D.O. thesis, 2008/10
3571

Semantischer Zugang zu Nomenklatur, Struktur und Funktion (dargestellt an ausgewählten Beispielen) knöcherner Strukturen des Craniums.
(Contribution to explaining the naming, structure and function (shown on special examples) in the area of the cranial bones)
Rega, B.
Unpublished D.O. thesis, 2008/10
3572

Können osteopathische Behandlungen einen Beitrag zur Verbesserung der Symptomatik chronischer funktioneller Obstipation leisten?
(Can Osteopathic treatments afford a contribution to improve the symptoms of chronic functional constipation?)
Schulz, P., Servatius, C.
Unpublished D.O. thesis, 2008/10
3573

Intra- and Inter-Rater Reliability of the Test: Anteromedial Position of the Talus in the Talocrural Joint
Dornieden, R.
Unpublished MSc thesis, 2008/10
Free full text
3574

Echinacea purpurea and osteopathic manipulative treatment in children with recurrent otitis media: a randomized controlled trial
Wahl, R. A., Aldous, M. B., Worden, K. A., Grant, K. L.
BMC Complementary and Alternative Medicine, 2008/10
Free full text
3575

Effectiveness of osteopathy in the cranial field and myofascial release versus acupuncture as complementary treatment for children with spastic cerebral palsy: a pilot study
Duncan, B., McDonough-Means, S., Worden, K., Schnyer, R., Andrews, J., Meaney, F. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text
3576

Legg reduction maneuver for patients with anterior shoulder dislocation
Dyck Jr., D. D., Porter, N. W., Dunbar, B. D.
The Journal of the American Osteopathic Association, 2008/10
Free full text
3577

Osteopathische Behandlung von Patienten mit Tinnitus und craniomandibulären Dysfunktionen
(Test-dependent osteopathic treatment of patients suffering from craniomandibular disorders (CMD) and tinnitus. A pre-post pilot trial)
Kronau, J. S., Moshövel, N.
Unpublished D.O. thesis, 2008/10
3578

The endocannabinoid system: an osteopathic perspective
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
3579

The influence of osteopathic treatments on the flexibility, technique and performance of juvenile high performance swimmers and high performance triathletes
Kattnig, W.
Unpublished MSc thesis, 2008/09
Free full text
3580

Research and treatment bulletin
Vaughan, B.
International Journal of Osteopathic Medicine, 2008/09
3581

Osteopathic Medicine and the Geriatric Patient
Hruby, R. J.
The AAO Journal, 2008/09
Free full text
3582

Osteopathic support for a survivor of gastric cancer: A case report
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/09
3583

Osteopathic treatment during immobilization of conservatively treated radial fractures in patients older than 45 years
Martschini, G.
Unpublished MSc thesis, 2008/09
Free full text
3584

Osteopathy with Enuresis
Kargl, D.
Unpublished MSc thesis, 2008/09
Free full text
3585

W.G.Sutherland - Seine Bedeutung in der Osteopathie einst und jetzt
William Garner Sutherland, The Founder of Cranial Osteopathy
Geppert, G.
Unpublished MSc thesis, 2008/09
Free full text
3586

Commentary on ‘Is there a place for science in the definition of osteopathy’?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09
3587

Le perinee douloureux sous toutes ses formes. Apport de la medecine manuelle et osteopathie. Etude clinique.
(Painful perineum in all its forms. Contribution of manual medicine and osteopathy. Clinical study)
Grimaldi, M.
Journal de Gynecologie, Obstetrique et Biologie de la Reproduction, 2008/09
3588

Osteopathic Prevention Study in Achievement-orientaded Young Soccer Players
Angleitner, C.
Unpublished MSc thesis, 2008/09
Free full text
3589

Osteopathic manipulation: promise for infantile colic
Friedman, S. J.
The Journal of the American Osteopathic Association, 2008/09
Free full text
3590

Clinical and research protocol for osteopathic manipulative treatment of elderly patients with pneumonia
Noll, D. R., Degenhardt, B. F., Fossum, C., Hensel, K.
The Journal of the American Osteopathic Association, 2008/09
Free full text
3591

Can back pain caused by symptom-giving sacroiliac joint relaxation during pregnancy be reduced by applying osteopathic treatment?
Aspalter, W.
Unpublished MSc thesis, 2008/09
Free full text
3592

Continuing professional development activity
Vogel, S.
International Journal of Osteopathic Medicine, 2008/09
3593

Effect of OMT in the Treatment of Initial Vascular Wall Alteration
Cerritelli, F., Carinci, F., Barlafante, G., Pizzolorusso, G., Turi, P., Cozzolino, V., Renzetti, C., Pizzolorusso, F., Orlando, F.
The Journal of the American Osteopathic Association, 2008/08
3594

Protective Effects of Craniocervical Osteopathic Manipulation on Cell Proliferation in the Developing Brain
LaTorre, G. N., Webster, T., Avallone, J., Hallas, B. H., Friedman, L.
The Journal of the American Osteopathic Association, 2008/08
3595

The Use of Osteopathic Manipulation to Address Pulmonary Distress as Related to Asthma in Southwest Virginia
Latter, M. L.
The Journal of the American Osteopathic Association, 2008/08
3596

Lymphatic Pump Treatment Mobilizes Leukocytes from the Gut Associated Lymphoid Tissue Into Thoracic Duct Lymph
Schander, A., Bearden, M. K., Huff, J. B., Williams Jr., A. J., Stoll, S. T., Simecka, J. W., King, H. H., Downey, H. F., Hodge, L.
The Journal of the American Osteopathic Association, 2008/08
3597

Lymphatic Pump Treatment Enhances Immunity and Reduces Pulmonary Disease During Experimental Pneumonia Infection
Huff, J. B., Schander, A., Stoll, S. T., Simecka, J. W., Downey, H. F., King, H. H., Hodge, L.
The Journal of the American Osteopathic Association, 2008/08
3598

Efficacy of Manipulative Treatment for Acute Low Back Pain in Active Duty Military Personnel
Stoll, S. T., Maurer, D., Hensel, K., Cruser, D.
The Journal of the American Osteopathic Association, 2008/08
3599

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3600

Einschneidende Rituale
(Drastic Rituals)
Knöppler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3601

Bedeutung der Haut im Umgang mit Säuglingen
(Significance of the Skin when Dealing with Infants)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3602

Atopische Dermatitis: (osteopathische) Hand anlegen!
(Atopic dermatitis: (osteopathic) hands on!)
Oezbay, I., Reckwerth, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3603

Evidence-based publications: balancing research mission and our community's needs
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3604

ED physicians beware when using OMT for patients with motor vehicle injuries
Fletcher, S. A.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3605

Therapie über die Körperoberfläche – Anatomische und physiologische Aspekte der neurolymphatischen Reflexpunkte am Beispiel der Augen– und Ohrzonen
(Therapy via the Body Surface – Anatomical and Physiological Aspects of the Neurolymphatic Reflex Points by the Example of Eye and Ear Zones)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
Free full text
3606

Unterhautblutung
(Subcutaneous hemorrhage)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3607

Erste Ansätze in der osteopathischen Behandlung der Haut
(First Approaches in the Osteopathic Treatment of the Skin)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3608

Osteopathic Manipulative Treatment for Postoperative Nausea and Vomiting
Schrick-Senasac, S. L., King, H. H.
The Journal of the American Osteopathic Association, 2008/08
3609

Validación del test de movilidad mandibular comparado con tomografía computarizada
(Validation of the mandibular mobility test compared with computed tomography)
García García, C., Rodríguez Díaz, J.
Osteopatía Científica, 2008/08
3610

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3611

Técnica combinada de articulación y thrust para disfunción de cóndilo posterior
(The combined articular thrust technique for posterior condyle dysfunction)
Guirao Cano, D.
Osteopatía Científica, 2008/08
3612

Eliminating bad, bad medicine: problems with P4P initiatives
McDonald, R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3613

Dolor craneofacial, craneomandibular y craneocervical. Diseño de caso único
(Craniofacial, craniocervical and/or craniomandibular pain: a single case design)
Hernández Xumet, J. E.
Osteopatía Científica, 2008/08
3614

Efectos de un protocolo secuenciado de terapia manual en los puntos gatillo latentes miofasciales de los maseteros
(Effects of a protocol of two manual techniques on latent myofascial trigger points of the masseter muscle)
Ibáñez García, J., Alburquerque Sendín, F.
Osteopatía Científica, 2008/08
3615

Posible manifestación de disfunción de la articulación temporomandibular en los estudios radiológicos quiroprácticos de las vértebras cervicales
(Possible manifestation of temporomandibular joint dysfunction on chiropractic cervical X-ray studies)
Knutson, G. A., Jacob, M.
Osteopatía Científica, 2008/08
3616

Efecto de la manipulación de la charnela occipito-atlo-axoidea en la apertura de la boca
(Effect of upper cervical spine manipulation on mouth opening)
Mansilla Ferragud, P., Boscá Gandia, J. J.
Osteopatía Científica, 2008/08
3617

Sistema estomatognático, osteopatía y postura
(The stomatognathic system, osteopathy and posture)
Oliva Pascual-Vaca, Á., Rodríguez Blanco, C.
Osteopatía Científica, 2008/08
3618

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3619

Introducing osteopathic medical education in an allopathic residency
Rubeor, A., Nothnagle, M., Taylor, J. S.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3620

Relationship of Osteopathic Manipulative Treatment During Labor and Delivery on Selected Maternal Morbidity Outcomes: A Randomized Controlled Trial
Keurentjes, A., Showalter, A., James, C., Vawter, A., Cross, B. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3621

Manuelle Medizin in der Pädiatrie: ein osteopathischer Ansatz: Auszüge aus dem neuen Buch: Pediatric Manual Medicine: an osteopathic approach
(Pediatric manual medicine: An osteopathic approach)
Carreiro, J. E.
Osteopathische Medizin, 2008/07
3622

Sind Habits, Tics, Bruxismus, Sprechfehler und orofaziale Dyskinesien eine Expression notwendiger kraniosakraler und posturaler Autoregulation des Menschen?: Das Balance-Behandlungskonzept
(Are habits, tics, bruxism, speech disorder and orofacial dyskinesia an expression of necessary craniosacral and postural autoregulation in humans?)
Entrup, W.
Osteopathische Medizin, 2008/07
3623

Behandlung der Enuresis nocturna in der Osteopathie
(Treatment of noctural enuresis in osteopathy)
Liem, T.
Osteopathische Medizin, 2008/07
3624

Osteopathic treatment of patients with chronic non-specific neck pain: a randomised controlled trial of efficacy
Schwerla, F., Bischoff, A., Nurnberger, A., Genter, P., Guillaume, J.P., Resch, K.L.
Forschende Komplementärmedizin, 2008/07
3625

Rediscovering the classic osteopathic literature to advance contemporary patient-oriented research: A new look at diabetes mellitus
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2008/07
3626

AOA is strong advocate for debt relief and primary care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3627

Kindliche Regulationsstörungen: Schrei-, Ess- und Schlafstörungen: Betrachtung der psychosozialen Zusammenhänge im Hinblick auf die osteopathische Behandlung
(Infantile regulatory disorders: Crying, eating and sleep disorders)
Gillemot, B.
Osteopathische Medizin, 2008/07
3628

Inpatient osteopathic structural examinations: is “red tape“ getting in the way of personalized patient care?
Fennig Jr., G. A., Shubrook Jr., J. H.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3629

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3630

Teaching critical thinking in osteopathy – Integrating craft knowledge and evidence-informed approaches
Fryer, G.
International Journal of Osteopathic Medicine, 2008/06/01/
3631

Continuing Professional Development Activity
International Journal of Osteopathic Medicine, 2008/06
3632

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06
3633

An Osteopathic Approach to Visceral Disease: A Case of Recurrent Urinary Tract Infection
Lerma, C., Mesisca, M., Hruby, R. J.
The AAO Journal, 2008/06
Free full text
3634

Educating osteopaths to be researchers - what role should research methods and statistics have in an undergraduate curriculum?
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2008/06
Free full text
3635

“Poiseuille’s Panacea”: a New Direction in Osteopathic Manipulation of the Thorax
McCombs, T. M., Towne, S., Treece, M.
The AAO Journal, 2008/06
Free full text
3636

Place de l’ostéopathie dans la correction des déformations crâniennes du nouveau-né et du jeune enfant
(Cranial osteopathy as a complementary treatment of postural plagiocephaly)
Amiel-Tison, C., Soyez-Papiernik, E.
Archives de Pédiatrie, 2008/06
3637

Solitary fibrous pleural tumor
Jenkins, L. A., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2008/06
Free full text
3638

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text
3639

Osteopathische Medizin und ihre Anpassung an das Älterwerden
(Osteopathic medicine and its adjustment to aging patients)
Hruby, R.
Osteopathische Medizin, 2008/05
3640

Der Befundungsprozess in der Osteopathie
(The diagnostic process in osteopathy)
Abpfolter, M.
Unpublished MSc thesis, 2008/05
3641

Modified Muncie technique: osteopathic manipulation for eustachian tube dysfunction and illustrative report of case
Channell, M. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text
3642

Immediate effects of osteopathic manipulative treatment in elderly patients with chronic obstructive pulmonary disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text
3643

Practice patterns of osteopathic physicians providing end-of-life care: a survey-based study
Mason, D. C., McElrath, S., Penn-Erskine, C., Kramer-Feeley, V., Pomerantz, S. C., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text
3644

Osteopathie in der Pädiatrie, Teil 3: Das Os temporale
(Osteopathy in Pediatrics, Part 3: The Temporal Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
3645

IFAO-Kongress „Bewegungsapparat” - November 2007 in Neuss
(IFAO Congress “Musculoskeletal System“ - November 2007 in Neuss)
Hebgen, E., Nienhaus, L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
3646

A randomized controlled trial of the effectiveness of osteopathy-based manual physical therapy in treating pediatric dysfunctional voiding
Nemett, D. R., Fivush, B. A., Mathews, R., Camirand, N., Eldridge, M. A., Finney, K., Gerson, A. C.
Journal of Pediatric Urology, 2008/04
Free full text
3647

Das komplexe regionale Schmerzsyndrom
(The complex regional pain syndrome)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
3648

Karpaltunnelsyndrom
(Carpal tunnel syndrome)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
3649

A.T. Still would not be proud
Fisher, C. M.
The Journal of the American Osteopathic Association, 2008/04
Free full text
3650

Repercusiones sobre los niveles de glucosa en sangre venosa periférica, tras la manipulación con thrust del segmento vertebral T8T9 en sujetos sanos
(Effects of T8 and T9 vertebras HVT manipulations on glycemic 8 levels in peripheral venous blood in healthy people)
Durá Soler, A. M., Boscá Gandía, J. J.
Osteopatía Científica, 2008/04
3651

Características de los movimientos intervertebrales y los cambios de presión intradiscal durante la manipulación de la columna lumbar: estudio de viabilidad
(Highlighting of intervertebral movements and variations of intradiskal pressure during lumbar spine manipulation: a feasibility study)
Maigne, J.Y., Guillon, F.
Osteopatía Científica, 2008/04
3652

Dolor del miembro superior, disfunción somática y deslizamiento neural
(Arm pain, somatic dysfunction and nerve movement)
Oliva Pascual-Vaca, Á.
Osteopatía Científica, 2008/04
3653

Un caso de pelviespondilitis atípica
(A case of atypical pelvispondylitis)
Ricard, F.
Osteopatía Científica, 2008/04
3654

Técnica semidirecta de thrust para torsión anterior derecha del sacro: TDD
(Indirect thrust manipulation for right anterior torsion of the sacrum on a right oblique axis)
Rodríguez Blanco, C.
Osteopatía Científica, 2008/04
3655

OSTEOPAThic Health outcomes in chronic low back pain: The OSTEOPATHIC Trial
Licciardone, J. C., King, H. H., Hensel, K. L., Williams, D. G.
Osteopathic Medicine and Primary Care, 2008/04
3656

Estimation of instantaneous and cumulative loads on the low back and neck of osteopaths while performing the pre-thrust positioning for a high velocity, low amplitude thrust technique applied to the thoracic spine
Stewart, M. D.
Unpublished MSc thesis, 2008/03
Free full text
3657

Continuing Professional Development Activity
Lucas, N.
International Journal of Osteopathic Medicine, 2008/03
3658

Migraine and OMT
Batchelor, K., Gamber, R.
The AAO Journal, 2008/03
Free full text
3659

Osteopathic Manipulative Treatment in Pregnancy and Augmentation of Labor: A Case Report
Jones, A. L., Lockwood, M. D.
The AAO Journal, 2008/03
Free full text
3660

Autistic Spectrum Disorder
Sorrell, M. A.
The AAO Journal, 2008/03
Free full text
3661

Reliability of physical examination to assess asymmetry of anatomical landmarks indicative of pelvic somatic dysfunction in subjects with and without low back pain
Kmita, A., Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/03
3662

A short questionnaire to identify patient characteristics indicating improved compliance to exercise rehabilitation programs: A pilot investigation
Howard, D. B., Gosling, C. M. R.
International Journal of Osteopathic Medicine, 2008/03
3663

“Even though you’re choking on it, it’s all in your mind” – an osteopathic perspective on Globus Hystericus
Comeaux, Z. J.
The AAO Journal, 2008/03
Free full text
3664

Osteopathy: In Good Hands (and I don’t mean Allstate®): 2007 Northup Lecture
King, H. H.
The AAO Journal, 2008/03
Free full text
3665

Osteopathic manipulative treatment (OMT) effects on mandibular kinetics: kinesiographic study
Monaco, A., Cozzolino, V., Cattaneo, R., Cutilli, T., Spadaro, A.
European Journal of Paediatric Dentistry, 2008/03
Free full text
3666

Clinical inquiries. Is osteopathic manipulation effective for headaches?
Keays, A. C., Neher, J. O., Safranek, S., Webb, C. W.
The Journal of Family Practice, 2008/03
3667

The importance of monitoring patient's ability to achieve functional tasks in those with musculoskeletal pain
Carnes, D., Underwood, M.
International Journal of Osteopathic Medicine, 2008/03
3668

Does osteopathic treatment influence the hormone level of hyperandrogenaemic infertile women?
Heim, S.
Unpublished MSc thesis, 2008/02
Free full text
3669

About the ligaments of the pleural dome
Scheiterbauer, F.
Unpublished MSc thesis, 2008/02
Free full text
3670

The impact of osteopathic treatment on intraocular hypertension – an experimental study
Kuhmann, O.
Unpublished MSc thesis, 2008/02
Free full text
3671

Die osteopathische Dysfunktion der Arterie
(Osteopathic Dysfunction of the Arteries)
Chauffour, P., Prat, E., Michaud, J.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
3672

Touch – Perception – Communication In the Context of Osteopathic Treatment
Schuster, K.
Unpublished MSc thesis, 2008/02
Free full text
3673

Health economic evaluation - An option for osteopathy?
Perndl, M.
Unpublished MSc thesis, 2008/02
Free full text
3674

Effect of osteopathic treatment on premature infants with regulation problems
Rajchl, E.
Unpublished MSc thesis, 2008/02
Free full text
3675

The Phenomenon Spondylolisthesis from an Osteopathic Point of View
Schiener, M.
Unpublished MSc thesis, 2008/02
Free full text
3676

Is there a relation between osteopathic kidney dysfunction and segmental dysfunction of the spinal segments D12 – L2 in patients suffering from renal hypertension?
Mauder, C.
Unpublished MSc thesis, 2008/02
Free full text
3677

Osteopathie in der Pädiatrie, Teil 2: Intraossäre Läsionen des Os occipitale
(Osteopathy in Pediatrics, Part 2: Intraosseus Lesions of the Occipital Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
3678

Growing pains in children- can osteopathy improve the clinical picture?
Kramer, B.
Unpublished MSc thesis, 2008/02
Free full text
3679

Bundesarbeitsgemeinschaft Osteopathie e.V. (BAO)
(Federal Working Group Osteopathy e.V. (BAO))
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
3680

The Integration of Clinical Reasoning in Osteopathy
Fink-Koller, B.
Unpublished MSc thesis, 2008/02
Free full text
3681

Arterienbehandlung bei Bluthochdruck
(Arterial treatment for hypertension)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
3682

Für Durchblutung sorgen - Die Behandlung von Arterien
(Providing blood circulation - The treatment of arteries)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
3683

Behandlung der intramuralen Gefäße der Viszera am Beispiel des Magens
(Treatment of the Intramural Vessels of the Viscera Using the Stomach as an Example)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
3684

Der Rhythmus des Blutflusses
(The Rhythm Of Perfusion)
Wyvekens, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
3685

Revisiting Castlio and Ferris-Swift's experiments on direct splenic stimulation in patients with acute infectious disease
Noll, D. R., Johnson, J. C., Brooks, J. E.
The Journal of the American Osteopathic Association, 2008/02
Free full text
3686

Doctors’ knowledge of osteopathy in the district of Bregenz
Seewald, S.
Unpublished MSc thesis, 2008/02
Free full text
3687

Efficacy of the ‘Still technique’ on dorsiflexion at the talocrural joint in patients with a history of ankle injury
Taylor, N.
Unpublished MSc thesis, 2008/01
Free full text
3688

Slow-Thrust Technik
(Slow thrust technique)
Dräger, K.
Osteopathische Medizin, 2008/01
3689

Female osteopathic medical students: When the minority become the majority
Johnson, K. D.
Unpublished PhD thesis, 2008/01
3690

Palpatory diagnosis training on the virtual haptic back: performance improvement and user evaluations
Howell, J. N., Conatser, R. R., Williams, R. L., Burns, J. M., Eland, D. C.
The Journal of the American Osteopathic Association, 2008/01
Free full text
3691

Attitudes toward pay-for-performance initiatives among primary care osteopathic physicians in small group practices
Locke, R. G., Srinivasan, M.
The Journal of the American Osteopathic Association, 2008/01
Free full text
3692

Osteopathie und Musikermedizin
(Osteopathy in musician's medicine)
Ridder, P.H.
Osteopathische Medizin, 2008/01
3693

Evidence-informed management of chronic low back pain with prolotherapy
Dagenais, S., Mayer, J., Haldeman, S., Borg-Stein, J.
The Spine Journal, 2008/01
3694

Identification, assessment and management of mood disorders in clients by osteopathic practitioners in New Zealand
Sampath, K.
Unpublished MSc thesis, 2008/01
Free full text
3695

Quantifying Structural Changes with the Application of Osteopathic Manual Medicine (OMM) in Tegucigalpa, Honduras
Hardee, A. B.
Unpublished PhD thesis, 2008/01
Free full text
3696

Current legal framework governing manual-therapeutic osteopathic work by physiotherapists in Austria. An analysis from the perspective of self-employed physical therapists
Panovits, V.
Unpublished MSc thesis, 2007/12
Free full text
3697

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text
3698

OMT Homework
Clark, R. C.
The AAO Journal, 2007/12
Free full text
3699

Understanding and Treating Fatigue and Gait Instability in Persons with Multiple Sclerosis: An Osteopathic Approach
Hatter, A., Williams, S.
The AAO Journal, 2007/12
Free full text
3700

Attitudes and Confidence Levels of Second-Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T. A., Fotopoulos, T. J., Best, M. A.
The AAO Journal, 2007/12
Free full text
3701

Osteopathic Manipulative Medicine and Acupuncture Combined: A Retrospective case study to determine if order of treatment makes a difference in outcome for acute mechanical low back pain
Stager, W. H.
The AAO Journal, 2007/12
Free full text
3702

Is it possible to measurably accelerate the healing process in the proliferation phase of a fresh Achilles tendon rupture with functional aftertreatment through osteopathic therapy?
Eilmsteiner, B.
Unpublished MSc thesis, 2007/12
3703

Gibt es bei Patienten mit renaler Hypertonie oder essentieller Hypertonie mit begleitender Nierenschädigung somatische Dysfunktionen
(Do somatic dysfunctions occur in patients with renal or primary hypertension accompanied by kidney damage)
Gögel, F.
Unpublished MSc thesis, 2007/12
Free full text
3704

Psychological response in spinal manipulation (PRISM): a systematic review of psychological outcomes in randomised controlled trials
Williams, N. H., Hendry, M., Lewis, R., Russell, I., Westmoreland, A., Wilkinson, C.
Complementary Therapies in Medicine, 2007/12
Free full text
3705

Osteopathic manipulative treatment for pandemic influenza: many questions, few answers
Sanderlin, B. W., Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2007/12
Free full text
3706

An investigation into the side of joint cavitation associated with cervical spine manipulation
Bolton, A., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/12
3707

Using the concept of ideomotor therapy in the treatment of a patient with chronic neck pain: A single system research design
McCarthy, S., Rickards, L. D., Lucas, N. P.
International Journal of Osteopathic Medicine, 2007/12
3708

Empathy as part of the perception process in osteopathy
Felder, R.
Unpublished MSc thesis, 2007/12
Free full text
3709

Relaxed Vision: A Clinical Study
Fitzinger, S.
Unpublished MSc thesis, 2007/12
Free full text
3710

Relationships between clinical rotation subscores, COMLEX-USA examination results, and school-based performance measures
Cope, M. K., Baker, H. H., Foster, R. W., Boisvert, C. S.
The Journal of the American Osteopathic Association, 2007/11
Free full text
3711

Applying osteopathic principles to formulate treatment for patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2007/11
Free full text
3712

Evolution of osteopathic graduate medical education: integration of osteopathic principles and practice in postdoctoral training
Lemley, W. W., Steele, K. M., Shires, W. E., McMahan, R. M.
The Journal of the American Osteopathic Association, 2007/11
Free full text
3713

Hypermobility and the hypermobility syndrome
Simmonds, J. V., Keer, R. J.
Manual Therapy, 2007/11
Free full text
3714

Using integrative therapies to treat women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2007/11
Free full text
3715

Schmerzsyndrome in der Regio Inguinalis
(Pain syndroms of the inguinal region)
Beck, M.
Osteopathische Medizin, 2007/10
3716

Kann mit osteopathischen Behandlungen eine Einflussnahme auf das Beschwerdebild bei Patienten mit Hyperakusis erreicht werden?
(Can osteopathic treatment influence the symptoms of patients with hyperacusis?)
Burkhardt, D., Schuff, I., Mahler, R.
Unpublished D.O. thesis, 2007/10
3717

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 3
(The craniomandibular system and its effects on the posture - Part III: Etiology, diagnosis and treatment of disorders of the CMS)
Honikel, M.
Osteopathische Medizin, 2007/10
3718

Manuelle Medizin wirkt auf schmerzhemmende Systeme!
(Manual medicine acts on pain inhibitory systems)
Locher, H., Sell, K.
Osteopathische Medizin, 2007/10
3719

Biomechanische Annäherung an die Dysfunktion - Teil 3: Die helikoidale Achse
(Biomechanical approach to dysfunction - Part 3: The helical axis)
Sommerfeld, P., Klein, P.
Osteopathische Medizin, 2007/10
3720

Osteopathische Behandlung von Frauen mit Harninkontinenz nach Verletzung des Perineums unter der Entbindung. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of women suffering from urinary incontinence as a result of an injury to the perineum during delivery. A randomized controlled trial)
Gerhardt, K., Montag, G.
Unpublished D.O. thesis, 2007/10
3721

The influence of an Osteopathic treatment on the performance of a high - performance athlete
Böhmüller, E.
Unpublished MSc thesis, 2007/10
Free full text
3722

Survey, Systematisation and Comparison of Professional, Advanced and Continuing Training Programs for Osteopathy available in Austria in the Winter Term 2006/2007
Wilfling, E.
Unpublished MSc thesis, 2007/10
Free full text
3723

Frühkindliche Hinweise auf Lernstörungen und osteopathische Behandlungsansätze
(Signs of Learning Disorders in Early Childhood and Osteopathic Treatment Approaches)
Bierent-Vass, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
3724

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
3725

Behandlung eines Kindes mit Morbus Hirschsprung
(Treatment of a child with Hirschsprung's disease)
Helsmoortel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
3726

Osteopathische Behandlung von Frauen mit primärer Dysmenorrhoe. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of women with primary dysmenorrhoea. A randomized controlled trial)
Pinter-Haas, A., Schach-Hirte, J., Wirthwein, P.
Unpublished D.O. thesis, 2007/10
3727

Hat die osteopathische Behandlung einen positiven Effekt bei Frauen mit persistierenden Rückenschmerzen post partum? Eine randomisierte kontrollierte Studie
(Study on the effectiveness of osteopathic treatment for women with persistent post partum back pain. A randomized controlled trial)
Recknagel, C., Roß, J.
Unpublished D.O. thesis, 2007/10
3728

Spina bifida
Mückler, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
3729

Osteopathische Begleitung bei frühkindlichen Fehlbildungen
(Osteopathic treatment for infantile malformations)
Mückler, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
3730

Lake Erie College of Osteopathic Medicine's preclinical problem-based learning pathway program: an alternative medical school curriculum design
Ferretti, S. M., Krueger, W. A., Gabel, L. L., Curry, J. J.
The Journal of the American Osteopathic Association, 2007/10
Free full text
3731

Stellt die osteopathische Behandlung von Patienten mit chronischer Zervikalgie eine wirksame Alternative zur Physiotherapie dar? Eine randomisierte kontrollierte Studie
(Osteopathy as an efficient treatment alternative to physical therapy for patients suffering from chronic non specific neck pain? A randomized controlled trial)
Steffen, S., Tempel, R.
Unpublished D.O. thesis, 2007/10
3732

Effektivität der osteopathischen Behandlung bei Patienten mit Patellofemoralen Schmerzsyndrom. Eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with patellofemoral pain syndrome. A randomized controlled trial)
Wendel, J., Rudisch, B., Berger, G.
Unpublished D.O. thesis, 2007/10
3733

Therapist- Patient- Relationship in Osteopathy
Novy, R.
Unpublished MSc thesis, 2007/10
Free full text
3734

Examining the Somatic Dysfunction: Lessons Learned in Practice
Danto, J. B., Danto, D. Z., Burns, A. T.
The AAO Journal, 2007/09
Free full text
3735

Occipital Compression and its Potential Uses in Obstetrics
McAfee, S. N., Chila, A. G.
The AAO Journal, 2007/09
Free full text
3736

The Establishment of a Neuromusculoskeletal-Osteopathic Manipulative Medicine Service in a 700 Allopathic Physician Practice
Richards, T. M.
The AAO Journal, 2007/09
Free full text
3737

A three-year accelerated medical school curriculum designed to encourage and facilitate primary care careers
Bell, H. S., Ferretti, S. M., Ortoski, R. A.
Academic Medicine, 2007/09
3738

Role of osteopathic manipulative treatment in altering pain biomarkers: a pilot study
Degenhardt, B. F., Darmani, N. A., Johnson, J. C., Towns, L. C., Rhodes, D. C., Trinh, C., McClanahan, B., DiMarzo, V.
The Journal of the American Osteopathic Association, 2007/09
Free full text
3739

Treatment of irritable bowel syndrome with osteopathy: results of a randomized controlled pilot study
Hundscheid, H. W., Pepels, M. J., Engels, L. G., Loffeld, R. J.
Journal of Gastroenterology and Hepatology, 2007/09
Free full text
3740

Die Rolle des Ösophagus bei der Entstehung einer Plagiocephalie beim Säugling
(Role of the esophagus in the development of plagiocephaly in infants)
Kaiser, F.
Osteopathische Medizin, 2007/08
3741

Attitudes towards Osteopathic Manipulation in Career Choices (ATOMICC)
Dunbar, B. D., Desai, G. J.
The Journal of the American Osteopathic Association, 2007/08
3742

Abdominal Lymphatic Pump Treatment Increases Leukocyte Count and Flux in Thoracic Duct Lymph
Hodge, L., Bearden, M. K., King, H. H., Williams Jr., A. G., Simecka, J. W., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2007/08
3743

Lymphatic Pump Treatment Enhances Survival and Reduces Pulmonary Bacteria during Experimental Pneumonia Infection
Hodge, L., Bellard, M. D., Bearden, M. K., Simecka, J. W., Stoll, S. T., Downey, H. F., King, H. H.
The Journal of the American Osteopathic Association, 2007/08
3744

Prolonged Effects of Maximal Effort Exercise (with Valsalva) and Osteopathic Manipulative Treatment in Women with Multiple Sclerosis
Kuchera, M. L., Vardy, T., Yates, H., Stouch, B., Johnson, J. C.
The Journal of the American Osteopathic Association, 2007/08
3745

A Pilot Clinical Trial of Osteopathic Manipulative Treatment During Third Trimester Pregnancy
Licciardone, J. C., Buchanan, S., Fulda, K., Hensel, K., King, H. H., Stoll, S. T.
The Journal of the American Osteopathic Association, 2007/08
3746

Foot Ankle Biomechanics: Effects of Manipulative Intervention on Plantar Fasciitis Subjects
Morton, A. L., McGrew, A., Burns, J. M., Karodogan, E., Conatser, R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2007/08
3747

Factors Contributing to Osteopathic Manipulation Usage at Army Family Medicine Residency Programs
Platz, K. E., Asplund, C. A.
The Journal of the American Osteopathic Association, 2007/08
3748

Die Entwicklung der Wirbelsäule (Teil 2)
(The Development of the Spinal Column (Part 2))
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
3749

Emotionale Diagnose und Behandlung nach J.P. Barral
(Diagnosis and Treatment of Emotional Problems according to Barral)
Klein Lossing, M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
3750

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
3751

SEE - Die SomatoEmotionale Entspannung nach Upledger
(SER - SomatoEmotional Release according to Upledger)
Landeweer, G. G., Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
3752

Orthopädie und Psyche nach Verkehrsunfall
(Orthopedics and psyche after traffic accident)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
3753

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
3754

Neuromusculoskeletal Causes of Back Pain in Competitive Figure Skaters
Goldman, S. I., Moyer, M.
The AAO Journal, 2007/06
Free full text
3755

Ehlers Danlos Syndrome: A Case Report
Kumar, A., Stoll, S. T., Hensel, K.
The AAO Journal, 2007/06
Free full text
3756

Alleviating Atypical Tender Points Through the Use of Myofascial Release of Scar Tissue
Thomas, B. P.
The AAO Journal, 2007/06
Free full text
3757

An observational study of motion induced in the lumbar–pelvic complex during ‘harmonic’ technique: A preliminary investigation
Waugh, J. L., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/06
3758

Optimising the psychological benefits of osteopathy
Williams, N. H.
International Journal of Osteopathic Medicine, 2007/06
3759

The effects of high-velocity, low-amplitude manipulation and muscle energy technique on suboccipital tenderness
Hamilton, L., Boswell, C., Fryer, G.
International Journal of Osteopathic Medicine, 2007/06
3760

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 1
(The craniomandibular system (cms). Part 1: The cms and its effects on the body posture)
Honikel, M., Bruderhofer, A.
Osteopathische Medizin, 2007/05
3761

Biomechanische Annäherung an die Dysfunktion - Teil 2
(Biomechanical approach to dysfunction - Part 2: The movement index)
Klein, P., Sommerfeld, P.
Osteopathische Medizin, 2007/05
3762

Eine Einführung in die Harmonischen Techniken
(An introduction to Harmonic Technique)
Lederman, E.
Osteopathische Medizin, 2007/05
3763

Harmonische Techniken - Ausgewählte Beispiele
(Harmonic technique - Selected examples of Eyal Lederman)
Lederman, E.
Osteopathische Medizin, 2007/05
3764

Attitudes to back pain amongst musculoskeletal practitioners: a comparison of professional groups and practice settings using the ABS-mp
Pincus, T., Foster, N. E., Vogel, S., Santos, R., Breen, A., Underwood, M.
Manual Therapy, 2007/05
3765

Die Stille nutzen - Auszug aus der Korrespondenz zwischen Rollin Becker und Anne Wales aus den frühen Siebziger Jahren
(Using the Stillness - Excerpt from the Correspondence between Rollin Becker and Anne Wales from the Early Seventies)
Becker, R. E.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
Free full text
3766

Epicondylitis humeri radialis
(Lateral epicondylitis)
Geldschläger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
3767

Die Motrizität
(Motricity)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
3768

Tennisellbogen: Osteopathie statt Kortison!
(Tennis elbow: Osteopathy instead of cortisone!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
3769

Der verletzte Ellbogen - Überlegungen aus orthopädischer und osteopathischer Sicht
(Elbow Trauma - Considerations from an orthopedic and osteopathic point of view)
Schleusener, R., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
3770

Der Ellbogen
(The elbow)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
3771

Treatment of Primary Raynaud`s Syndrome with Osteopathy
Kalcakosz-Takacs, T.
Unpublished MSc thesis, 2007/03
Free full text
3772

Infantile postural asymmetry and osteopathic treatment: A randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2007/03
Free full text
3773

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text
3774

Unexplained Subfertility and Osteopathic Treatment
Kapper, A.
Unpublished MSc thesis, 2007/03
Free full text
3775

The Immediate Influence of Osteopathic Treatment on the Parametres of Bodyplethysmography in Patients Suffering From Cystic Fibrosis
Neuhaus, S.
Unpublished MSc thesis, 2007/03
Free full text
3776

Klinische Osteopathie Bestandsaufnahme und Stellenwert der klinischen Arbeit in der Osteopathie
(Clinical Osteopathy)
Mayer-Fally, E.
Unpublished MSc thesis, 2007/03
Free full text
3777

Cervicobrachialgia. Efficiency and Effectiveness of Osteopathic Treatment in Comparison with Conventional Ultrasound Therapy
Rumer, H.
Unpublished MSc thesis, 2007/03
Free full text
3778

A Case Study on the Osteopathic Approach to Chronic Low Back Pain and Radiculopathy
Schmied, A.
Unpublished MSc thesis, 2007/03
Free full text
3779

The Influence of Osteopathic Treatment on Postpuncture Complaints
Stephanides, A.
Unpublished MSc thesis, 2007/03
Free full text
3780

Matched-Controlled Pilot-Study: Influence of Osteopathic Treatment (Diagnostic Touch Technique) on Fatigue in a Working Population
Tremel, A.
Unpublished MSc thesis, 2007/03
Free full text
3781

The Effectiveness of Osteopathic Treatment in Perimenopause
Zanon, B.
Unpublished MSc thesis, 2007/03
Free full text
3782

Management of Peptic Ulcer Disease Using Osteopathic Manipulation
Morris, H. D., Dickey, J. L.
The AAO Journal, 2007/03
Free full text
3783

Examination of Refraction in Myopia - An Osteopathic Treatment Approach
Bayer, C.
Unpublished MSc thesis, 2007/03
Free full text
3784

Is it possible to intensify the effect of an osteopathic treatment through automobilisation (in a structural and visceral way), regarding success of treatment and long-term result instancing chronic low back pain patients?
Bilgeri, E.
Unpublished MSc thesis, 2007/03
Free full text
3785

The Influence of Osteopathic Treatment on the Performance of Hobby Runners. A Comparative Study using Osteopathic Treatment to Enhance the Performance of Hobby Runners
Haberl, F.J.
Unpublished MSc thesis, 2007/03
Free full text
3786

Effects of Osteopathic Work to Mother and Child Regarding Foetal Heart Rate, Uterine contractions, Lumbosacral Mobility, and Objective Parameters of Delivery
Hampel, E.
Unpublished MSc thesis, 2007/03
Free full text
3787

Does an osteopathic treatment influence the human voice?
Hempel, G.
Unpublished MSc thesis, 2007/03
Free full text
3788

The Influence of Osteopathy on ADHD
Hubmann, B.
Unpublished MSc thesis, 2007/03
Free full text
3789

Influencing Lung Function by Osteopathy in Idiopathic Parkinson's Syndrome
Rupp, G.
Unpublished MSc thesis, 2007/03
3790

Osteopathy in idiopathic sudden hearing loss
Staffa, U.
Unpublished MSc thesis, 2007/03
Free full text
3791

Comments on “Spinal manipulation in patients with disc herniation: A critical review of risk and benefit”
Brownhill, K.
International Journal of Osteopathic Medicine, 2007/03
3792

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03
3793

Beyond spinal manipulation
McClune, T.
International Journal of Osteopathic Medicine, 2007/03
3794

Physiological effects of a CV4 cranial osteopathic technique on autonomic nervous system function: A preliminary investigation
Milnes, K., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/03
3795

Reply to Comments on “Spinal manipulation in patients with disc herniation: A critical review of risk and benefit”
Snelling, N. J.
International Journal of Osteopathic Medicine, 2007/03
3796

Validity of an electronic pressure algometer
Vaughan, B., McLaughlin, P., Gosling, C.
International Journal of Osteopathic Medicine, 2007/03
3797

The Impact of Osteopathic Treatment on Increased Intraocular Pressure in Primary Chronic Open-Angle Glaucoma
Bilgeri, S.
Unpublished MSc thesis, 2007/03
Free full text
3798

Osteopathic Treatment and Stress Incontinence, in Combination with Biofeedback
Brix, S.
Unpublished MSc thesis, 2007/03
Free full text
3799

Biomechanik - Versuch einer Darstellung
(Biomechanics: Study of a description)
Sommerfeld, P.
Osteopathische Medizin, 2007/02
3800

Mechanical Link. Ein osteopathisches Diagnose- und Behandlungskonzept
(The mechanical link: An osteopathic diagnosis and treatment concept)
Somody-Neplaz, I., Chauffour, P., Prat, E.
Osteopathische Medizin, 2007/02
3801

Osteopathie in Kenia: Ein Projekt von Care Highway International
(Osteopathy in Kenya: A project of Care Highway International)
Soriano, L. C.
Osteopathische Medizin, 2007/02
3802

Does Osteopathy Influence Diabetes Mellitus Type II?
Kiegerl, G.
Unpublished MSc thesis, 2007/01
Free full text
3803

Status post abortus - Usefulness of osteopathic treatment after miscarriage
Krasser, E.
Unpublished MSc thesis, 2007/01
Free full text
3804

A Questionnaire to evaluate the Professional Field of Osteopathy in Austria
Krönke, K.
Unpublished MSc thesis, 2007/01
Free full text
3805

Osteopathic Treatment During Transition of Perimenopause
Mückler, A.
Unpublished MSc thesis, 2007/01
Free full text
3806

Influence of Osteopathic Treatment on Congestive Menstrual Disorders and Premenstrual Syndrome
Riepler-Reisecker, I.
Unpublished MSc thesis, 2007/01
Free full text
3807

Observation Cv4-technique - Hypertension Hypertension - Osteopathic Disfunctions
Schögler, M.
Unpublished MSc thesis, 2007/01
Free full text
3808

The heart - an expanded osteopathic approach
Wagner, G.
Unpublished MSc thesis, 2007/01
Free full text
3809

Das Mediastinum und Intrathorakales Fasziales Release
(The mediastinum and intrathoracal fascial release)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
3810

Die Bewegungen der Viszera: Die Mobilität, Teil 2
(Visceral Movements: Mobility, Part 2)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
3811

Mediastinum
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
3812

Das Mediastinum - der Raum zwischen den Lungenflügeln
(The mediastinum - the space between the lungs)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
3813

Das Herz: Allgemeine osteopathische Überlegungen und spezielle Ansätze in der Kinderosteopathie
(The Heart: General osteopathic reflections and special applications in pediatric osteopathy)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
3814

The significance of osteopathic interventions in the treatment of congenital hip dysplasia (Type IIa/IIb)
Ellmerer, H.
Unpublished MSc thesis, 2007/01
Free full text
3815

Osteopathy and the Breech Presentation after 30 Weeks of Gestation
Georgiades, O.
Unpublished MSc thesis, 2007/01
Free full text
3816

The influence of sitting position on (ventro-) dorsal head translation
Hoffmann, F.
Unpublished MSc thesis, 2007/01
Free full text
3817

Along The Dura Mater in Patients with Multiple Sclerosis
Toth, A.
Unpublished MSc thesis, 2007/01
Free full text
3818

The influence of osteopathic treatment during gestation onto the course of delivery - a comparative study on the frequency of medical intervation during child birth
Ruspeckhofer, M.
Unpublished MSc thesis, 2007/01
Free full text
3819

Teaching “doctoring“: a model curriculum for family medicine
Wilson, M. A., Blondefield, P. J.
The Journal of the American Osteopathic Association, 2007/01
Free full text
3820

A woman with the problem of Infertility receiving osteopathic treatment has an increased chance of becoming pregnant
Kirchmayr, M.
Unpublished MSc thesis, 2007/01
Free full text
3821

Do 3-months-old babies who have been examined osteopathically immediately after birth and / or have been treated osteopathically as a result show different patterns of behaviour considering sleep, crying fits and digestion than 3-months-old babies having had no such treatment
Urbanek, B.
Unpublished MSc thesis, 2007/01
Free full text
3822

Can Vital Capacity be Improved by Osteopathic Treatment of the Mediastinum?
Wieser, R.
Unpublished MSc thesis, 2007/01
Free full text
3823

Osteopathy and Tinnitus
Plamberger, M.
Unpublished MSc thesis, 2007
Free full text
3824

OMT for Post-mastectomy Lymphedema and Rib Pain: Case Report
Bradshaw, D., Snider, K.
The AAO Journal, 2006/12
Free full text
3825

The Use of OMT in Patients with Osteoarthritis: Case Report
Zaidi, T., Williams, S.
The AAO Journal, 2006/12
Free full text
3826

Developing professionalism of osteopathic trainees through mentorship: KCOM's “Societies“ model
Laird, S. D., McNabb, J. E., Coon, S. A.
The Journal of the American Osteopathic Association, 2006/12
Free full text
3827

Do any treatments work for irritable bowel syndrome?
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/12
3828

The effectiveness of non-invasive treatments for active myofascial trigger point pain: A systematic review of the literature
Rickards, L. D.
International Journal of Osteopathic Medicine, 2006/12
3829

Algometer reliability in measuring pain pressure threshold over normal spinal muscles to allow quantification of anti-nociceptive treatment effects
Potter, L., McCarthy, C., Oldham, J.
International Journal of Osteopathic Medicine, 2006/12
3830

Pelvic Pain Due to Placement of the Vaginal Cuff after Hysterectomy: Case Report and Osteopathic Manipulative Approach to Treatment
Pasquarello, G. J.
The AAO Journal, 2006/12
Free full text
3831

Erratum to “Patient perception of practitioner intention in osteopathy in the cranial field – A preliminary investigation” [International Journal of Osteopathic Medicine 2006;9(1):46]
McFarlane, S., Standen, C., Roy, D., McPartland, J. M.
International Journal of Osteopathic Medicine, 2006/12
3832

Non-Operative Management of Spinal Stenosis
Greenman, P. E.
The AAO Journal, 2006/12
Free full text
3833

Craniosacral Therapy: The Effects of Cranial Manipulation on Intracranial Pressure and Cranial Bone Movement
Downey, P. A., Barbano, T., Kapur-Wadhwa, R., Sciote, J. J., Siegel, M. I., Mooney, M. P.
Journal of Orthopaedic & Sports Physical Therapy, 2006/11
Free full text
3834

Studie zur Patientenzufriedenheit mit der osteopathischen Behandlung. Eine Fragebogenaktion der ÖGO
(A study on patient satisfaction with osteopathic treatment)
Weber, K.H., Woisetschläger, G.
Osteopathische Medizin, 2006/10
3835

Kieferorthopädie im Kindes- und Jugendalter. Zahnmedizinische und osteopathische Grundlagen. Basis eines interdisziplinären Dialoges.
(Orthodontics in infancy and adolescence. Dental and osteopathic fundamentals. Basis for an interdisciplinary dialogue)
von Tümpling, U.
Unpublished D.O. thesis, 2006/10
3836

Osteopathische Behandlung von Frauen mit Rückenschmerzen während der Schwangerschaft. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of women with low back pain during pregnancy. A randomized controlled trial)
van der Linde, M., Peters, R.
Unpublished D.O. thesis, 2006/10
3837

Nitric oxide and anandamide in OMT research
Stefano, G. B., Salamon, E. J.
The Journal of the American Osteopathic Association, 2006/10
Free full text
3838

Folgen des intrauterinen Gefängnis: Fußdeformitäten
(Consequences of intrauterine imprisonment: Deformities of the Foot)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
3839

Das Fulkrum - Auszug aus dem Journal of the Osteopathic Cranial Association,Jahrbuch von 1953
(The Fulcrum - Excerpt from the Journal of the Osteopathic Cranial Association,Yearbook of 1953)
Schooley, T. F.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
3840

Können osteopathische Behandlungen die Symptomatik des Kopfschmerzes bzw. des Kopfdrucks bei Patienten mit chronischer Rhinosinusitis (CRS) verbessern? Eine randomisierte kontrollierte Studie
(Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with Chronic Rhino sinusitis (CRS)? A randomized controlled trial)
Roos, S., Steinbauer, U., Amann, P.
Unpublished D.O. thesis, 2006/10
3841

Osteopathic reasoning for the treatment of low back pain
Rennie, P. R.
Manuelle Medizin, 2006/10
3842

Osteopathische Behandlung bei frühkindlichem Innenschielen. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of congenital and infantile esotropia)
Reimann, B., Schiedt, R.
Unpublished D.O. thesis, 2006/10
3843

Mechanisms of change: animal models in osteopathic medical research
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/10
Free full text
3844

Osteopathische Intervention bei Kindern mit sprachassoziierten Wahrnehmungsstörungen
(Can osteopathic treatment improve language associated perception disorders in infants?)
Nollmann, R., Sturhahn, F.
Unpublished D.O. thesis, 2006/10
3845

Osteopathische Behandlung bei gastroösophagealem Reflux. Eine Beobachtungsstudie
(The osteopathic treatment of gastroesophageal reflux disease (GERD) - a observational study)
Nerreter, A., Ruf, S., Höly, B.
Unpublished D.O. thesis, 2006/10
3846

Unspezifische, pseudoradikuläre Schmerzen nach lumbaler Bandscheibenoperation
(Nonspecific, pseudoradicular low back pain after lumbar nucleotomy)
Müller, P.
Unpublished D.O. thesis, 2006/10
3847

Fußschmerzen bei einem Kleinkind
(Foot pain in a young child)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
3848

Aspekte der traditionellen chinesischen Medizin bei der osteopathischen Behandlung des Fußes
(Aspects of traditional Chinese medicine in osteopathic treatment of the foot)
Kaufmann, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
3849

Wie groß ist der Erfolg einer ganzheitlich osteopathischen Behandlung bei einem subakuten (tiefen) lumbalen Rückenschmerz? Eine randomisierte kontrollierte klinische Studie.
(The effectiveness of a holistic osteopathic treatment in subacute low back pain. A randomized controlled trial)
Heinze, G.
Unpublished D.O. thesis, 2006/10
3850

Incidence of iatrogenesis associated with osteopathic manipulative treatment of pediatric patients
Hayes, N. M., Bezilla, T. A.
The Journal of the American Osteopathic Association, 2006/10
Free full text
3851

Bewusstheit für Bewegung - Die minimale Hebeltechnik und das Behandlungskonzept von Laurie Hartman
(Awareness for movement)
Franke, H.
Osteopathische Medizin, 2006/10
3852

Larsen’s Syndrome - A Case Report
Burkett, D., Gamber, R. G.
The AAO Journal, 2006/09
Free full text
3853

A comparison of selected osteopathic treatment and relaxation for tension-type headaches
Anderson, R. E., Seniscal, C.
Headache, 2006/09
3854

Interventions need to be consistent with osteopathic philosophy
Vasquez, A.
The Journal of the American Osteopathic Association, 2006/09
Free full text
3855

Embryological study of the spinal dura and its attachment into the vertebral canal
van Dun, P. L. S., Girardin, M. R. G
International Journal of Osteopathic Medicine, 2006/09
3856

Spinal manipulation in patients with disc herniation: A critical review of risk and benefit
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/09
3857

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text
3858

Infantile colic: A critical appraisal of the literature from an osteopathic perspective
Lim, K. W.
International Journal of Osteopathic Medicine, 2006/09
3859

Stretch reflex and Hoffmann reflex responses to osteopathic manipulative treatment in subjects with Achilles tendinitis
Howell, J. N., Cabell, K. S., Chila, A. G., Eland, D. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text
3860

Palpatory Evidence for Viscero-somatic Influence upon the Musculoskeletal System
Eland, D. C.
The AAO Journal, 2006/09
Free full text
3861

The Effects of Manipulation on Ligaments and Fascia from a Fluids Model Perspective
Crow, W. T.
The AAO Journal, 2006/09
Free full text
3862

Zen-Bewusstsein bei der Lehre der Palpation: Ein osteopathischer Ansatz
(Zen awareness in the teaching of palpation: An osteopathic perspective)
Comeaux, Z.
Osteopathische Medizin, 2006/08
3863

Establishing a case for cause and effect
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text
3864

Attitudes, Knowledge, and Use of Osteopathic Manipulative Treatment by Osteopathic Sports Medicine Physicians: Is OMT Being Used in the Sports Arena?
Clearfield, D.
The Journal of the American Osteopathic Association, 2006/08
3865

The Effects of OMT on Median Nerve Size and Function in Patients with Carpal Tunnel Syndrome
Feathers, T. A., Foley, W. M., Panzone, J., Lyons, J. B., Stewart, P. E., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/08
3866

Effect of OMT on Myofascial Somatic Dysfunction and Objective Parameters of Severity in Patients with Carpal Tunnel Syndrome
Foley, W. M., Kuchera, M. L., Lyons, J. B., Panzone, J., Yahnert, J. L., Stewart, P. E.
The Journal of the American Osteopathic Association, 2006/08
3867

Lymphatic Pump Treatment Increases Leukocyte Numbers in Thoracic Duct Lymph
Hodge, L., Williams Jr., A. G., Belavadi, T. J., Simecka, J. W., Stoll, S. T., Downey, H. F., King, H. H.
The Journal of the American Osteopathic Association, 2006/08
3868

Immediate Effects of Osteopathic Manipulative Treatments on Immune Function in a Healthy Population: A Pilot Study
John, J. T.
The Journal of the American Osteopathic Association, 2006/08
3869

Teaching Osteopathic Manipulative Treatment to Allopathic Family Medicine Residents: The Role of the Community Preceptor
Jorgensen, S., Quinlan, J., Soldo, T.
The Journal of the American Osteopathic Association, 2006/08
3870

Assessing the Effectiveness of OMT Provided by Undergraduate Teaching Fellows as Measured by a Visual Analog Pain Scale
Lerma, C. M., Render, R. M., Sarkaria, J. A., Homertgen, K. D., Hruby, R. J.
The Journal of the American Osteopathic Association, 2006/08
3871

AOA needs to reach out more
Tatum, W. O.
The Journal of the American Osteopathic Association, 2006/08
Free full text
3872

Improving Symptoms, Pain, Functioning, and Strength for Persons with Carpal Tunnel Syndrome
Meyer, P., Stoll, S. T., Cruser, D., White, H. D., Whitesell, R.
The Journal of the American Osteopathic Association, 2006/08
3873

Chronic Obstructive Pulmonary Disease (COPD): Immediate Effects of Osteopathic Manipulative Treatment on Exercise Tolerance and Dyspnea
Pickett, C., Stoll, S. T., Cruser, D., Cipher, D. J.
The Journal of the American Osteopathic Association, 2006/08
3874

Effectiveness of Osteopathic Manipulative Treatment for Parkinson Disease
Snider, T. C., La Croix, C., Nunnley, T., Colwell, S., Jones, L., Wilde, B., Lodge, K., Will, A., Shoup, D., Devine, W., Wechsler, N., Cooper, K., Baker, W. P.
The Journal of the American Osteopathic Association, 2006/08
3875

Osteopathic Manipulative Medicine for Carpal Tunnel Syndrome: Changes in Nerve Conduction
White, H. D., Stoll, S. T., Cruser, D., Whitesell, R., King, H. H.
The Journal of the American Osteopathic Association, 2006/08
3876

Blinding protocols, treatment credibility, and expectancy: methodologic issues in clinical trials of osteopathic manipulative treatment
Licciardone, J. C., Russo, D. P.
The Journal of the American Osteopathic Association, 2006/08
Free full text
3877

Osteopathic treatment of Dysmenorrhoe - possible effects relief of kongestive menstruation pains by osteopathic treatments
Karl-Schindler, H.
Unpublished MSc thesis, 2006/08
Free full text
3878

Funktionelle Technik
(Functional technique)
Johnston, W. L.
Osteopathische Medizin, 2006/08
3879

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08
3880

Funktionelle Technik in der Praxis
(Functional technique in practice)
Franke, H., Schmidt, S.
Osteopathische Medizin, 2006/08
3881

Changes in active mouth opening following a single treatment of latent myofascial trigger points in the masseter muscle involving post-isometric relaxation or strain/counterstrain
Blanco, C. R., de las Penas, C. F., Xumet, J. E., Algaba, C. P., Rabadan, M. F., de la Quintana, M. C.
Journal of Bodywork and Movement Therapies, 2006/07
3882

“Circle turns round“ to “allopathic osteopathy“
Wisnioski, S. W.
The Journal of the American Osteopathic Association, 2006/07
Free full text
3883

Neuropsychiatric symptoms and medical illness in patients with dementia: an exploratory study
Tran, P., Schmidt, K., Gallo, J., Tuppo, E., Scheinthal, S., Chopra, A., Libon, D. J.
The Journal of the American Osteopathic Association, 2006/07
Free full text
3884

Nervus vestibulocochlearis (VIII.)
(Vestibulocochlear nerve)
Toth, A. B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
3885

Benötige ich ein Kunstgelenk?
(Do I need an artificial joint?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
3886

Tracing the decline of OMT in patient care
Richardson, M. E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
3887

Behandlung eines temporomandibulären Problems bessert langfristig Tinnitus-Symptome
(Treatment of a temporomandibular problem improves tinnitus symptoms in the long term)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
3888

Akuter Tinnitus: Selbstheilungskräfte dominieren
(Acute tinnitus: self-healing powers dominate)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
3889

Osteopathische Therapie des chronischen Schwindels: Nutzen offen
(Osteopathic therapy of chronic vertigo: benefit unknown)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
3890

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
3891

Cochrane Library's summary of review on manipulative treatment misleading, cheats readers
Michaud, R. G.
The Journal of the American Osteopathic Association, 2006/07
Free full text
3892

OMT: evidence, research, and practice
McCombs, T. M.
The Journal of the American Osteopathic Association, 2006/07
Free full text
3893

The osteopathic approach in the treatment of asymmetric infant
Kollingbaum-Fabian, S.
Unpublished MSc thesis, 2006/07
Free full text
3894

Post Operative Osteopathic Manipulative Protocol for Delivery by Students in an Allopathic Environment
Clark, R. C., McCombs, T. M.
The AAO Journal, 2006/06
Free full text
3895

Suggestions and questions for osteopathic medical education
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2006/06
Free full text
3896

In a vacuum or in a s(l)ide show: OPP in osteopathic CME programming
Beaman, R. T.
The Journal of the American Osteopathic Association, 2006/06
Free full text
3897

Maintaining competence and leadership in manual medicine
Beal, M. C.
The Journal of the American Osteopathic Association, 2006/06
Free full text
3898

Sciatic Neuritis: A Research Study
Beal, M. C.
The AAO Journal, 2006/06
Free full text
3899

Competence levels in musculoskeletal medicine: comparison of osteopathic and allopathic medical graduates
Stockard, A. R., Allen, T. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text
3900

A profile of middle-aged women who consult a chiropractor or osteopath: findings from a survey of 11,143 Australian women
Sibbritt, D., Adams, J., Young, A. F.
Journal of Manipulative and Physiological Therapeutics, 2006/06
3901

Crohn’s Disease: A Case Report including the most recent Theories and Treatment Principles
Mitchell, D., Dickey, J. L.
The AAO Journal, 2006/06
Free full text
3902

Sacroiliac Mechanics Revisited
Jordan, T. R.
The AAO Journal, 2006/06
Free full text
3903

Manipulation of Adhesive Capsulitis under Anesthesia
Hurrell, J., Speece, A. J., Williams, S. F.
The AAO Journal, 2006/06
Free full text
3904

Front-line osteopathic medicine
Hayes, D. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text
3905

Osteopathic manipulative treatment of a 27-year-old man after anterior cruciate ligament reconstruction
Gugel, M. R., Johnston, W. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text
3906

Factors affecting the intra-examiner and inter-examiner reliability of palpation for supine medial malleoli asymmetry
Fryer, G.
International Journal of Osteopathic Medicine, 2006/06
3907

Osteopathic evaluation and manipulative treatment in reducing the morbidity of otitis media: a pilot study
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text
3908

Manipulative treatment for idiopathic impotence in a 24-year-old water polo player
Crow, W. T.
International Journal of Osteopathic Medicine, 2006/06
3909

Manual therapies
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/05
3910

Relationships between scores on the COMLEX-USA Level 2-Performance Evaluation and selected school-based performance measures
Baker, H. H., Cope, M. K., Adelman, M. D., Schuler, S., Foster, R. W., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2006/05
Free full text
3911

Nonobstetric lacerations of the vagina
Sloin, M. M., Karimian, M., Ilbeigi, P.
The Journal of the American Osteopathic Association, 2006/05
Free full text
3912

Mechanism-of-injury approach to evaluating patients with blast-related polytrauma
Scott, S. G., Belanger, H. G., Vanderploeg, R. D., Massengale, J., Scholten, J.
The Journal of the American Osteopathic Association, 2006/05
Free full text
3913

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05
3914

Immediate effects of osteopathic manipulative treatment on immune function in a healthy population: A pilot study
John, J. T.
Unpublished MSc thesis, 2006/05
3915

Osteopathic manipulative treatment of a 26-year-old woman with Bell's palsy
Lancaster, D. G., Crow, W. T.
The Journal of the American Osteopathic Association, 2006/05
Free full text
3916

Does osteopathic manipulative treatment improve dyspnea and exercise tolerance in subjects with stable chronic obstructive pulmonary disease?
Pickett, C.
Unpublished MSc thesis, 2006/05
3917

The immediate effect of OMT on a COPD population: A pilot study
Som, M.
Unpublished MSc thesis, 2006/05
3918

A preliminary assessment of the impact of cranial osteopathy for the relief of infantile colic
Hayden, C., Mullinger, B.
Complementary Therapies in Clinical Practice, 2006/05
Free full text
3919

Osteopathic manipulative treatment is for all DOs
Cummings, C. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text
3920

Let the beauty of the marketplace benefit healthcare
Bliss, G.
The Journal of the American Osteopathic Association, 2006/04
Free full text
3921

Was die Osteopathie „Golden Girls” zu bieten hat
(What osteopathy has to offer „Golden Girls”)
Tettambel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
3922

Sind strukturelle Veränderungen behandelbar? - Pro und Contra
(Are structural changes treatable? - Pros and cons)
Seider, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
3923

Alles Schrott?
(All scrap?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
3924

Polymyalgia rheumatica
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
3925

Women's reproductive health and neonatal care
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/04
Free full text
3926

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
3927

A systematic review of systematic reviews of spinal manipulation
Ernst, E., Canter, P. H.
Journal of the Royal Society of Medicine, 2006/04
Free full text
3928

Assessment of the measurement tools of dysfunctional breathing
Courtney, R., Cohen, M.
International Journal of Osteopathic Medicine, 2006/03
3929

Factors associated with high-severity disciplinary action by a state medical board: a Texas study of medical license revocation
Cardarelli, R., Licciardone, J. C.
The Journal of the American Osteopathic Association, 2006/03
Free full text
3930

Recurring Limitations in OMT Research
Cardarelli, R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
3931

Gross range of motion in the cervical spine: the effects of osteopathic muscle energy technique in asymptomatic subjects
Burns, D. K., Wells, M. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
3932

Trunk and limb muscle activity during the application of a mobilisation type force to the vertebral column
Blaich, R., Ginn, K., Cathers, I., Lee, M.
International Journal of Osteopathic Medicine, 2006/03
3933

An initial investigation into the possible influence of reactive oxygen species (ROS) in chronic nerve compression injuries and the effects of osteopathic manipulative therapy (OMT)
Andrews, M. A. W.
International Journal of Osteopathic Medicine, 2006/03
3934

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain: A pilot study
Alvizatos, J., Lamaro, J., Fryer, G.
International Journal of Osteopathic Medicine, 2006/03
3935

Multidisciplinary approach to treatment in a 38-year-old female, restrained driver following injuries sustained in a rear-end collision
Rook, J. L., Auburn, A. M.
The AAO Journal, 2006/03
Free full text
3936

Postmastectomy lymphedema: a call for osteopathic medical research
Ota, K. S.
The Journal of the American Osteopathic Association, 2006/03
Free full text
3937

Manipulation in the presence of cervical spinal cord compression: a case series
Murphy, D. R., Hurwitz, E. L., Gregory, A. A.
Journal of Manipulative and Physiological Therapeutics, 2006/03
3938

Reliability of visual assessment for lumbar curves in standing: Does clinical experience matter?
Moran, R. W., Ljubotenski, E.
International Journal of Osteopathic Medicine, 2006/03
3939

Patient perception of practitioner intention in osteopathy in the cranial field – A preliminary investigation
McFarlane, S., Standen, C., Roy, D.
International Journal of Osteopathic Medicine, 2006/03
3940

Intercostal rib release
McCarty, C. L.
The AAO Journal, 2006/03
Free full text
3941

Does osteopathic treatment have an influence on the symptoms of patients with chronic prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial
Marx, S.
International Journal of Osteopathic Medicine, 2006/03
3942

The temporal effect of a high velocity thrust technique to the lumbar spine on cutaneous blood flow in the lower limb, comparing smokers and non-smokers
Howard, J.
International Journal of Osteopathic Medicine, 2006/03
3943

Beyond OMT: time for a new chapter in osteopathic medicine?
Hansen, G. P.
The Journal of the American Osteopathic Association, 2006/03
Free full text
3944

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03
3945

Solving clinical problems osteopathically
Feeko, K. J.
The Journal of the American Osteopathic Association, 2006/03
Free full text
3946

The effect of different rates of application of a rib raising technique on cardiovascular and respiratory measures in asymptomatic individuals
Farthing, R., Gosling, C., Williams, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2006/03
3947

Welcome
Drysdale, I.
International Journal of Osteopathic Medicine, 2006/03
3948

In vitro biophysical strain model for understanding mechanisms of osteopathic manipulative treatment
Dodd, J. G., Good, M. M., Nguyen, T. L., Grigg, A. I., Batia, L. M., Standley, P. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
3949

A myofascial trigger point on the skull: Treatment improves peak flow values in acute asthma patients
Crow, W. T., Kasper, D.
The AAO Journal, 2006/03
Free full text
3950

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text
3951

Matrix-Rhythmus-Therapie und osteopathischer Ansatz
(Matrix rhythm therapy and osteopathic approach)
Randoll, U. G., McCutcheon, R., Hennig, F. F.
Osteopathische Medizin, 2006/02
3952

(Osteopathic treatment of newborns with sucking dysfunction)
Mahdi, S.
Osteopathische Medizin, 2006/02
Free full text
3953

(Various approaches for the treatment of postpartal problems)
Ligner, B.
Osteopathische Medizin, 2006/02
Free full text
3954

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text
3955

Ethische Überlegungen zur Anwendung manipulativer Therapien in Altenpflegeheimen
(Ethical considerations for the use of manipulative therapy in nursing homes for the elderly)
Buckler, D., Strait, B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
3956

The Treatment of the Subacromial Impingement Syndrome of the Shoulder by Ostheopathic Therapy or by Self-training: Results of a prospective randomised study
Anderl, E.
Unpublished MSc thesis, 2006/01
Free full text
3957

Low back pain in pregnancy - do Austrian women know about the osteopathic approach?
Albrecht, M.
Unpublished MSc thesis, 2006/01
Free full text
3958

Hüft-Operation und Demenz
(Hip surgery and dementia)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
3959

Osteopathic Preparation of Birth
Reiter-Horngacher, M.
Unpublished MSc thesis, 2006/01
Free full text
3960

Infantile postural asymmetry and osteopathic treatment: a randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2006/01
Free full text
3961

Osteopathie bei älteren Menschen und der derzeitige Stand der klinischen Forschung
(Osteopathy in the elderly and the current state of clinical research)
Noll, D. R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
3962

A phenomenological single case study of African American medical students in a predominantly White college of osteopathic medicine
Brown, T. A. Sr.
Unpublished PhD thesis, 2006/01
3963

Die osteopathische Versorgung älterer Menschen
(Osteopathic treatment of the elderly)
McGovern, J. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
3964

Treatment of urinary incontinence (stress-incontinence of urine) at a descensus of vagina and bladder
Gabriel, R.
Unpublished MSc thesis, 2006/01
Free full text
3965

Osteopathic manipulative treatment of somatic dysfunction among patients in the family practice clinic setting: a retrospective analysis
Licciardone, J. C., Nelson, K. E., Glonek, T., Sleszynski, S. L., Cruser, des Anges
The Journal of the American Osteopathic Association, 2005/12
Free full text
3966

Use of osteopathic manipulative treatment for iliotibial band friction syndrome
Pedowitz, R. N.
The Journal of the American Osteopathic Association, 2005/12
Free full text
3967

Women in Osteopathy. A Synopsis of the Journals “DO” and “Osteopathic Medicine”
Schmid, A.
Unpublished MSc thesis, 2005/12
Free full text
3968

Revisiting Castlio and Ferris-Swift's experiments testing the effects of splenic pump in normal individuals
Noll, D. R., Johnson, J. C.
International Journal of Osteopathic Medicine, 2005/12
3969

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text
3970

Osteopathic Care of Children: 2005 Scott Memorial Lecture
Steele, K. M.
The AAO Journal, 2005/12
Free full text
3971

Immediate changes in radiographically determined lateral flexion range of motion following a single cervical HVLA manipulation in patients presenting with mechanical neck pain: A case series
Fernández-de-las-Peñas, C., Downey, C., Miangolarra-Page, J. C.
International Journal of Osteopathic Medicine, 2005/12
3972

To what should we attribute the effects of OMT?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/12
3973

The effect of training on the inter-examiner and intra-examiner reliability of the seated flexion test and assessment of pelvic anatomical landmarks with palpation
Fryer, G., McPherson, H. C., O'Keefe, P.
International Journal of Osteopathic Medicine, 2005/12
3974

American Osteopathic Association adopts policies on treatment of patients in pain: an overview
D'Alonzo, G. E., Jr., Stipp
The Journal of the American Osteopathic Association, 2005/11
Free full text
3975

The coming influenza pandemic: lessons from the past for the future
Patterson, M. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text
3976

American Osteopathic Association's policy statement on end-of-life care
Issues, Council on Palliative Care
The Journal of the American Osteopathic Association, 2005/11
Free full text
3977

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text
3978

Osteopathic manipulative treatment out of a horse and buggy
Tessien, R. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text
3979

Allopathic family medicine residents can learn osteopathic manipulation techniques in a 1-month elective
Leiber, J. D.
Family Medicine, 2005/11
Free full text
3980

Haben osteopathische Behandlungen einen Effekt bei Patienten mit Gonarthrose im Vergleich zu physikalischer und medikamentöser Therapie? Eine randomisierte kontrollierte Studie
(How effective are osteopathic treatments to patients with gonarthritis in comparison to the two most current forms of treatment namely physiotherapy and medication. A randomized controlled trial)
Auracher, M.
Unpublished D.O. thesis, 2005/10
3981

Manual techniques addressing the lymphatic system: origins and development
Chikly, B. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
3982

(The Effectiveness of Muscle Energy Technique (MET). A systematic review)
Bergold-Meier, S., Franke, H.
Unpublished D.O. thesis, 2005/10
3983

Systematic review of effects of manual therapy in infants with kinetic imbalance due to suboccipital strain (KISS) syndrome
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Journal of Manual and Manipulative Therapy, 2005/10
3984

Interobserver reliability of osteopathic palpatory diagnostic tests of the lumbar spine: improvements from consensus training
Degenhardt, B. F., Snider, K. T., Snider, E. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2005/10
Free full text
3985

Cost-effective osteopathic manipulative medicine: a literature review of cost-effectiveness analyses for osteopathic manipulative treatment
Gamber, R., Holland, S., Russo, D. P., Cruser d, A., Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2005/10
Free full text
3986

Increased lymphatic flow in the thoracic duct during manipulative intervention
Knott, E. M., Tune, J. D., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2005/10
Free full text
3987

Mobilität der Niere: Überprüfung eines osteopathischen Tests mittels Ultraschall
(Mobility of the Kidney: Evaluation of an osteopathic test with sonography)
Dillinger, W., Wülfing, M.
Unpublished D.O. thesis, 2005/10
3988

Osteopathische Behandlung bei Patienten mit sekundären Lymphödemen zusätzlich zur Standardtherapie. Eine Pilotstudie.
(Osteopathic treatment of patients with secondary Lymphedema in addition to standard therapy)
Dufner, B., Lacina, H.P., Lottermoser, B.
Unpublished D.O. thesis, 2005/10
3989

Hemodynamic effects of osteopathic manipulative treatment immediately after coronary artery bypass graft surgery
Olivencia-Yurvati, A. H., Carnes, M. S., Clearfield, M. B., Stoll, S. T., McConathy, W. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
3990

Osteopathische versus orthopädische Behandlung der chronischen Epicondylopathia humeri radialis: Eine randomisiert kontrollierte Untersuchung
(Osteopathic versus Orthopedic Interventions for Chronic Epicondylopathia humeri radialis: A randomized controlled trial)
Geldschläger, S.
Unpublished D.O. thesis, 2005/10
3991

Haben osteopathische Techniken der Nieren und deren Umgebung einen Einfluss auf den Blutdruck bei Patienten mit renaler Hypertonie oder essentieller Hypertonie mit begleitender Nierenschädigung? Eine Pilotstudie.
(Does osteopathic treatment of the kidneys and the surrounding tissue have an effect on blood pressure in patients with renal hypertension or essential hypertension with concomitant renal impairment? A pilot study)
Gögel, F., Mauder, C.
Unpublished D.O. thesis, 2005/10
3992

Effektivität der osteopathischen Behandlung von Patienten mit chronischer Achilles-Tendinopathie. Eine randomisierte kontrollierte Studie
(Can osteopathic treatments effectively influence symptoms of patients with chronic achillotendinitis? A randomized controlled trial)
Hölscher, M., Notarius, R.
Unpublished D.O. thesis, 2005/10
3993

Haben osteopathische Behandlungen einen Einfluss auf die Symptome bei Patienten mit chronischer abakterieller Prostatitis/chronischem Beckenschmerzsyndrom ? Eine randomisierte kontrollierte Studie
(Does an osteopathic treatment have an influence on the symptoms of patients with a chronic abacterial prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial)
Marx, S.
Unpublished D.O. thesis, 2005/10
3994

Wirksamkeit osteopathischer Behandlungen bei kongenitalem Torticollis im Säuglingsalter. Eine randomisierte kontrollierte Interventionsstudie
(Have osteopathic treatments a positive affect on the extent of the pathology of a congenital, muscular torticollis on infants? A randomized controlled trial)
Niggemeier, H., Wilke, H.
Unpublished D.O. thesis, 2005/10
3995

Die therapeutische Wirksamkeit osteopathischer Behandlungen bei Säuglingen und Kindern mit Atopic Dermatitis. Eine randomisierte, kontrollierte Studie.
(The therapeutic effectiveness of osteopathic treatments of babies and children with atopic dermatitis. A randomized controlled trial)
Özbay, I., Reckwerth, M.
Unpublished D.O. thesis, 2005/10
3996

Der Einfluss der osteopathischen Behandlung beim chronischen Vertigo – eine randomisierte kontrollierte Studie
(The Influence of Osteopathic Treatment at chronic Vertigo. A randomized controlled trial)
Recknagel, A., Koop, C.
Unpublished D.O. thesis, 2005/10
3997

Andrew Taylor Still-Techniken
(Andrew Taylor Still techniques)
Bachand, P.
Osteopathische Medizin, 2005/10
3998

Muskel Energie Techniken - Three visions - Ein Workshop
(Muscle energy techniques - Three visions - A workshop)
Beck, M., Unverricht, R.
Osteopathische Medizin, 2005/10
3999

Osteopathie bei somatoformen autonomen Funktionsstörung des Herz- und Kreislaufsystems. Eine kontrollierte klinische Studie.
(Osteopathic treatment of somatoform autonomic dysfunction of the cardiovascular system)
Sauerburger, S., Zorgman, M.
Unpublished D.O. thesis, 2005/10
4000

Prospektive Studie zu den Nebenwirkungen nach osteopathischer Behandlung an der European School of Osteopathy
(A prospective study on the side-effects following osteopathic treatment at the European School of Osteopathy)
Fossum, C., Mullinger, B., Rajendran, D.
Osteopathische Medizin, 2005/10
4001

Geschichte, Modell und Wirksamkeit der MuskelEnergieTechnik: Teil 3: Wirksamkeit der MET - Eine systematische übersichtsarbeit
(History, model and effectiveness of MuscleEnergyTechnique. Part 3: The effectiveness of MET - A systematic review)
Franke, H.
Osteopathische Medizin, 2005/10
4002

Akkomodationsfähigkeit der Augen und ihre Beeinflussung durch osteopathische Behandlung bei Presbyopie – eine randomisierte kontrollierte Studie
(Accommodative ability of the eyes and its impact by a series of osteopathic treatments in presbyopia. A randomized controlled trial)
Stelzer, F.
Unpublished D.O. thesis, 2005/10
4003

Osteopathische Behandlung von Patienten mit chronischem Asthma bronchiale – eine kontrollierte klinische Pilotstudie
(Osteopathic treatment of patients with chronic bronchial asthma. A controlled clinical pilotstudy)
Zielinski, J.
Unpublished D.O. thesis, 2005/10
4004

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4005

Der fasziale Test und die Behandlung der Articulatio coxae
(The fascial test and treatment of the articulatio coxae)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4006

Bewegungsabhängige Schmerzen über dem Hüftgelenk
(Movement-dependent pain above the hip joint)
Profanter, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4007

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4008

Das Hüftgelenk
(The hip joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4009

Der Einfluss der osteopathischen Behandlung auf Blasenentleerungsstörungen bei Frauen. Eine kontrollierte klinische Studie
(The influence of osteopathic treatment on voiding dysfunction of female patients)
Alberts, B., Eckmann, K., Mertens, B.
Unpublished D.O. thesis, 2005/10
4010

Pelvic postural asymmetry revisited
Davidson, S. M., Juhl, J. H.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4011

Headache pain
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4012

Osteopathie als Chance bei Kindern mit ADS/ADHS
“Osteopathy as an opportunity for children with ADD/ADHD“
Bierent-Vass, A.
Osteopathische Medizin, 2005/09
4013

Management of neuropathic pain
Galluzzi, K. E.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4014

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4015

Management of osteoarthritic knee pain
Rubin, B. R.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4016

An osteopathic approach to treating women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4017

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4018

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text
4019

Lower Extremity Edema: A Case Report
DeLaughter, J. P., Gamber, R. G.
The AAO Journal, 2005/09
Free full text
4020

Osteopathie als Chance für Kinder mit ADS/ADHS?
(Osteopathy as an opportunity for children with ADD/ADHD?)
Bierent-Vass, A.
Osteopathische Medizin, 2005/09
4021

Somatische Dysfunktion - Reflektion über die Anwendung des Begriffs in der osteopathischen Praxis
(Somatic dysfunction - Reflection on the use of the term in osteopathic practice)
Comeaux, Z.
Osteopathische Medizin, 2005/09
4022

Muscle energy technique: Geschichte, Modell und Wirksamkeit, Teil 2 - Das Modell
(Muscle energy technique. History, model and effectiveness, part 2 - The model)
Franke, H.
Osteopathische Medizin, 2005/09
4023

Effectiveness of cervical spine manipulation and prescribed exercise in reduction of cervicogenic headache pain and frequency: A single case study experimental design
Eldridge, L., Russell, J.
International Journal of Osteopathic Medicine, 2005/09
4024

The active knee extension test and Slump test in subjects with perceived hamstring tightness
Kuilart, K. E., Woollam, M., Barling, E., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09
4025

Osteopathy in the cranial field – moving towards evidence for causality and effectiveness
Moran, R. W.
International Journal of Osteopathic Medicine, 2005/09
4026

Osteopathic manipulative treatment for low back pain: a systematic review and meta-analysis of randomized controlled trials
Licciardone, J. C., Brimhall, A. K., King, L. N.
BMC Musculoskeletal Disorders, 2005/08
Free full text
4027

A Pilot Clinical Trial of Osteopathic Manipulative Treatment in Pregnancy
Licciardone, J. C., Buchanan, S., Pim, K. H., Cruser, D., Stoll, S. T.
The Journal of the American Osteopathic Association, 2005/07
4028

Intraocular Pressure Correlated with Osteopathic Manipulative Treatment
Nye, Z. B., Nye, D. M., Multack, R. F., Glonek, T.
The Journal of the American Osteopathic Association, 2005/07
4029

The Impact of OMM on the Management of Tension Cephalgia
Patel, A. M., Desai, G. J.
The Journal of the American Osteopathic Association, 2005/07
4030

Osteopathische Narbenbehandlung
(Osteopathic cicatrice treatment)
Mayer, J.
Osteopathische Medizin, 2005/07
4031

The Impact of Osteopathic Manipulative Treatment on Future Osteopathic Physicians
Williams, J., Howell, J. P.
The Journal of the American Osteopathic Association, 2005/07
4032

Das stomatognathe System aus osteopathischer Sicht
(The Stomatognathic System from an Osteopathic Aspect)
Amigues, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4033

Zusammenarbeit von Zahnarzt und Osteopath bei Kiefergelenksbeschwerden
(Collaboration between dentist and osteopath for temporomandibular joint disorders)
Fiedler, S.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4034

Störungen in der Entwicklung des kindlichen Kiefers
(Developmental Disorders of the Jaw in Children)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4035

Osteopathie bei Kindern mit Asthma
(Osteopathy in children with asthma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4036

Das Kiefergelenk
(The temporomandibular joint)
Terhorst, L., Sundermann, W.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4037

Preoperative intravenous morphine sulfate with postoperative osteopathic manipulative treatment reduces patient analgesic use after total abdominal hysterectomy
Goldstein, F. J., Jeck, S., Nicholas, A. S., Berman, M. J., Lerario, M.
The Journal of the American Osteopathic Association, 2005/06
Free full text
4038

Cannabimimetic effects of osteopathic manipulative treatment
McPartland, J. M., Giuffrida, A., King, J., Skinner, E., Scotter, J., Musty, R. E.
The Journal of the American Osteopathic Association, 2005/06
Free full text
4039

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text
4040

American Academy of Osteopathy® Consensus Statement for Osteopathic Manipulation of Somatic Dysfunction under Anesthesia and Conscious Sedation
Governors, AAO Board of
The AAO Journal, 2005/06
Free full text
4041

Be Careful with this Kind of Case!
MacDonald, R. C.
The AAO Journal, 2005/06
Free full text
4042

Abreactions in Ligamentous Articular Strain
McMurrey, L., Williams, S. F.
The AAO Journal, 2005/06
Free full text
4043

The UK BEAM trial – a review and discussion
Vogel, S., Dear, J., Evans, D. W.
International Journal of Osteopathic Medicine, 2005/06
4044

Dissection of the thoracic paraspinal region – implications for osteopathic palpatory diagnosis: A case study
Fryer, G., Johnson, J.
International Journal of Osteopathic Medicine, 2005/06
4045

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain: A pilot study
Fryer, G., Alvizatos, J., Lamaro, J.
International Journal of Osteopathic Medicine, 2005/06
4046

IM ketorolac versus OMT: was agent at peak analgesic effect in JAOA study?
Coston, J. L., McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
4047

Sources of bias in reviews of spinal manipulation for back pain
Canter, P. H., Ernst, E.
Wiener Klinische Wochenschrift, 2005/05
4048

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
4049

Systematisch literatuuronderzoek naar de effecten van behandeling bij zuigelingen met 'kopgewrichteninvloed bij storingen in de symmetrie' ('KISS-syndroom').
Renckens, C. N.
Nederlands Tijdschrift Voor Geneeskunde, 2005/05
4050

(Systematic review of the effects of therapy in infants with the KISS-syndrome (kinetic imbalance due to suboccipital strain))
Systematisch literatuuronderzoek naar de effecten van behandeling bij zuigelingen met 'kopgewrichteninvloed bij storingen in de symmetrie' ('KISS-syndroom').
Saedt, E., van der Woude, B., Theunissen, P.
Nederlands Tijdschrift Voor Geneeskunde, 2005/05
4051

Facilitated oscillatory release - a dynamic method of neuromuscular and ligamentous/articular assessment and treatment
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/04
4052

Systematisch literatuuronderzoek naar de effecten van behandeling bij zuigelingen met 'kopgewrichteninvloed bij storingen in de symmetrie' ('KISS-syndroom')
(Systematic review of the effects of therapy in infants with the KISS-syndrome (kinetic imbalance due to suboccipital strain))
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Nederlands Tijdschrift voor Geneeskunde, 2005/04
Free full text
4053

Outpatient Osteopathic SOAP Note Form: preliminary results in osteopathic outcomes-based research
Sleszynski, S. L., Glonek, T.
The Journal of the American Osteopathic Association, 2005/04
Free full text
4054

Das okulo-vestibulo-zervikale Funktionsmodell in der osteopathischen Praxis
(The oculo-vestibulo-cervico function model in the osteopathic practice)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4055

Osteopathische Therapie bei Glaukom
(Osteopathic Therapy of Glaucoma)
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4056

Nystagmus
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4057

Der Einfluss der osteopathischen Behandlung auf die Verkrümmung der Cornea
(The influence of osteopathic treatment on corneal curvature)
Haase, A.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4058

Tränenkanalstenose und andere Augenbeschwerden bei Kindern
(Lacrimal duct stenosis and other eye disorders in children)
Heinisch, M., Oberhuber, H.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4059

Osteopathie gegen Schielen
(Osteopathy for strabismus)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4060

Osteopathische Pilotstudie zum Offenwinkelglaukom
(Osteopathic pilot study on open-angle glaucoma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4061

Okulomotorik. Was bewegt das Auge?
(Oculomotorics: What makes the eye move?)
Storr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4062

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4063

Kudos on electronic-only COMLEX-USA
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4064

Pain management in end-of-life care
Leleszi, J. P., Lewandowski, J. G.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4065

Still keeping the faith
Rubinstein, L.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4066

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament: part 2. Effect of sex differences and manipulative “priming“
Sucher, B. M., Hinrichs, R. N., Welcher, R. L., Quiroz, L. D., St Laurent, B. F., Morrison, B. J.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4067

The Case of a Patient with Persistent Urinary Urgency
Clark, R. C.
The AAO Journal, 2005/03
Free full text
4068

Survey of osteopathic and allopathic residents' attitudes toward osteopathic manipulative treatment
Allee, B. A., Pollak, M. H., Malnar, K. F.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4069

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03
4070

Where Do We Go From Here? 2004 Thomas L. Northup Lecture
Glover, J. C.
The AAO Journal, 2005/03
Free full text
4071

Medical Coverage for the American Team at the World 24-hour Championship Race in Brno Czech Republic
Lovy, A.
The AAO Journal, 2005/03
Free full text
4072

Acute Intermittent Porphyria Mimic of Guillain-Barré Syndrome: A Case Report with the Use of Osteopathic Manipulation for Management of Pain
McClennen, E. R., Gamber, R.
The AAO Journal, 2005/03
Free full text
4073

Rolfing und Osteopathie: Form und Funktion aus der Sicht des Rolfing
(Rolfing and osteopathy: Form and function from the viewpoint of rolfing)
Flury, H.
Osteopathische Medizin, 2005/03
4074

Qualität in der Osteopathiepraxis
(Quality in osteopathy practice)
Hafen, F.
Osteopathische Medizin, 2005/03
4075

Palpation und Forschung
(Palpation and research in osteopathy)
Muzzi, D.
Osteopathische Medizin, 2005/03
4076

Wie ein Osteopath die Rolfingmethode sieht
(How an osteopath looks upon the rolfing method)
Proby, J.
Osteopathische Medizin, 2005/03
4077

The effect of osteopathy in the treatment of chronic low back pain – a feasibility study
Kirk, L., Underwood, M., Chappell, L., Martins-Mendez, M., Thomas, P.
International Journal of Osteopathic Medicine, 2005/03
4078

Intramuscular ketorolac versus osteopathic manipulative treatment in the management of acute neck pain in the emergency department: a randomized clinical trial
McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/02
Free full text
4079

Hysteresis as a measure of ankle dysfunction
Cohen, A. M., Mertz, J., Stewart, P., Warner, M. J., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/01
Free full text
4080

The effect of manual therapy and a home exercise program on cervicogenic headaches: A case report
Hanten, W. P., Olson, S. L., Lindsay, W. A., Lounsberry, K. A., Stewart, J. K.
Journal of Manual and Manipulative Therapy, 2005/01
4081

Chronic low back pain: osteopaths' attitudes and management
Griffiths, L.
Unpublished MSc thesis, 2005/01
Free full text
4082

Integrating Osteopathic terminology into SNOMED CT
Nash, S.
AMIA - Annual Symposium Proceedings, 2005/01
Free full text
4083

Melburnian women's use of osteopathy as therapy for low back pain and posterior pelvic pain during pregnancy
Burns, C.
Unpublished MSc thesis, 2005/01
Free full text
4084

The effect of mobilisation on pressure pain thresholds in the lumbar spine
Medle, M.
Unpublished MSc thesis, 2005/01
Free full text
4085

The effect of balancing ligamentous tension (an indirect technique) on range of motion at the ankle
Ricketts, S.
Unpublished MSc thesis, 2005/01
Free full text
4086

A study into osteopathic treatment of pregnant women in NSW and Queensland
Smith, S.
Unpublished MSc thesis, 2005/01
Free full text
4087

Sexual harassment of male osteopaths in the workplace: evidence and effect
Stone, M.
Unpublished MSc thesis, 2005/01
Free full text
4088

Die Wirbelsäule
(The Spine)
Fuhrmann, M., Kühn, J.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
4089

An observational study of student osteopaths' measurement of arterial blood pressure by sphygmomanometry and auscultation
Tye-Smith, A.
Unpublished MSc thesis, 2005/01
Free full text
4090

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
4091

Subakuter Rückenschmerz: Osteopathie als nützliche und kosteneffektive Ergänzung der Routinebehandlung
(Subacute spinal pain: Osteopathy as a useful and cost effecticve add-on to usual care)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
4092

Effects of osteopathic manipulative treatment on pediatric patients with asthma: a randomized controlled trial
Guiney, P. A., Chou, R., Vianna, A., Lovenheim, J.
The Journal of the American Osteopathic Association, 2005/01
Free full text
4093

Spondylodiszitis
(Spondylodiscitis)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
4094

Cognitive bias in back pain patients attending osteopathy: testing the enmeshment model in reference to future thinking
Read, J., Pincus, T.
European Journal of Pain, 2004/12
4095

Lessons learned in bioterrorism can be applied to medical practice
McFee, R. B.
The Journal of the American Osteopathic Association, 2004/12
Free full text
4096

Don’t Raise Your Hand – Put it on the Patient
Dowling, D. J.
The AAO Journal, 2004/12
Free full text
4097

A Case Study of Left Adhesive Capsulitis Presumably Resulting from Previous Treatment with Protease Inhibitors
Lipton, J. A., Neil, M.
The AAO Journal, 2004/12
Free full text
4098

Case Study: An Osteopathic Resolution of a Neurocardiogenic Syncope
Somoano, Y., Hagopian, S.
The AAO Journal, 2004/12
Free full text
4099

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text
4100

Cost-utility analysis of osteopathy in primary care: results from a pragmatic randomized controlled trial
Williams, N. H., Edwards, R. T., Linck, P., Muntz, R., Hibbs, R., Wilkinson, C., Russell, I., Russell, D., Hounsome, B.
Family Practice, 2004/12
Free full text
4101

Blagrave-Technik zur Halswirbelsäulenbehandlung
(The Blagrave procedure for the treatment of the cervical spine)
Blagrave, P.
Osteopathische Medizin, 2004/11
4102

Die sensomotorische Entwicklung des Kindes
(The sensomotoric development of the child)
Darraillans, B.
Osteopathische Medizin, 2004/11
4103

Gibt es eine kranielle Osteopathie?
(Is there such a thing as cranial osteopathy?)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4104

F. X. Mayr-Diagnostik -Therapie und Osteopathie
(F.X. Mayr diagnosis and therapy and osteopathy)
Wilde, W.
Osteopathische Medizin, 2004/11
4105

Osteopathie in der kraniellen Sphäre
(Osteopathy in the cranial sphere)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4106

Geburtstraumatisch bedingtes Zephalhämatom
(Birth trauma-related cephalohematoma)
Fuhrmann, M., Münster, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4107

Osteopathischer Dachverband endlich gegründet
(Osteopathic umbrella organization finally founded)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4108

The unique role of osteopathic physicians in treating patients with low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/11
Free full text
4109

Intraossäre Läsion des Sphenoids und Os temporale - Ansichten und Vorgehen von Viola Frymann
(Intraosseus lesion of the sphenoid and temporalis. Views and Procedures from Viola Frymann)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4110

The relation between thoracic paraspinal tissues and pressure sensitivity measured by a digital algometer
Fryer, G., Gibbons, P., Morris, T.
Journal of Osteopathic Medicine, 2004/10
4111

Kann die Osteopathie einen spezifischen Beitrag in der Behandlung von Kindern mit Aufmerksamkeitsstörungen ohne Hyperaktivität und mit Hyperaktivität – ADS/ADHS leisten? Eine randomisierte kontrollierte Studie
(Osteopathic treatment of children with attention deficit disorders, with or without hyperactivity (ADD/ADHD) - is there any effect? A randomized controlled trial)
Bierent-Vass, A., Lang, J., Neumann, N.
Unpublished D.O. thesis, 2004/10
4112

Kann eine osteopathische Behandlung die Dyspareunie beeinflussen?
(Can patients, suffering from Dyspareunia, expect improvement from an osteopathic treatment? A controlled and prospective trial)
Hoffmann, A., Band, I.
Unpublished D.O. thesis, 2004/10
4113

Osteopathische Behandlungen bei intramuralen Uterusmyomen – eine randomisierte klinische Studie
Osteopathic treatment for uterine leiomyomas: a randomized controlled clinical trial
Kaschowitz, G., Besse, J.P., Schwering, G.
Unpublished D.O. thesis, 2004/10
4114

Die osteopathische Behandlung von Patienten mit Coxarthrose
(The osteopathic treatment of patients with coxarthritis)
Kießling, G., Trantenroth, M.
Unpublished D.O. thesis, 2004/10
4115

Schädelformauffälligkeiten bei Säuglingen – Bestandsauf-nahme aus der Literatur und Entwicklung einer Messmethode
(Skull shape abnormalities in infants - review from the literature and development of a measurement method.)
Kleemann, E.
Unpublished D.O. thesis, 2004/10
4116

The elephant in the room: does OMT have proved benefit?
Bledsoe, B. E.
The Journal of the American Osteopathic Association, 2004/10
Free full text
4117

Eine anatomische Studie zur Frage nach der Existenz von vertebropericardialen Ligamenten
(An anatomical study on the question of the existence of vertebropericardial ligaments.)
Seidler, J.
Unpublished D.O. thesis, 2004/10
4118

More about the use of OMT during influenza epidemics
Magoun, H. I.
The Journal of the American Osteopathic Association, 2004/10
Free full text
4119

An introduction to the use of outcomes questionnaires in osteopathic practice
Vaughan, B., DiVenuto, G.
Journal of Osteopathic Medicine, 2004/10
4120

Effectiveness and efficiency of a primary care based osteopathy clinic for spinal pain
Williams, N. H.
Unpublished PhD thesis, 2004/10
Free full text
4121

The influence of contraction duration in muscle energy technique applied to the atlanto-axial joint
Fryer, G., Ruszkowski, W.
Journal of Osteopathic Medicine, 2004/10
4122

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09
4123

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09
4124

Influenza epidemic or pandemic? Time to roll up sleeves, vaccinate patients, and hone osteopathic manipulative skills
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/09
Free full text
4125

Chronic Fatigue Syndrome: The Misunderstood Disease
Gregg, T., Williams, S. F.
The AAO Journal, 2004/09
Free full text
4126

The Effect of Osteopathic Manipulative Treatment on Gait Disturbance in Multiple Sclerosis Patients
Mann, J. M., Steele, K. M.
The AAO Journal, 2004/09
Free full text
4127

Lymphatic Manipulative Pump Research: A Brief Review of Literature
McMillan, S., Crow, W. T., Greene, C. H.
The AAO Journal, 2004/09
Free full text
4128

Cranial Manipulation Induces Sequential Changes in Blood Flow Velocity on Demand
Nelson, K. E., Sergueef, N., Glonek, T.
The AAO Journal, 2004/09
Free full text
4129

Chronic Pelvic Pain Syndrome
Rossi, P. J., Dickey, J. L.
The AAO Journal, 2004/09
Free full text
4130

A review of King HH and Lay EM, “Osteopathy in the Cranial Field,“ in Foundations for Osteopathic Medicine, 2nd ed
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2004/09
4131

Initial Investigation Into The Effect of Nerve Compression Syndrome on Slow-Twitch Muscle, and Treatment With Osteopathic Manipulative Therapy (OMT)
Andrews, M. A. W.
Journal of Osteopathic Medicine, 2004/08
4132

Investigating the Effect of OMT on Circulatory Biochemical Markers
Degenhardt, B. F., Darmani, N., Towns, L., Rhodes, D. C. J., Trinh, C., Johnson, J. C.
The Journal of the American Osteopathic Association, 2004/08
4133

The Impact of Osteopathic Manipulative Treatment by Doctors Osteopathic Medicine on the Management of Low Back Pain in Physicians' Offices
Desai, G. J., Kolo, G., Sun, C.
The Journal of the American Osteopathic Association, 2004/08
4134

Kurzinterview: Silvio Castagna
(A short interview with Silvio Castagna)
Schmidt, S., Castagna, S.
Osteopathische Medizin, 2004/08
4135

Lymphatic Pump Treatment Increase Thoracic Duct Flow
Knott, M., Tune, J. D., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2004/08
4136

Wirksamkeit der Manipulation bei der Behandlung von Lumbago: Die Gültigkeit der Schlussfolgerungen bei Metaanalysen
(Effectiveness of manipulation in the treatment of low back pain: Validity of the conclusions in metaanalyses)
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Osteopathische Medizin, 2004/08
4137

Stellungnahme der DGOM e.V.
(Statement of the German Society of Ostheopathic Medicine (DGOM))
Graf-Baumann, T.
Osteopathische Medizin, 2004/08
4138

Osteopathie- ein viel versprechender Ansatz zur Verbesserung der Lebensqualität bei Panikattacken
(Osteopathy - A very promising approach to improve the quality of life in persons suffering from panic attacks)
Michaud, C.
Osteopathische Medizin, 2004/08
4139

Effects of Osteopathic Manipulative Treatment on Symptom Severity and Functional Status in Carpal Tunnel Syndrome
Meyer, P. M., Stoll, S. T., Cruser, D., White, H. D., Whitesell, R., Angel, L.
The Journal of the American Osteopathic Association, 2004/08
4140

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text
4141

Treatment Credibility in Osteopathic Manipulative Treatment Research
Russo, D. P., Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/08
4142

Ultra Marathon Performance Improves Following OMT
Weibel, J., Lovy, A., Nelson, K. E., Kappler, R., Glonek, T.
The Journal of the American Osteopathic Association, 2004/08
4143

Conclusion of frequently used unsupported by data
Smith, R. M.
The Journal of the American Osteopathic Association, 2004/08
Free full text
4144

Physiologic and Anatomic Changes in Carpal Tunnel Syndrome: Is Osteopathic Manipulative Treatment an Effective Non-surgical Alternative Therapy?
White, H. D., Stoll, S. T., Cruser, D., Meyer, P. M., Whitesell, R.
The Journal of the American Osteopathic Association, 2004/08
4145

Rechtsgutachten: Ist der Osteopath zur selbstständigen Berufsausübung in der Osteopathie berechtigt?
(Legal expert's opinion: Is an osteopath authorized to practice independently in osteopathy? Comment by Prof. Dr. Toni Graf-Baumann)
Graf-Baumann, T.
Osteopathische Medizin, 2004/08
4146

Rechtsgutachten: Ist der Osteopath zur selbstständigen Berufsausübung in der Osteopathie berechtigt?
(Legal expert's opinion: Is an osteopath authorized to practice independently in osteopathy? Comment by the Working Group for Chiropractic, Osteopathy and Neural Therapy)
Riemer, B.
Osteopathische Medizin, 2004/08
4147

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4148

The effect of osteopathic manipulative treatment on immune response to the influenza vaccine in nursing homes residents: a pilot study
Noll, D. R., Degenhardt, B. F., Stuart, M. K., Werden, S., McGovern, R. J., Johnson, J. C.
Alternative Therapies In Health And Medicine, 2004/07
4149

Osteopathy in Idiopathic Parkinson Syndrome
Pelzl, R.
Unpublished MSc thesis, 2004/07
Free full text
4150

Globale integrierte Myofasziale Osteopathische Therapie (GIMFOT)
(Global integrated myofascial osteopathic therapy (GIMFOT))
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4151

Fasziales Thoraxkompressionstrauma
(Fascial thoracic compression trauma)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4152

Mobilisation der Rippen - in die ein geschränkte oder in die freie Richtung? Pro und Contra
(Mobilization of the ribs - in the restricted or in the free direction? Pros and cons)
Küttner, T., Geldschläger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4153

Osteopathie im Bereich des Brustkorbs
(Osteopathy in the thoracic region)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4154

Risk management for chiropractors and osteopaths: informed consent. A common law requirement
Walker, B. F., Cameron, M., French, S., Pollard, H. P., Vitiello, A. L., Reggars, J. W., Werth, P. D.
Australasian Chiropractic & Osteopathy, 2004/07
4155

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text
4156

Evaluating the rationale of the osteopathic internship
Smith, A. B.
The Journal of the American Osteopathic Association, 2004/06
Free full text
4157

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text
4158

Assessing the Gender Component in Coronary Heart Disease; A Comparative Analysis of Osteopathic and Allopathic Rural Physicians' Medical Approaches to Diagnosing and Treating Female Coronary Heart Disease
Curtis, V. S.
Unpublished PhD thesis, 2004/06
Free full text
4159

Osteopathische versus orthopädische Behandlung der chronischen Epicondylopathia humeri radialis: Eine randomisiert kontrollierte Untersuchung.
[Osteopathic versus orthopedic treatments for chronic epicondylopathia humeri radialis: a randomized controlled trial]
Geldschlager, S.
Forschende Komplementärmedizin, 2004/05
4160

Osteopathie und Senkung der Arbeitsunfähigkeitszeit
(Osteopathy and disability reduction)
Hack, A.
Manuelle Medizin, 2004/05
4161

Pseudokrupp
(Pseudo Croup)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4162

Die Entwicklung und osteopathische Behandlung von Kindern
(The development and osteopathic treatment of children)
Beinborn, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4163

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4164

Assessing the ability of medical students to perform osteopathic manipulative treatment techniques
Boulet, J. R., Gimpel, J. R., Dowling, D. J., Finley, M.
The Journal of the American Osteopathic Association, 2004/05
Free full text
4165

A randomized controlled trial of osteopathic manipulative treatment following knee or hip arthroplasty
Licciardone, J. C., Stoll, S. T., Cardarelli, K. M., Gamber, R. G., Swift, J. N., Jr., Winn
The Journal of the American Osteopathic Association, 2004/05
Free full text
4166

Infantile Schluckstörungen - in die Hand des Osteopathen
(Infantile swallowing disorder: To the hands of osteopaths)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4167

Dreimonatskolik: Osteopathie klinisch klar überlegen
(Colic children: Osteopathy markedly superior)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4168

Das Okziput - ein wichtiger Aspekt der kraniosakralen Osteopathie bei Säuglingen
(Occiput: An important aspect of craniosacral osteopathy in infants)
Schwerdtner, H.P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4169

Bericht vom 10th Annual Symposium on Complementary Healthcare
(Report from the 10th Annual Symposium on Complementary Health Care)
Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4170

Osteopathie auf der Intensivstation
(Osteopathy in the intensive care unit)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
Free full text
4171

Parental perceptions of the therapeutic effect from osteopathic manipulation or acupuncture in children with spastic cerebral palsy
Duncan, B., Barton, L., Edmonds, D., Blashill, B. M.
Clinical Pediatrics, 2004/05
4172

The effect of manipulation and mobilisation on pressure pain thresholds in the thoracic spine
Fryer, G., Carub, J., McIver, S.
Journal of Osteopathic Medicine, 2004/04
4173

DO relates positive experience with use of integrated neuromusculoskeletal release
Connolly, T. P.
The Journal of the American Osteopathic Association, 2004/04
Free full text
4174

Musculoskeletal disorders: does the osteopathic medical profession demonstrate its unique and distinctive characteristics?
Sun, C., Desai, G. J., Pucci, D. S., Jew, S.
The Journal of the American Osteopathic Association, 2004/04
Free full text
4175

The effect of osteopathic manipulative medicine on pulmonary function and lung volumes in healthy adults
Bradbury, J. A.
Unpublished MSc thesis, 2004/04
4176

A presentation of stiff and painful shoulder — a case based commentary
Chemeris, A. I., Clive, B., Lathey, D., Niel-Asher, C. S.
Journal of Osteopathic Medicine, 2004/04
4177

Methods used by members of the Australian osteopathic profession to assess the sacroiliac joint
Peace, S., Fryer, G.
Journal of Osteopathic Medicine, 2004/04
4178

Effectiveness of a sham protocol and adverse effects in a clinical trial of osteopathic manipulative treatment in nursing home patients
Noll, D. R., Degenhardt, B. F., Stuart, M., McGovern, R., Matteson, M.
The Journal of the American Osteopathic Association, 2004/03
Free full text
4179

Status of complementary and alternative medicine in the osteopathic medical school curriculum
Saxon, D. W., Tunnicliff, G., Brokaw, J. J., Raess, B. U.
The Journal of the American Osteopathic Association, 2004/03
Free full text
4180

Cystic Fibrosis: A Case History
Back, H. D., Gamber, R. G.
The AAO Journal, 2004/03
Free full text
4181

The Neuroendocrine-Immune Complex Illustrated in the Work of Dr. Frank Chapman
Capobianco, J. D.
The AAO Journal, 2004/03
Free full text
4182

A Case of Right First Rib Somatic Dysfunction Diagnosed and Treated
Lipton, J. A., Neil, M., Drew, B., McCarty, C.
The AAO Journal, 2004/03
Free full text
4183

Akuter Lumbago - ein funktioneller Ansatz
(Acute lumbago: a functional approach)
Debroux, J.J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
4184

Sturzgeburt und fasziales System
(Precipitate labor and fascial system)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
4185

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text
4186

Die Bedeutung der Faszien in der manuellen Therapie
(The importance of fasciae in manual therapy)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
4187

Wie viel Intensität braucht die Behandlung des Fasziengewebes? Pro und Contra
(How much intensity does the treatment of fascial tissue need? Pros and cons)
Schwind, P., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
4188

Outpatient osteopathic single organ system musculoskeletal exam form: training and certification
Sleszynski, S. L., Glonek, T., Kuchera, W. A.
The Journal of the American Osteopathic Association, 2004/02
Free full text
4189

Let's learn from the influenza epidemic
Richardson, M. E.
The Journal of the American Osteopathic Association, 2004/02
Free full text
4190

Efficacy of manipulation in low back pain treatment: The validity of meta-analysis conclusions
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Journal of Bodywork and Movement Therapies, 2004/01
4191

Osteopathic treatment for the symtomatic relief of meniere's disease
Adamek, K.
Unpublished MSc thesis, 2004/01
Free full text
4192

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain
Alivizatos, J.
Unpublished MSc thesis, 2004/01
Free full text
4193

Frequency and duration of low back pain in female hockey players compared to two other populations
Edwards, F.
Unpublished MSc thesis, 2004/01
Free full text
4194

The effect of osteopathic treatment on lung function in children with asthma: a case study
Esnouf, M.
Unpublished MSc thesis, 2004/01
Free full text
4195

The effect of osteopathic manipulative therapy applied to the lumbar spine on postural stability: a pilot study
Jones, D.
Unpublished MSc thesis, 2004/01
Free full text
4196

An investigation of the factors underlying the choice of treatment modalities used by students in the Victoria University Osteopathic clinic and practicing osteopaths
Kennedy, L.
Unpublished MSc thesis, 2004/01
Free full text
4197

Bridging the gap between medical education and application of OPP/OMT
Crosby, J. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text
4198

An epidemiology of injuries in sub-elite netball during a competitive season: a club perspective
McMillan, J. T.
Unpublished MSc thesis, 2004/01
Free full text
4199

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text
4200

Osteopathic emergency physician training and use of osteopathic manipulative treatment
Ray, A. M., Cohen, J. E., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text
4201

Osteopathic treatment to patients with primary dysmenorrhea
Pirritano, R.
Unpublished MSc thesis, 2004/01
Free full text
4202

The point prevalence of injuries in retired competitive female gymnasts
Shelton, N.
Unpublished MSc thesis, 2004/01
Free full text
4203

The effect of osteopathic treatment on the irritable bowel syndrome: a case series
Stasiuk, D.
Unpublished MSc thesis, 2004/01
Free full text
4204

Effects of osteopathic treatment on people with psoriatic arthritis: a pilot study
Wall, R., Ryan, E., Kiatos, J.
Unpublished MSc thesis, 2004/01
Free full text
4205

Postmenopause: womens' experiences
Walshe, S.
Unpublished MSc thesis, 2004/01
Free full text
4206

Randomized osteopathic manipulation study (ROMANS): pragmatic trial for spinal pain in primary care
Williams, N. H., Wilkinson, C., Russell, I., Edwards, R. T., Hibbs, R., Linck, P., Muntz, R.
Family Practice, 2003/12
Free full text
4207

Review of integrated neuromusculoskeletal release and the novel application of a segmental anterior/posterior approach in the thoracic, lumbar, and sacral regions
Danto, J. B.
The Journal of the American Osteopathic Association, 2003/12
Free full text
4208

Osteopathic manipulative treatment in prenatal care: a retrospective case control design study
King, H. H., Tettambel, M. A., Lockwood, M. D., Johnson, K. H., Arsenault, D. A., Quist, R.
The Journal of the American Osteopathic Association, 2003/12
Free full text
4209

Osteopathic physicians in primary care, Texas, 2003
Miller, T. L.
Unpublished MSc thesis, 2003/12
4210

Neuromusculoskeletal Medicine/ OMM: Useful to ALL DOs
van Buskirk, R. L.
The AAO Journal, 2003/12
Free full text
4211

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11
4212

Osteopathie hilft bei Prävention & Reha
(Osteopathy helps in prevention and rehabilitation)
Schaa, J.
Pflege Aktuell, 2003/11
4213

Position-Assisted Combination Technique (PACT) in the Management of Type-II Impairment in the Thoracic and Lumbar Spine
Makofsky, H. W.
Journal of Manual and Manipulative Therapy, 2003/10
4214

The effect of muscle energy technique on hamstring extensibility: the mechanism of altered flexibility
Ballantyne, F., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/10
4215

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10
4216

Intervertebral dysfunction: a discussion of the manipulable spinal lesion
Fryer, G.
Journal of Osteopathic Medicine, 2003/10
4217

A prospective study of osteopathic medical students' attitudes toward use of osteopathic manipulative treatment in caring for patients
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2003/10
Free full text
4218

Characteristics of the courses that best predict COMLEX-USA level 1 performance
Sefcik, D. J., Prozialeck, W. C., O'Hare, T. H.
The Journal of the American Osteopathic Association, 2003/10
Free full text
4219

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text
4220

Osteopathische Behandlung infantiler Schluckstörungen bei Kindern zwischen sieben und elf Jahren
(Osteopathic treatment of infantile swallowing for children between 7 and 11 years)
Bayer, S., Feldt, M.
Unpublished D.O. thesis, 2003/10
4221

Hat die osteopathische Behandlung bei Frauen mit menstrueller Migräne einen Effekt?
(The osteopathic treatment of menstrual migraine)
Ecker, H., Thomas, C.
Unpublished D.O. thesis, 2003/10
4222

Study to evaluate osteopathic treatment in late whiplash syndrome
(Study to evaluate osteopathic treatment in late whiplash syndrome)
Gietz, R., Kaiser, A., Kastner, K.
Unpublished D.O. thesis, 2003/10
4223

Die osteopathische Behandlung bei 3- Monatskolik im Vergleich zur konventionellen Therapie
(Osteopathic treatment of infantile colic)
Heber, U., Senger, A.
Unpublished D.O. thesis, 2003/10
4224

Die osteopathische Behandlung als Prävention von Geburtskomplikationen.
(Osteopathic treatment as a prevention of complications during child birth)
Lenz, D.
Unpublished D.O. thesis, 2003/10
4225

Pilotstudie zur Untersuchung der Wirksamkeit der osteopathischen Tuba auditiva Technik bei akuten Tinnituspatienten mit und ohne Hörstörungen
(Randomized clinical trial to investigate the efficacy of osteopathic tuba auditiva technique in acute tinnitus patients with and without hearing disorders - a pilot study.)
Mayer, M.
Unpublished D.O. thesis, 2003/10
4226

Osteopathie als Therapie der Säuglingsasymmetrie: Eine randomisierte kontrollierte Studie
(Infantile postural asymmetry and osteopathic treatment: a randomized therapeutic trial)
Pabst, B., Schleupen, A.
Unpublished D.O. thesis, 2003/10
4227

Veränderungen im Bereich des Beckenbodens in der Schwangerschaft
(Pregnancy-related changes in the pelvic floor region)
Dittmar, F. W.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4228

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4229

Osteopathie in der Schwangerschaft
(Osteopathy during pregnancy)
Gillemot, B.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4230

Osteopathie – ohne Frauen undenkbar!
(Osteopathy - unthinkable without women!)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4231

Osteopathische Begleitung während der Schwangerschaft
(Osteopathic support during pregnancy)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4232

Ein Blick über den Zaun: Beckenbodentraining bei Schwangerschaftsinkontinenz
(Looking beyond the fence: pelvic floor muscle training during pregnancy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4233

Osteopathie in der Schwangerschaft: Profitieren Mutter und Kind?
(Osteopathy in pregnancy: positive impact on mother and child?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4234

Gesundheitsstörungen in der Schwangerschaft: Joker Osteopathie?
(Pregnancy associated health problems: joker osteopathy?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4235

Osteopathie bei Zwillingsschwangerschaft
(Osteopathy in twin pregnancy)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4236

Behandlung von Symphysis pubis, knöchernem Becken und Beckenboden
(Treatment of symphysis pubis, bony pelvis and pelvic floor)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4237

Place de l’acupuncteur et du thérapeute manuel dans la prise en charge pluridisciplinaire des douloureux chroniques
(Place of acupuncturist and osteopath in multidisciplinary chronic pain management)
Meas, Y., Nizard, J., Rouxeville, Y., Lajat, Y.
Douleur et Analgesie, 2003/09
4238

Muscle energy technique in patients with acute low back pain: a pilot clinical trial
Wilson, E., Payton, O., Donegan-Shoaf, L., Dec, K.
Journal of Orthopaedic & Sports Physical Therapy, 2003/09
4239

Osteopathic manipulative treatment in the emergency department for patients with acute ankle injuries
Eisenhart, A. W., Gaeta, T. J., Yens, D. P.
The Journal of the American Osteopathic Association, 2003/09
Free full text
4240

Development of the Attitudes Toward Osteopathic Principles and Practice Scale (ATOPPS): preliminary results
Russo, D. P., Stoll, S. T., Shores, J. H.
The Journal of the American Osteopathic Association, 2003/09
Free full text
4241

Likening Likening Strikes. Psychiatry, Osteopathy, and the Likeness Argument
Tyreman, S.
Philosophy, Psychiatry & Psychology, 2003/09
4242

Objectively and subjectively observed changes in patients diagnosed with primary coxarthrosis following osteopathic treatment with and without supplemental glucosaminosulfate and MSM
Bergthaler, H.
Unpublished MSc thesis, 2003/09
4243

Letters to the editor
Ehrenfeuchter, W. C., Kellam, R. T.
The AAO Journal, 2003/09
Free full text
4244

Facilitated Oscillatory Release - a method of dynamic assessment and treatment of Somatic Dysfunction
Comeaux, Z. J.
The AAO Journal, 2003/09
Free full text
4245

Dynamic Strain-Vector Release: An Energetic Approach to OMT
Hendryx, J. T., O'Brien, R. L.
The AAO Journal, 2003/09
Free full text
4246

“The Energy cyst“: Its Ramifications and Use in Osteopathic Manipulative Management
MacDonald, R. C.
The AAO Journal, 2003/09
Free full text
4247

The use of osteopathic manipulative treatment as adjuvant therapy in children with recurrent acute otitis media
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F.
Archives of Pediatrics & Adolescent Medicine, 2003/09
Free full text
4248

Osteopathic manipulation to prevent otitis media--does it work?
Pichichero, M. E.
Archives of Pediatrics & Adolescent Medicine, 2003/09
4249

Osteopathic and Allopathic Family Practice Residents' Attitudes Toward OMT/OPP
Allee, B. A., Pollak, M. H., Malnar, K. F., Elfrink, L. D., Mulkey, L. E.
Journal of Osteopathic Medicine, 2003/08
4250

Patient-reported Outcomes of Osteopathic Manipulative Treatment, The Development of a Research Tool
Caldwell, C. T., Degenhardt, B. F., Johnson, J. C., Hoberman, C. J.
The Journal of the American Osteopathic Association, 2003/08
4251

Determining the Impact of Osteopathic Manipulative Therapy in the Management of Irritable Bowel Syndrome
Chiesa, J. C., Pomerantz, S. C., Shinkle, J. W., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08
4252

Study raises important issues about the potential benefit of osteopathy in the cranial field to patients with Parkinson's disease
Boehm, K. M., Lawner, B. J., McFee, R. B.
The Journal of the American Osteopathic Association, 2003/08
Free full text
4253

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text
4254

Die Wirksamkeit des multimodalen (manualtherapeutischen, osteopathischen) Therapiekonzeptes bei Kindern mit infantiler Cerebralparese
(The effectiveness of multimodal therapy concepts in children with cerebral palsy)
Steingrube-Bradtke, E.
Kranken Gymnastik, 2003/08
4255

Benefits of Osteopathic Manipulative Treatment After Abdominal Hysterectomy: A Retrospective Cohort Study
Ludwig, K., Hortos, K., Gupte, C.
The Journal of the American Osteopathic Association, 2003/08
4256

Osteopathic Manipulative Therapy (OMT) as a Non-pharmacological Treatment for Stable Patients with Emphysema and Chronic Bronchitis
Morley, T. F., Shinkle, J. W., Pomerantz, S. C., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08
4257

Hemodynamic Effects of Osteopathic Manipulative Treatment (OMT) Immediately Following Coronary Artery Bypass Graft (CABG) Surgery
O-Yurvati, A. H., Carnes, M., Clearfield, M., Stoll, S. T., McConathy, W.
The Journal of the American Osteopathic Association, 2003/08
4258

Determination of Pressures Used in Osteopathic Manipulative Treatments
Patterson, M. M., Shamus, E., Carter, K.
The Journal of the American Osteopathic Association, 2003/08
4259

Osteopathic Manipulative Treatment and Congestive Heart Failure
Scheunemen, G. M., Mnabhi, A. K. S., Papp, M. A., Nelson, K. E., Glonek, T.
The Journal of the American Osteopathic Association, 2003/08
4260

Lumbar Rotation Range of Motion with Lumbar Osteopathic Manipulative Treatment
Shamus, E., Patterson, M. M., Carter, K.
The Journal of the American Osteopathic Association, 2003/08
4261

Osteopathic manipulative medicine in the treatment of hypertension: An alternative, conventional approach
Spiegel, A. J., Capobianco, J. D., Kruger, A., Spinner, W. D.
Heart Disease, 2003/07
4262

Treating patients in primary care: the impact of mood, behavior, and thought disturbances
Baron, D. A., Hay, D. P., Easom, H. M.
The Journal of the American Osteopathic Association, 2003/07
Free full text
4263

Predictive validity of osteopathic medical licensing examinations for osteopathic medical knowledge measured by graduate written examinations
Cavalieri, T. A., Shen, L., Slick, G. L.
The Journal of the American Osteopathic Association, 2003/07
Free full text
4264

Osteopathic manipulative treatment for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Stoll, S. T., Fulda, K. G., Russo, D. P., Siu, J., Winn, W., Swift, J.
Spine (Phila Pa 1976), 2003/07
4265

Cranial manipulation with possible neurovascular contact injury at the cerebello-pontine angle: a case report
Elliott, J. M., Jacobson, E. J., Centeno, C. J., Emerson, P. L.
Alternative Therapies in Health and Medicine, 2003/07
4266

ACO Risk Management for Chiropractors and Osteopaths: Imaging Guidelines for Conditions Commonly Seenin Practice
French, S., Walker, B. F., Cameron, M., Pollard, H. P., Vitiello, A. L., Reggars, J. W., Werth, P. D., Comrie, D. A.
Australasian Chiropractic & Osteopathy, 2003/07
Free full text
4267

Schlüsselfunktionen des Peritoneums bei Rückenschmerzen
(Key functions of the peritoneum in back pain)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4268

Zum primären Verletzungsmechanismus bei Beschleunigungsverletzungen
(Whiplash injury: What you should know)
Keller, M., Bischoff, A., Schwerla, B. S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4269

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4270

Nackenschmerzen: Hand anlegen überlegen!
(Neck pain: manual therapy scores best)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4271

Nackenschmerzen: Manualtherapie am günstigsten
(Cost-effectiveness of common treatments for neck pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4272

Die Viszera - Konsequenzen aus der Autonomie für die Osteopathie? Pro und Contra
(The viscera - consequences of autonomy for osteopathy? Pros and cons)
Wührl, P., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4273

Osteopathic physicians provide quality care--with or without OMT
Crow, R. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
4274

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
4275

OMT's effectiveness already proven
Tessien, R. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
4276

Die Klavikula
(The clavicle. The key to the shoulder)
Hack, A.
Manuelle Medizin, 2003/06
4277

Osteopathic Manipulative Management of Herpes Zoster (Shingles} and the Prevention of Post Herpetic Neuralgia
Kellam, R. T.
The AAO Journal, 2003/06
Free full text
4278

From the Archives: A Manual of Cranial Technique
Lippincott, R. C., Lippincott, H. A.
The AAO Journal, 2003/06
Free full text
4279

OMT Relieves Jaw Pain
Pasquarello, G.
The AAO Journal, 2003/06
Free full text
4280

Somatovisceral response following osteopathic HVLAT: a pilot study on the effect of unilateral lumbosacral high-velocity low-amplitude thrust technique on the cutaneous blood flow in the lower limb
Karason, A. B., Drysdale, I. P.
Journal of Manipulative and Physiological Therapeutics, 2003/05
4281

Osteopathic manipulative treatment techniques preferred by contemporary osteopathic physicians
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2003/05
Free full text
4282

Using National Medical Care Survey data to validate examination content on a performance-based clinical skills assessment for osteopathic physicians
Boulet, J. R., Gimpel, J. R., Errichetti, A. M., Meoli, F. G.
The Journal of the American Osteopathic Association, 2003/05
Free full text
4283

The effect of muscle energy technique on gross trunk range of motion
Lenehan, K. L., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/04
4284

Research at US colleges of osteopathic medicine: a decade of growth
Guillory, V. J., Sharp, G.
The Journal of the American Osteopathic Association, 2003/04
Free full text
4285

Thanks for professional support
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2003/04
4286

Praktische osteopathische Überlegungen zu den Nasennebenhöhlen
(Practical osteopathic considerations for the paranasal sinuses)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4287

Osteopathie bei chronischer Sinusitis
(Osteopathy for chronic sinusitis)
Häfner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4288

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4289

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4290

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4291

Wissenswertes zum Bereich von Hals, Nase und Ohren
(Things to know about the area of the throat, nose and ears)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4292

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4293

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4294

A proposal that benefits all
Bentley, E. M.
The Journal of the American Osteopathic Association, 2003/03
Free full text
4295

Osteopatia in neonatologia
(Osteopathy in neonatology)
Colli, R., Biagiotti, I., Sterpa, A.
La Pediatria medica e chirurgica : Medical and surgical pediatrics, 2003/03
4296

Etiological Factors in Sacral Somatic Dysfunctions
Danto, J. B.
The AAO Journal, 2003/03
Free full text
4297

Conceptual and Treatment Models in Osteopathy
Jordan, T.
The AAO Journal, 2003/03
Free full text
4298

Characteristics of physicians disciplined by the State Medical Board of Ohio
Clay, S. W., Conatser, R. R.
The Journal of the American Osteopathic Association, 2003/02
Free full text
4299

Failure to convince osteopathic medical students of OMT's worth increases risk of subspecialization
Corbett, R. M.
The Journal of the American Osteopathic Association, 2003/02
Free full text
4300

Validity and reliability of the Osteopathic Survey of Health Care in America (OSTEOSURV)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/02
Free full text
4301

Spinal manipulation for low-back pain: a treatment package agreed to by the UK chiropractic, osteopathy and physiotherapy professional associations
Harvey, E., Burton, A. K., Moffett, J. K., Breen, A.
Manual Therapy, 2003/02
4302

Manipulation of the cervical spine
Hing, W. A., Reid, D. A., Monaghan, M.
Manual Therapy, 2003/02
4303

Alternative treatments for neck sprain
Hogg, K., Morton, R.
Emergency Medicine Journal, 2003/01
4304

Use of osteopathic manipulative treatment by Ohio osteopathic physicians in various specialties
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2003/01
Free full text
4305

Positional related injury in elite female field hockey players
Merrett, A.
Unpublished MSc thesis, 2003/01
Free full text
4306

The effects of vocal function exercises on the lung function of trained female singers: a pilot investigation
Price, K.
Unpublished MSc thesis, 2003/01
Free full text
4307

Etiology of lumbar pain in pregnancy
Rodriguez, W.
Unpublished MSc thesis, 2003/01
Free full text
4308

Re-discovery of self: the impact of osteopathic treatment on women who suffer from perimenstrual low backache
Lonergan, B.
Unpublished PhD thesis, 2003/01
4309

Evaluation de la frequence des accidents lies aux manipulations vertebrales a partir d'une enquete retrospective realisee dans quatre departements francais
(Complications following vertebral manipulation-a survey of a French region physicians)
Dupeyron, A., Vautravers, P., Lecocq, J., Isner-Horobeti, M. E.
Annales de Réadaptation et de Médecine Physique, 2003/01
4310

Allgemeiner Aufbau des Kniegelenks
(General structure of the knee joint)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4311

Das schmerzhafte Knie: Eine Übersicht
(The painful knee: an overview)
Resch, K.L., Bachem, S., Salzmann, I., Schwartz, U., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4312

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4313

Kompensatorische Kniebeschwerden
(Compensatory knee pain)
Schallier, F., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4314

Traumatologische Diagnostik des Kniegelenks
(Traumatological diagnostics of the knee joint)
Schwerdtner, H.P., Schallier, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4315

Das posttraumatische Kniegelenk
(The post-traumatic knee joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4316

Perceptions of philosophic and practice differences between US osteopathic physicians and their allopathic counterparts
Johnson, S. M., Kurtz, M. E.
Social Science & Medicine, 2002/12
Free full text
4317

From the Archives: Untitled Talk
Sutherland, W. G.
The AAO Journal, 2002/12
Free full text
4318

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4319

Selection criteria for applicants in primary care osteopathic graduate medical education
Bates, B. P.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4320

Parameters of asthma and manipulation study questioned
Cali, G. E.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4321

Relationship of osteopathic medical licensure examinations with undergraduate admission measures and predictive value of identifying future performance in osteopathic principles and practice/osteopathic manipulative medicine courses and rotations
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4322

Institutional impact of a part-time faculty development fellowship program for osteopathic community-based physicians
Pinheiro, S. O., Liechty, D. K., Busch, K. V., Johnson, E. S., Dora, D. L., Butler, R. M.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4323

Training family medicine residents for assessment and advocacy of older adults
Robbins, M. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4324

The effect of cranial manipulation on the Traube-Hering-Mayer oscillation as measured by laser-Doppler flowmetry
Sergueef, N., Nelson, K. E., Glonek, T.
Alternative Therapies in Health and Medicine, 2002/11
4325

Die osteopathische Behandlung der chronischen Zervikalgie. Eine randomisierte kontrollierte Studie
(Osteopathy alleviates pain in chronic non-specific neck pain: A randomized controlled trial)
Bischoff, P., Nürnberger, A., Voigt, A.
Unpublished D.O. thesis, 2002/10
4326

Hat eine osteopathische Behandlung einen Effekt bei Kindern mit Hyperaktivität und/oder eines Aufmerksamkeits-Defizitsyndroms.
(Can osteopathic treatment have an effect on children with Attention Deficit Hyperactivity Disorder Syndrome (ADHD) and/or Attention Disorder Syndrome (ADD)? A randomized controlled trial.)
Haas, J, Käser, D, Werner, M
Unpublished D.O. thesis, 2002/10
4327

Studie zur osteopathischen Behandlung der Dranginkontinenz und der Kombination aus Stress- und Dranginkontinenz bei Frauen
(Study on osteopathic treatment of urge incontinence and the combination of stress and urge incontinence in women.)
Ernst, H., Osenstätter, H.
Unpublished D.O. thesis, 2002/10
4328

Kann durch osteopathische Techniken eine Senkung des Augeninnendrucks beim primärchronischen Offenwinkelglaukom bewirkt werden? [Pilotstudie]
(Is it possible through osteopathic techniques to get a reduction of intraocular pressure in primary open-angle glaucoma? (pilot study))
Esser, T.
Unpublished D.O. thesis, 2002/10
4329

Common Mother-Infant Treatment. A Way to Attachment Security
Kreutz, M.
Unpublished MSc thesis, 2002/10
4330

Osteopathie und chronische Sinusitis: Eine randomisierte kontrollierte Pilotstudie
(Osteopathic treatment of chronic sinusitis: a randomized controlled pilot trial)
Häfner, S., Stadler, M.
Unpublished D.O. thesis, 2002/10
4331

Einfluss osteopathischer Behandlungen auf Konzentrationsstörungen bei Kindern [Pilotstudie]
(Effect of osteopathic treatments on concentration disorders in children. A pilot study)
Lamberts, A.
Unpublished D.O. thesis, 2002/10
4332

Osteopathische Behandlung im Bereich des Caecums und die Wirkung auf den Rückfluss der Vena femoralis bei Patientinnen mit Venenproblemen
(Osteopathic treatment in the caecum and the effect on the reflux of the femoral vein in patients with venous problems)
Ritter-Kleinhans, M.
Unpublished D.O. thesis, 2002/10
4333

Die therapeutische Wirksamkeit einer osteopathischen Behandlung beim Reizdarmsyndrom: Eine randomisierte kontrollierte Studie
(Osteopathy as a promising short-term strategy for irritable bowel syndrome: randomized controlled trial)
Müller, A., Salomon, J., Stiedl, M.
Unpublished D.O. thesis, 2002/10
4334

Einfluss osteopathischer Techniken auf den Heilungsverlauf einer Hüftreifestörung (Dysplasie) im Säuglingsalter
(Influence of osteopathic techniques on the healing process of a hip maturation disorder (dysplasia) in infancy)
Remmele, R., Weiss, R.
Unpublished D.O. thesis, 2002/10
4335

Stellt die osteopathische Therapie bei der chronischer Tubenbelüftungsstörung von Kindern eine Alternative zur üblichen chirurgischen Behandlung dar? [Pilotstudie]
(Is osteopathic therapy an alternative to standard surgical treatment for chronic impaired tubal ventilation in children? A pilot study.)
Schiefer, B., Weis-Ayari, M.
Unpublished D.O. thesis, 2002/10
4336

An investigation into the electrical activity of tender, resting paraspinal muscles using surface electromyography: a pilot study
Hubbard, A., Fryer, G., Ball, K. T.
Journal of Osteopathic Medicine, 2002/10
4337

Working less, training harder
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2002/10
Free full text
4338

Conditions and diagnoses for which osteopathic primary care physicians and specialists use osteopathic manipulative treatment
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2002/10
Free full text
4339

A critical appraisal of an article comparing the effectiveness of osteopathic manipulation and chemonucleolysis in the management of symptomatic lumbar disc herniation
Legge, D.
Journal of Osteopathic Medicine, 2002/10
4340

Osteopathic perturbation and immune network compensation
Degabriele, R.
Journal of Osteopathic Medicine, 2002/10
4341

A retrospective case report of symphysis pubis dysfunction in a pregnant woman
Cassidy, I., Jones, C.
Journal of Osteopathic Medicine, 2002/10
4342

Osteopathy for Back- and Pelvic Pain in Pregnancy
Kofler, G.
Unpublished MSc thesis, 2002/09
Free full text
4343

From the Archives: Vindication
Bennett, G. M.
The AAO Journal, 2002/09
Free full text
4344

Post-traumatic Headache of Cervical Origin
Mitra, M. M., Stoll, S. T.
The AAO Journal, 2002/09
Free full text
4345

Osteopathic Manipulative Treatment and Task Specific Practice Enhance Locomotor Recovery after Unilateral Sensorimotor Cortex Lesions in Rats
Schmanke, T., Rosario, H., Chughtai, H., Ruiz, C., O'Halpin, S., Wells, M. R., Hallas, B. H., Scandalis, T. A.
The Journal of the American Osteopathic Association, 2002/09
4346

Students', Interns' and Residents' Comfort and Confidence With Their OMT Skills
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2002/09
4347

Student performance on the Comprehensive Osteopathic Medical Licensing Examination-USA level 2 following a clinical evaluation, feedback, and intervention program
Agostini, D. E., Stano, A. S., Parente, D. H.
The Journal of the American Osteopathic Association, 2002/09
Free full text
4348

Structure and function reexamined
Magoun, H. I.
The Journal of the American Osteopathic Association, 2002/09
Free full text
4349

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text
4350

Osteopathic Manipulation Increases Active Range of Motion and Gait Parameters in Osteoarthritis: A Pilot Study
Bahamonde, L. G., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
Journal of Osteopathic Medicine, 2002/08
4351

Impact of Osteopathic Manual Medicine in Patients with Knee Osteoarthritis
Degenhardt, B. F., Kenney, R. G., McGovern, R. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/08
4352

Joint Kinetic Parameters as Indicators of Osteopathic Manipulative Treatment Effect in Osteoarthritis of the Knee
Kilbury Nason, L. L., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
The Journal of the American Osteopathic Association, 2002/08
4353

A Randomized Controlled Trial of Osteopathic Manipulative Treatment in Chronic, Non-Specific Low Back Pain
Licciardone, J. C., Stoll, S. T., Fulda, K., Russo, D. P., Siu, J., Winn, W., Swift Jr., J.
The Journal of the American Osteopathic Association, 2002/08
4354

Effect of Osteopathic Manipulative Treatment (OMT) On Recurrent Acute Otitis Media in Children
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F., Worden, K.
The Journal of the American Osteopathic Association, 2002/08
4355

Can A Sham Treatment Blind Subjects With Obstructive Lung Disease To Group Assignment?
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2002/08
4356

The Immediate Effect of OMT on Pulmonary Function Parameters in Obstructive Pulmonary Disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2002/08
4357

A retrospective study of cranial strain patterns in patients with idiopathic Parkinson's disease
Rivera-Martinez, S., Wells, M. R., Capobianco, J. D.
The Journal of the American Osteopathic Association, 2002/08
Free full text
4358

Osteopathy in pregnancy and childbirth. Interview by Jenny Green
Sandler, S., Korth, S.
The Practising Midwife, 2002/07
4359

Quantifiable effects of osteopathic manipulative techniques on patients with chronic asthma
Bockenhauer, S. E., Julliard, K. N., Lo, K. S., Huang, E., Sheth, A. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
4360

Osteopathy in the cranial field: uncovering challenges and potential applications
King, H. H.
The Journal of the American Osteopathic Association, 2002/07
Free full text
4361

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
4362

Therapeutische Ergebnisse mit der Muscle energy technique nach Mitchel beim Bandscheibenvorfall der Lendenwirbelsäule
(Results after treatment with Mitchel's muscle energy technique in disk prolapse in the lumbar spine)
Hack, A.
Manuelle Medizin, 2002/06
4363

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text
4364

Osteopathic manipulative treatment in conjunction with medication relieves pain associated with fibromyalgia syndrome: results of a randomized clinical pilot project
Gamber, R. G., Shores, J. H., Russo, D. P., Jimenez, C., Rubin, B. R.
The Journal of the American Osteopathic Association, 2002/06
Free full text
4365

Mechanisms and effects of spinal high-velocity, low-amplitude thrust manipulation: previous theories
Evans, D. W.
Journal of Manipulative and Physiological Therapeutics, 2002/05
4366

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text
4367

Joint cracking and popping: understanding noises that accompany articular release
Protopapas, M. G., Cymet, T. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text
4368

Effects of osteopathic manipulative treatment and concentric and eccentric maximal-effort exercise on women with multiple sclerosis: a pilot study
Yates, H. A., Vardy, T. C., Kuchera, M. L., Ripley, B. D., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text
4369

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04
4370

In response
Sanders, G.
Journal of Osteopathic Medicine, 2002/04
4371

Unity between osteopathic and allopathic medicine only answer to preserving osteopathic uniqueness
Wagner, E. E.
The Journal of the American Osteopathic Association, 2002/04
Free full text
4372

Tackling birth trauma with cranio-sacral therapy
Turney, J.
The Practising Midwife, 2002/03
4373

Unrelenting Abdominal Pain of Elusive Origin: A Case Study
Chapello, I. A., Templin, M. A.
The AAO Journal, 2002/03
Free full text
4374

The Impact of Osteopathic Manipulative Medicine On Inpatient Outcomes
Klock, G. B.
The AAO Journal, 2002/03
Free full text
4375

Improved Pain Score Outcomes Achieved Through The Cooperative And Cost-Effective Use Of Physical (Osteopathic Manipulative) Medicine In The Treatment Of Outpatient Musculoskeletal Complaints
Lipton, J. A., Meneses, P., Martin, J. B., Mizera, A. C., Kappler, R. E., Brooks, J. S., Parr, C.
The AAO Journal, 2002/03
Free full text
4376

Quality of life in referred patients presenting to a specialty clinic for osteopathic manipulative treatment
Licciardone, J. C., Gamber, R. G., Russo, D. P.
The Journal of the American Osteopathic Association, 2002/03
Free full text
4377

Need for objective measures to prove clinical outcome
Oleski, S. L., Kim, M. D.
The Journal of the American Osteopathic Association, 2002/03
Free full text
4378

Research in action: a summary of the 2001 American Osteopathic Association Research Conference
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2002/03
Free full text
4379

Evaluation of osteopathic manipulative treatment training by practicing physicians in Ohio
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2002/03
Free full text
4380

Interexaminer reliability and cranial osteopathy
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2002/01
4381

Must question cause of sports-related injuries
Brumm, L. F.
The Journal of the American Osteopathic Association, 2002/01
Free full text
4382

Patient satisfaction and clinical outcomes associated with osteopathic manipulative treatment
Licciardone, J., Gamber, R., Cardarelli, K.
The Journal of the American Osteopathic Association, 2002/01
Free full text
4383

Travel road that includes complementary and alternative modes of therapy
Maulfair, C. G.
The Journal of the American Osteopathic Association, 2002/01
Free full text
4384

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text
4385

Is there any osteopathy in the specialty training of osteopathic residents?
Glover, J. C.
The AAO Journal, 2001/12
Free full text
4386

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
4387

Neuromusculoskeletal Medicine and Osteopathic Manipulative Treatment Residency Programs at the Osteopathic Medical Center of Texas
Stoll, S. T., Carnes, M., Brooks, L.
The AAO Journal, 2001/12
Free full text
4388

A framework for and case study of medical informatics development at Michigan State University College of Osteopathic Medicine
Notman, M., Greene, J. F.
The Journal of the American Osteopathic Association, 2001/12
Free full text
4389

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text
4390

Effektivität einer osteopathischen Behandlung bei chronischem Knieschmerz
(Effectiveness of an osteopathic treatment in patients with chronic knee pain)
Bachem, U., Salzmann, S., Schwartz, I.
Unpublished D.O. thesis, 2001/10
4391

Osteopathy and Yoga - a First Examination
Laun, G.
Unpublished MSc thesis, 2001/10
Free full text
4392

Systematische Untersuchung osteopathischer Befunde bei primärer Dysmenorrhoe
(Systematic study of osteopathic findings in primary dysmenorrhea)
Hellmann, C.
Unpublished D.O. thesis, 2001/10
4393

Mobilization with movement applied to the elbow affects shoulder range of movement in subjects with lateral epicondylalgia
Abbott, J. H.
Journal of Osteopathic Medicine, 2001/10
4394

The initial effects of an elbow mobilization with movement technique on grip strength in subjects with lateral epicondylalgia
Abbott, J. H., Patla, C. E., Jensen, R. H.
Journal of Osteopathic Medicine, 2001/10
4395

Short-term effects of cervical manipulation on edge light pupil cycle time: a pilot study
Gibbons, P., Gosling, C. M., Holmes, M.
Journal of Osteopathic Medicine, 2001/10
4396

The percentage improvement in pain scale as a measure of physiotherapy treatment effects
Gridley, L., Van den Dolder, P.
Journal of Osteopathic Medicine, 2001/10
4397

Thoracic spine dysfunction in upper extremity complex regional pain syndrome type I
Menck, J. Y., Requejo, S. M., Kulik, K.
Journal of Osteopathic Medicine, 2001/10
4398

Destiny of osteopathic profession. 1916
Meacham, W. B.
The Journal of the American Osteopathic Association, 2001/10
4399

Intra-examiner and inter-examiner reliability of a positional diagnostic screen for the lumbar spine
Spring, F., Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10
4400

Auswirkungen von osteopathischen Behandlungen auf die Dreimonatskoliken bei Säuglingen
(Effects of osteopathic treatments on infantile colic)
Gludovatz, P.
Unpublished MSc thesis, 2001/10
Free full text
4401

The destiny of the osteopathic profession: the osteopathic difference
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/10
Free full text
4402

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text
4403

Andrew Taylor Still Memorial Lecture: the osteopathic difference--is it only manipulation? 1984
Siehl, D.
The Journal of the American Osteopathic Association, 2001/10
4404

Osteopathic treatment in rehabilitation of whiplash injury
Stockinger, V.
Unpublished MSc thesis, 2001/10
4405

Efficacy of spinal manipulation for chronic headache: A systematic review
Bronfort, G.
Journal of Manipulative and Physiological Therapeutics, 2001/09
4406

A Pilot Study Assessing Effects of OMT on Immune Changes Associated Wth Academic Stress
Joshi, B. P., Plotkin, B. J., Viselli, S. M.
The Journal of the American Osteopathic Association, 2001/09
4407

Respect the friendly adversary
Anderson, R. B.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4408

Knowing more than the score: providing sideline medical care coverage for athletic competition
Brolinson, G., Cibor, G. M.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4409

Decline in structural examination compliance in the hospital medical record with advancing level of training
Essig-Beatty, D. R., Klebba, G. E., LaPointe, N. G., Miller, E. D., Strong, R. E.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4410

Has our profession become its own worst enemy?
Fettig, L. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4411

A research program for the osteopathic profession, our great and only hope
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4412

Adjunctive osteopathic manipulative treatment in women with depression: a pilot study
Plotkin, B. J., Rodos, J. J., Kappler, R., Schrage, M., Freydl, K., Hasegawa, S., Hennegan, E., Hilchie-Schmidt, C., Hines, D., Iwata, J., Mok, C., Raffaelli, D.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4413

Osteopathic manipulative treatment of low back pain during labor
Carpenter, S., Woolley, A.
The AAO Journal, 2001/09
4414

Elbow injuries in golf
Stockard, A. R.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4415

The Evaluation of the Effect of Osteopathic Manipulative Techniques (OMT) on Headache Pain
Flotildes, K. L.
The Journal of the American Osteopathic Association, 2001/08
4416

Effect of Pre-Emptive Morphine and Postoperative Osteopathic Manipulative Technique on Pain Following Total Abdominal Hysterectomy: A Pilot Study
Goldstein, F., Jeck, S., Nicholas, A., Berman, M., Lerario, M.
The Journal of the American Osteopathic Association, 2001/08
4417

More on allopathic medical credentialing
Allee, B. A.
The Journal of the American Osteopathic Association, 2001/08
Free full text
4418

Osteopathic treatment of the common cold. 1937
Becker, A. D.
The Journal of the American Osteopathic Association, 2001/08
Free full text
4419

The Effects of a Structured OMT Curriculum on Osteopathic Exams and OMT for Hospitalized Patients
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2001/08
4420

The Effects of OMT on Vital Signs During Headache
Parikh, A. S.
The Journal of the American Osteopathic Association, 2001/08
4421

Diminished use of osteopathic manipulative treatment and its impact on the uniqueness of the osteopathic profession
Johnson, S. M., Kurtz, M. E.
Academic Medicine, 2001/08
Free full text
4422

Methods of applying manipulative technic. 1945
Burns, L.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4423

Soft tissues in areas of osteopathic lesion. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4424

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4425

Characteristics, satisfaction, and perceptions of patients receiving ambulatory healthcare from osteopathic physicians: a comparative national survey
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4426

Applications of manipulative techniques
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4427

Correlation of scores for the Comprehensive Osteopathic Medical Licensing Examination with osteopathic medical school grades
Hartman, S. E., Bates, B. P., Sprafka, S. A.
The Journal of the American Osteopathic Association, 2001/06
Free full text
4428

Beschwerden der oberen Wirbelsäule. Teil 3: Behandlungsergebnisse mit der Muscle energy Technique nach Mitchel bei Beschwerden, die von der oberen Wirbelsaule ausgehen
(Symptoms originating from the upper spine. Part 3: Results of Mitchel's Muscle Energy Technique in symptoms originating from the upper spine)
Hack, A.
Manuelle Medizin, 2001/06
4429

“The California incident“
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/06
Free full text
4430

DOs question intent of challenge
Zorski, K. C., Woeller, K. N., Galin, C. M., Nani, S., Myers, G. P., Greenfield, J. R., Sendzicki, B., Haltof, A. H.
The Journal of the American Osteopathic Association, 2001/06
Free full text
4431

Sinusitis in children: the importance of diagnosis and treatment
Shrum, K. M., Grogg, S. E., Barton, P., Shaw, H. H., Dyer, R. R.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4432

More on spirituality
Chin, W. L.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4433

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4434

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4435

Letter that questions OCF requires no response
MacDonald, R. C.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4436

Innovative approach to headaches
Mellick, G. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4437

More on spirituality
Horton, J. G.
The Journal of the American Osteopathic Association, 2001/05
4438

Case report: Resolution of suckling intolerance in a 6-month-old chiropractic patient
Holtrop, D. P.
Journal of Osteopathic Medicine, 2001/04
4439

Toward optimal health: The experts discuss fibromyalgia
Meisler, J. G., Clauw, D. J., Russell, I. J.
Journal of Osteopathic Medicine, 2001/04
4440

Exercise therapy for craniomandibular disorders
Nicolakis, P., Erdogmus, B., Kopf, A., Djaber-Ansari, A., Piehslinger, E., Fialka-Moser, V.
Journal of Osteopathic Medicine, 2001/04
4441

Pain management in osteopathic medicine: The efficacy of flotation REST as an adjunct to spinal manipulation for acute non-specific low back pain. A case report
Rogan, A., Morris, T., Gibbons, P.
Journal of Osteopathic Medicine, 2001/04
4442

Osteopathic treatment considerations for rheumatic diseases
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
4443

Review of Sacral Somatic Dysfunction
Janiak, D. D.
The AAO Journal, 2001/03
Free full text
4444

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text
4445

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text
4446

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text
4447

Analyzing the osteopathic lesion. 1940
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/02
Free full text
4448

Research--beginning the modern era
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/02
Free full text
4449

Testing osteopathic medical school graduates for licensure: is COMLEX-USA the most appropriate examination?
Graneto, J.
The Journal of the American Osteopathic Association, 2001/01
Free full text
4450

Osteopathy in its early adulthood, 1945-1955
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/01
Free full text
4451

Osteopathic medicine in the treatment of low back pain
Newswanger, D. L., Patel, A. T., Ogle, A.
American Family Physician, 2000/12
Free full text
4452

Shortness of breath and hypoxia following exploratory laparotomy
Ettlinger, H. M.
The AAO Journal, 2000/12
Free full text
4453

A practitioner survey of osteopathic manipulative treatment (OMT) techniques for specific body regions
Song, S. H.
The AAO Journal, 2000/12
Free full text
4454

Low back pain: Cost and treatment
Swords, W. J.
The AAO Journal, 2000/12
Free full text
4455

Time for Medicare reform is now
Linz, A. J.
The Journal of the American Osteopathic Association, 2000/12
Free full text
4456

Benefits of osteopathic manipulative treatment for hospitalized elderly patients with pneumonia
Noll, D. R., Shores, J. H., Gamber, R. G., Herron, K. M., Swift, J.
The Journal of the American Osteopathic Association, 2000/12
Free full text
4457

Questioning of OCF should rouse osteopathic response
Norton, J. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text
4458

Government control of medicine
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text
4459

Collaboration between pharmacy and osteopathic medicine to teach via the Internet
Sweeney, M. A., Schuster, M. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text
4460

Tendencies in a social, political, and governmental way which may influence doctors. 1937
Thomas, E. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text
4461

Spirituality in medicine
Travaline, J. M., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2000/12
Free full text
4462

Hardship deferment saves residents' money
Weinberg, A.
The Journal of the American Osteopathic Association, 2000/12
Free full text
4463

Acute gastrointestinal bleeding: clinical essentials for the initial evaluation and risk assessment by the primary care physician
Zuckerman, G. R.
The Journal of the American Osteopathic Association, 2000/12
4464

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
4465

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text
4466

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
4467

The clinical spectrum of acute coronary syndromes
Rogers, F. J.
The Journal of the American Osteopathic Association, 2000/11
Free full text
4468

Enrollment management strategies and practices at colleges of osteopathic medicine
Guidry, B. S.
Unpublished Dissertation, 2000/11
4469

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
4470

Galbreath technique: a manipulative treatment for otitis media revisited
Pratt-Harrington, D.
The Journal of the American Osteopathic Association, 2000/10
Free full text
4471

Osteopathic Treatment of Idiopathic Scoliosis with Emphasis on the Fascial System
Mandl-Weber, U.
Unpublished MSc thesis, 2000/10
4472

Anatomische Hypothese über den Musculus stylohyoideus und den Processus styloideus
(Anatomical hypothesis about Musculus stylohyoideus and Processus styloideus)
Firniss, M.
Unpublished D.O. thesis, 2000/10
4473

Osteoporosis
Cymet, T. C., Wood, B., Orbach, N.
The Journal of the American Osteopathic Association, 2000/10
4474

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text
4475

Managing common problems in perimenopausal women
Forstein, D. A.
The Journal of the American Osteopathic Association, 2000/10
4476

Endovascular treatment of peripheral arterial disease
Gray, B. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text
4477

Clinical use of selective estrogen receptor modulators
Krueger, P. M.
The Journal of the American Osteopathic Association, 2000/10
4478

Influencing the vegetative nervous system through manipulation. 1945
Northup, G. W.
The Journal of the American Osteopathic Association, 2000/10
Free full text
4479

Update: the latest on hormone replacement therapy
Packin, G. S.
The Journal of the American Osteopathic Association, 2000/10
Free full text
4480

The autonomic nervous system in osteopathic therapy. 1948
Waitley, D. D.
The Journal of the American Osteopathic Association, 2000/10
Free full text
4481

Individualizing treatment plan and combining approaches key to pain management and holistic care: a student's perspective
Lawlor, T. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text
4482

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text
4483

Osteopathy and heavy metals- demonstrated by copper secretion in urine
Wutzl, C.
Unpublished MSc thesis, 2000/09
4484

Carpal tunnel syndrome: more than just a problem at the wrist
Ramey, K. A.
The AAO Journal, 2000/09
Free full text
4485

Osteopathic cranial lesions. 1948
Kimberly, P. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
4486

Effects of a structured curriculum in osteopathic manipulative treatment (OMT) on osteopathic structural examinations and use of OMT for hospitalized patients
Shubrook, J. H., Jr., Dooley
The Journal of the American Osteopathic Association, 2000/09
Free full text
4487

Patients' satisfaction with osteopathic and GP management of low back pain in the same surgery
Pincus, T., Vogel, S., Savage, R., Newman, S.
Complementary Therapies in Medicine, 2000/09
4488

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09
4489

Osteopathic Manual Medicine and Acute Injuries
Coppola, G. W., Gilmore, J. L., Miars, C. W., Jacobs, A.
The Journal of the American Osteopathic Association, 2000/08
4490

Dangers of sleepiness and inattention while driving
Eberhart, R., Hu, X., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
4491

Sleep and breathing disorders: the genesis of obstructive sleep apnea
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
4492

Osteopathy and insanity. 1917
Gerdine, L. V.
The Journal of the American Osteopathic Association, 2000/08
Free full text
4493

A Randomized Controlled Trial of Osteopathic Manipulation Following Knee or Hip Arthroplasty
Licciardone, J. C., Stoll, S. T., Herron, K. M., Gamber, R. G., Swift, J., Winn, W.
The Journal of the American Osteopathic Association, 2000/08
4494

Schizophrenia. 1939
Hildreth, A. G., Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
4495

Effects of Osteopathic Manipulative Treatment on Knee Osteoarthritis
Pham, C. N., Knebl, J.
The Journal of the American Osteopathic Association, 2000/08
4496

Osteopathic and “old school“ results in mental diseases. 1933
Merrill, E. S.
The Journal of the American Osteopathic Association, 2000/08
Free full text
4497

Osteopathic Manipulation in the Management of Parkinson's Disease
Wells, M. R., McCarty, C. L., Smutny, C. J., Scandalis, T. A., Dittrich, F., Fazzini, E. A.
The Journal of the American Osteopathic Association, 2000/08
4498

Psychosis and osteopathy
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
4499

Opinions Toward The Use of OMT by Oklahoma D.O.s Responding to Surveys in 1984 and 1999
Yates, H., Johnson, J. C.
The Journal of the American Osteopathic Association, 2000/08
4500

Comparison of osteopathic and allopathic results in dementia praecox. 1933
Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
4501

The mechanism of anatomical structure in its relation to osteopathy. 1911
Bernard, H.
The Journal of the American Osteopathic Association, 2000/07
Free full text
4502

Use of a computer-assisted clinical case (CACC) SOAP note exercise to assess students' application of osteopathic principles and practice
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2000/07
Free full text
4503

Inhaled corticosteroid-induced bone loss and preventive strategies
Singh, R. F., Muskelly, C. C.
The Journal of the American Osteopathic Association, 2000/07
Free full text
4504

Osteopathic practice. 1903
Bernard, H. E.
The Journal of the American Osteopathic Association, 2000/06
Free full text
4505

Osteopathic manipulative treatment and Down syndrome
Funk, S. L.
The AAO Journal, 2000/06
Free full text
4506

From the Archives: Prenatal Care
Grow, O. P.
The AAO Journal, 2000/06
Free full text
4507

Osteopathic manipulative treatment in prenatal care: Evidence supporting improved outcomes and health policy implications
King, H. H.
The AAO Journal, 2000/06
Free full text
4508

Survey of medical ethics in US medical schools: a descriptive study
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2000/06
Free full text
4509

Another great article on osteopathic manipulative treatment
Zorski, K. C.
The Journal of the American Osteopathic Association, 2000/06
Free full text
4510

Single-blind randomised controlled trial of chemonucleolysis and manipulation in the treatment of symptomatic lumbar disc herniation
Burton, A. K., Tillotson, K. M., Cleary, J.
European Spine Journal, 2000/06
4511

Progressive inhibition of neuromuscular structures (PINS) technique
Dowling, D. J.
The Journal of the American Osteopathic Association, 2000/05
Free full text
4512

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05
4513

The treatment of influenza. 1918
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/05
Free full text
4514

Relationship between academic achievement and COMLEX-USA Level 1 performance: a multisite study
Baker, H. H., Foster, R. W., Bates, B. P., Cope, M. K., McWilliams, T. E., Musser, A., Yens, D.
The Journal of the American Osteopathic Association, 2000/04
Free full text
4515

Viscero-somatic and somato-visceral spinal reflexes. 1907
Burns, L.
The Journal of the American Osteopathic Association, 2000/04
Free full text
4516

Use of magnetic resonance imaging to diagnose common wrist disorders
DiMarcangelo, M. T., Smith, P. A.
The Journal of the American Osteopathic Association, 2000/04
Free full text
4517

National study of the impact of managed care on osteopathic physicians
Horan, J.
The Journal of the American Osteopathic Association, 2000/04
Free full text
4518

Osteopathie - Die sanfte Chirotherapie
(Osteopathy - The gentle chirotherapy)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2000/04
4519

Osteopathic treatment of low back pain
Sweetman, B. J.
The New England Journal of Medicine, 2000/03
4520

Research Directions From 1940-1988
Beal, M. C.
The AAO Journal, 2000/03
Free full text
4521

Brain Wave Pattern Changes in Children with ADD/ADHD following Osteopathic Manipulation: A Pilot Study
Blood, S. D., Hurwitz, B. A.
The AAO Journal, 2000/03
Free full text
4522

Case Study: OMT and Chronic Cephalgia
Brown, C. S.
The AAO Journal, 2000/03
Free full text
4523

Advancing Osteopathic Medicine in Health Care: Integrating OMM into Osteopathic Medical Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 2000/03
Free full text
4524

Lift Treatment in Naval Special Warfare (NSW) Personnel: A Retrospective Study
Lipton, J. A., Brooks, J. S., Hickey, M. J., Drew, B. G., Eggleston, M. T., Gemmer, C. H.
The AAO Journal, 2000/03
Free full text
4525

Case Study of a 42-year-old patient with Systemic Lupus Erythematosus
Zucker, N.
The AAO Journal, 2000/03
Free full text
4526

Refractory torticollis after a fall
Kaprow, M. G., Sandhouse, M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
4527

Surgical and medical treatment options for urge incontinence
Lonsway, J. M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
4528

Multiple sclerosis article ignores conventional and osteopathic treatment options
Schreier, E. M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
4529

Interstitial cystitis: a retrospective analysis of treatment with pentosan polysulfate and follow-up patient survey
Waters, M. G., Suleskey, J. F., Finkelstein, L. J., Van Overbeke, M. E., Zizza, V. J., Stommel, M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
4530

Research on OPP/OMT is Critical to the Profession's Future
Noone, S. J.
The AAO Journal, 2000/03
Free full text
4531

Letters to the Editor
Friedman, H. D., McMillin, D. L., Richards, D. G., Mein, E. A., Nelson, C. D., Kellam, R. T., Patriquin, D. A., Clark, R. C.
The AAO Journal, 2000/03
Free full text
4532

Osteopathic treatment of low back pain
Cherkin, D.
The New England Journal of Medicine, 2000/03
4533

Osteopathic treatment of low back pain
Foster, D., Johnson, M. D., Harrelson, A.
The New England Journal of Medicine, 2000/03
4534

Osteopathic treatment of low back pain
Oppenheim, J. S.
The New England Journal of Medicine, 2000/03
4535

Manual medicine treatment of the cervical spine and whiplash injury
Bilkey, W. J., Tomski, M. A.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
4536

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02
4537

Importance of empiricism in medicine
Hartman, S. E.
The Journal of the American Osteopathic Association, 2000/02
Free full text
4538

Benign prostatic hyperplasia treated with saw palmetto: a literature search and an experimental case study
McPartland, J. M., Pruitt, P. L.
The Journal of the American Osteopathic Association, 2000/02
Free full text
4539

The Comprehensive Osteopathic Medical Licensing Examination, COMLEX-USA: a new paradigm in testing and evaluation
Osborn, G. G., Meoli, F. G., Buser, B. R., Clearfield, M. B., Bruno, J. P., Sumner-Truax, L.
The Journal of the American Osteopathic Association, 2000/02
Free full text
4540

Paradox answered
Parker, C.
The Journal of the American Osteopathic Association, 2000/02
Free full text
4541

Physician recalls unforgettable evening in her early career
Wales, A. L.
The Journal of the American Osteopathic Association, 2000/02
Free full text
4542

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
4543

Management of osteoporosis in the new millennium
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2000/01
4544

Osteoporosis: a new understanding of its impact and pathogenesis
Chopra, A.
The Journal of the American Osteopathic Association, 2000/01
4545

Effective strategies for the prevention of osteoporosis across the life span
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2000/01
4546

Role of antileukotriene agents in asthma therapy
Gawchik, S. M., Saccar, C. L.
The Journal of the American Osteopathic Association, 2000/01
Free full text
4547

Osteopathy an independent system co-extensive with the science and art of healing. 1901
Littlejohn, J. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text
4548

Evaluation of osteoporosis
Nichols, K. J.
The Journal of the American Osteopathic Association, 2000/01
4549

OMT and diffuse musculoskeletal complaints following a motor vehicle accident
Bezilla, T. A.
The AAO Journal, 1999/12
Free full text
4550

Osteopathic treatment of asthma: A literature review and call for research
Jackson, K. M., Steele, K. M.
The AAO Journal, 1999/12
Free full text
4551

Importance of OMT cannot be overemphasized
Abend, D. S.
Journal of Osteopathic Medicine, 1999/12
Free full text
4552

Assessing the impact of complementary therapy on health status: a service evaluation of the benefits of acupuncture, homoeopathy and osteopathy using the SF-36 health survey and a waiting list control group
Richardson, J.
Unpublished PhD thesis, 1999/12
Free full text
4553

An overview of osteopathic medicine
Lesho, E. P.
Archives of Family Medicine, 1999/11
4554

New England Journal of Medicine article may be misleading about OMT
Coughlin, P., Kriebel, R., Fogel, R.
Journal of Osteopathic Medicine, 1999/11
Free full text
4555

A comparison of osteopathic spinal manipulation with standard care for patients with low back pain
Andersson, G. B., Lucente, T., Davis, A. M., Kappler, R. E., Lipton, J. A., Leurgans, S.
The New England Journal of Medicine, 1999/11
Free full text
4556

ABC of complementary medicine. The manipulative therapies: osteopathy and chiropractic
Vickers, A., Zollman, C.
The BMJ, 1999/10
4557

Standardized medical record: a new outpatient osteopathic SOAP note form: validation of a standardized office form against physician's progress notes
Sleszynski, S. L., Glonek, T., Kuchera, W. A.
Journal of Osteopathic Medicine, 1999/10
Free full text
4558

Die Entspannung der intracranialen Membranen bei Kindern mit hyperaktivem Verhaltenssyndrom
(Intracranial membrane tension release of children with hyperactive disorder)
Röh, N., Rütz, M.
Unpublished D.O. thesis, 1999/10
4559

(Intracranial membrane tension release of children with hyperactive disorder)
Die Entspannung der intracranialen Membranen bei Kindern mit hyperaktivem Verhaltenssyndrom
Röh, N., Rütz, M.
Unpublished D.O. thesis, 1999/10
4560

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain. A randomized controlled trial)
Adorjàn-Schaumann, A., Höhrhan, G., Wille, H., Wolff, A.
Unpublished D.O. thesis, 1999/10
4561

Low back pain in pregnancy
Gallagher, K. M.
The AAO Journal, 1999/09
Free full text
4562

A review of the principles of William G. Sutherland's general techniques
Golden, W. J.
The AAO Journal, 1999/09
Free full text
4563

Medical and osteopathic boards' positions on chaperones during gynecologic examinations
Stagno, S. J., Forster, H., Belinson, J.
Obstetrics & Gynecology, 1999/09
4564

Meniere's syndromes resulting from multiple traumatic brain injury: Two case studies
Lockhart, W. C.
The AAO Journal, 1999/09
Free full text
4565

Osteopathic manipulative treatment of an 8-year-old child born with anoxia
Morelli, M. A.
The AAO Journal, 1999/09
Free full text
4566

Professional identification and affiliation of the 1992 graduate class of the colleges of osteopathic medicine
Aguwa, M. I., Liechty, D. K.
Journal of Osteopathic Medicine, 1999/08
Free full text
4567

OMT and urinary incontinence
Farley, J. E.
The AAO Journal, 1999/06
Free full text
4568

MRI assessment of changes in swelling of wrist structures following OMT in patients with carpal tunnel syndrome
Ramey, K. A., Kappler, R. E., Chimata, M., Hohner, J., Mizera, A. C.
The AAO Journal, 1999/06
Free full text
4569

Comparison of work and time estimates by chiropractic physicians with those of medical and osteopathic providers
Hess, J. A., Mootz, R. D.
Journal of Manipulative and Physiological Therapeutics, 1999/06
4570

Osteopathy – A philosophical perspective
Masiello, D. J.
The AAO Journal, 1999/06
Free full text
4571

OMM beyond the classroom – The Future is now
Veneziano, M.
The AAO Journal, 1999/06
Free full text
4572

An osteopathic approach to asthma
Rowane, W. A., Rowane, M. P.
Journal of Osteopathic Medicine, 1999/05
Free full text
4573

The Effectiveness of CV-4 and Resting Position Techniques on Subjects with Tension-Type Headaches
Hanten, William P., Olson, Sharon L., Hodson, Jennifer L., Imler, Vickie L., Knab, Virginia M., Magee, Jennifer L.
Journal of Manual & Manipulative Therapy, 1999/04/01
4574

Dancing Elaine neck syndrome
Chin, C.
The AAO Journal, 1999/03
Free full text
4575

Adjunctive osteopathic manipulative treatment in the elderly hospitalized with pneumonia: a pilot study
Noll, D. R., Shores, J., Bryman, P. N., Masterson, E. V.
Journal of Osteopathic Medicine, 1999/03
Free full text
4576

Making a difference: the osteopathic approach lecture series
Danto, J. B., Kavieff, T. R.
Journal of Osteopathic Medicine, 1999/03
Free full text
4577

The Use of OMT in Stroke Rehabilitation
Maxwell, S.
The AAO Journal, 1999/03
Free full text
4578

The principles of osteopathic structural therapy – Part IV
Page, L. E.
The AAO Journal, 1999/03
Free full text
4579

Standard osteopathic manipulative treatment acutely improves gait performance in patients with Parkinson's disease
Wells, M. R., Giantinoto, S., D'Agate, D., Areman, R. D., Fazzini, E. A., Dowling, D., Bosak, A.
Journal of Osteopathic Medicine, 1999/02
Free full text
4580

Opinions of MDs, RNs, allied health practitioners toward osteopathic medicine and alternative therapies: results from a Vermont survey
McPartland, J. M., Pruit, P. L.
Journal of Osteopathic Medicine, 1999/02
Free full text
4581

Revisiting the role of osteopathic manipulation in primary care
Hopp, R. J.
Journal of Osteopathic Medicine, 1999/02
Free full text
4582

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament
Sucher, B. M., Hinrichs, R. N.
Journal of Osteopathic Medicine, 1998/12
Free full text
4583

The principles of osteopathic structural therapy – Part III
Page, L. E.
The AAO Journal, 1998/12
Free full text
4584

Women's health osteopathy: an alternative view
Hyne, J.
Nursing Management, 1998/12
4585

Case Study: OMT and the enlarged prostate
Smutney, C. J.
The AAO Journal, 1998/12
Free full text
4586

Scoliosis and Osteopathic Manipulative Treatment
Weatherly, J.
The AAO Journal, 1998/12
Free full text
4587

Missed cancer screening opportunities among older women: A provider survey
Gulitz, E., Bustillo-Hernandez, M., Kent, E. B.
Cancer Practice, 1998/11
4588

Die osteopathische Behandlung für Kinder mit Down-Syndrom mit Schwerpunkt auf dem Os Occipitale
(The osteopathic treatment for children with Down syndrome with emphasis on the Os Occipitale)
Kasack, A.
Unpublished D.O. thesis, 1998/10
4589

Sinusitus Supplement missing osteopathic component
Dudley, G.
Journal of Osteopathic Medicine, 1998/10
4590

Short leg syndrome
Lal, S.
The AAO Journal, 1998/09
Free full text
4591

Integrating cranial osteopathy with gnathologic orthopedics
Kennedy, J. M.
The Journal - American Academy of Gnathologic Orthopedics, 1998/09
4592

The origin and relief of common pain
Irvin, R. E.
Journal of Back and Musculoskeletal Rehabilitation, 1998/09
4593

The principles of osteopathic structural therapy – Part II
Page, L. E.
The AAO Journal, 1998/09
Free full text
4594

Case study: Neck and shoulder pain
Pasquarello, G.
The AAO Journal, 1998/09
Free full text
4595

Alternative therapies and complementary medicine: a mutiny in the making
Friedman, H. D.
Journal of Osteopathic Medicine, 1998/09
Free full text
4596

Scalene entrapment syndrome
Royder, J. O.
The AAO Journal, 1998/09
Free full text
4597

A chronic case with an unusual remedy
Taylor, V. A.
The AAO Journal, 1998/09
Free full text
4598

Dysfunction of the 'sacred' sacrum – Techniques for treating individual pole restrictions
Wells, K.
The AAO Journal, 1998/09
Free full text
4599

Physicians need to stand up to managed care
Rosenberg, P. K.
Journal of Osteopathic Medicine, 1998/08
Free full text
4600

A pilot study: Osteopathic treatment of infants with a sucking dysfunction
Fraval, M.
The AAO Journal, 1998/06
Free full text
4601

Solar Plexus Injuries: An old injury with a new twist
Jones, J. M., May, T.
The AAO Journal, 1998/06
Free full text
4602

The principles of osteopathic structural therapy – Part I
Page, L. E.
The AAO Journal, 1998/06
Free full text
4603

Case History
Strait, B. W.
The AAO Journal, 1998/06
Free full text
4604

Muscle energy concepts and coupled motion of the spine
Gibbons, P., Tehan, P.
Manual Therapy, 1998/05
4605

Coming full circle: osteopathic manipulative treatment and immunity
Allen, T. W.
Journal of Osteopathic Medicine, 1998/04
4606

Application of osteopathic principles to a viral upper respiratory infection
Cavanaugh, S. P.
The AAO Journal, 1998/03
Free full text
4607

Effect of lymphatic and splenic pump techniques on the antibody response to hepatitis B vaccine: a pilot study
Jackson, K. M., Steele, T. F., Dugan, E. P., Kukulka, G., Blue, W., Roberts, A.
Journal of Osteopathic Medicine, 1998/03
4608

Communication for osteopathic manipulative treatment (OMT): the language of lived experience in OMT pedagogy
Gaines, E., Chila, A. G.
Journal of Osteopathic Medicine, 1998/03
4609

Sinusitis and OMT
Sept, K.
The AAO Journal, 1998/03
Free full text
4610

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02
4611

Positional release techniques in the treatment of muscle and joint dysfunction
Chaitow, L.
Clinical Bulletin of Myofascial Therapy, 1998/01
4612

Inpatient osteopathic manipulative treatment: Impact on length of stay
Cantieri, M. S.
The AAO Journal, 1997/12
Free full text
4613

Motor-vehicle accident trauma
File, P. M.
The AAO Journal, 1997/12
Free full text
4614

Pain: a functional disorder
Ernst, E.
British Journal of General Practice, 1997/12
Free full text
4615

(Osteopathy treatment)
Osteopathie-Behandlung
Mach, J.
Deutsche Medizinische Wochenschrift, 1997/10
4616

The effects of muscle energy technique on lumbar range of motion
Schenk, R. J., MacDiarmid, A., Rousselle, J.
Journal of Manual and Manipulative Therapy, 1997/10
4617

Managing back pain in general practice--is osteopathy the new paradigm?
Williams, N.
British Journal of General Practice, 1997/10
Free full text
4618

Using heart variability to measure the effects of manual medicine on autonomic activity
Zullow, M.
Unpublished MSc thesis, 1997/10
4619

Osteopathic manipulative treatment: Practice use and and opinions of the Texas College of Osteopathic Medicine alumni
Gamber, R. G., Kennedy, D. A., Erickson, R. C., Moss, J. A., McKay Hart, C., Zengerle, C., Stone, R. C., Gish, E. E.
The AAO Journal, 1997/09
Free full text
4620

Case history: Low back pain with a radiating 'electric shock'
McCarty, C. L.
The AAO Journal, 1997/09
Free full text
4621

The effect of osteopathic manipulative treatment (OMT) on heart rate and blood pressure in female athletes
Paul, F. A., Norton, J. M., Cross, N. A., Buser, B. R.
The AAO Journal, 1997/09
Free full text
4622

Osteopathic manipulative treatment of Bell's palsy
Ulrich, R. F
The AAO Journal, 1997/09
Free full text
4623

The art of osteopathy
Wales, A. L.
The AAO Journal, 1997/09
Free full text
4624

The controversy of cranial bone motion
Rogers, J. S., Witt, P. L.
Journal of Orthopaedic & Sports Physical Therapy, 1997/08
4625

Comparison of performance on the American Osteopathic Board of Internal Medicine certifying examination 1986 to 1996 by type of residency
Slick, G. L.
Journal of Osteopathic Medicine, 1997/07
Free full text
4626

The hysteresis loop as a model for low back motion analysis
Warner, M. J., Mertz, J. A., Zimmerman, A. S.
Journal of Osteopathic Medicine, 1997/07
Free full text
4627

A successful use of cranial-sacral osteopathy in the treatment of post-traumatic headache following subarachnoid hemorrhage
Barke, L., Gelman, S., Lipton, J. A.
The AAO Journal, 1997/06
Free full text
4628

OMM and Asthma
Jealous, J. S.
The AAO Journal, 1997/06
Free full text
4629

Case study: Use of the pedal lymphatic pump in a patient with restless legs syndrome
Ragucci, M., Swanson, K., Cook, E.
The AAO Journal, 1997/06
Free full text
4630

Efficacy of osteopathic manipulative treatment in improving clinical outcomes in patients with orthopedic diagnoses admitted to a hospital-based rehabilitation unit
Brittain, P. D.
Unpublished MSc thesis, 1997/06
4631

Cervical spine manipulation: summary report of a systematic review of the literature and a multidisciplinary expert panel
Shekelle, P. G., Coulter, I.
Journal of Spinal Disorders, 1997/06
4632

Comparing medical knowledge of osteopathic medical trainees in DO and MD programs: a random effect meta-analysis
Shen, L., Cavalieri, T., Clearfield, M., Smoley, J.
Journal of Osteopathic Medicine, 1997/06
Free full text
4633

Introducing the cranial approach in osteopathy and the treatment of infants and mothers
Sullivan, C.
Complementary Therapies in Nursing and Midwifery, 1997/06
4634

Chest pain and the role of somatic dysfunction
Wax, C. M., Abend, D. S., Pearson, P. H.
Journal of Osteopathic Medicine, 1997/06
Free full text
4635

Muscle tones
Waldron, B. J.
The AAO Journal, 1997/06
Free full text
4636

From 'Osteopathic Manipulative Procedure in Disorders of the Eye'
Wolf, A. H.
The AAO Journal, 1997/06
Free full text
4637

Will failure to use OMT be grounds for malpractice?
Allen, T. W.
Journal of Osteopathic Medicine, 1997/05
Free full text
4638

Repositioning maneuver for benign paroxysmal positional vertigo (BPPV)
Brooks, J. G., Abidin, M. R.
Journal of Osteopathic Medicine, 1997/05
Free full text
4639

A randomized comparison of continuous versus interrupted mass closure of midline incisions in patients with gynecologic cancer
Colombo, M., Maggioni, A., Parma, G., Scalambrino, S., Milani, R.
Obstetrics & Gynecology, 1997/05
4640

Osteopathic medical considerations of reflex sympathetic dystrophy
Nelson, K. E.
Journal of Osteopathic Medicine, 1997/05
Free full text
4641

Osteopathic manipulation for low back pain
Abend, D. S.
Postgraduate Medicine, 1997/04
4642

Establishment of behavioral parameters for the evaluation of osteopathic treatment principles in a rat model of arthritis
Hallas, B., Lehman, S., Bosak, A., Tierney, S., Galler, R., Jacovina, P., Scandalis, T. A., Wells, M.
Journal of Osteopathic Medicine, 1997/04
Free full text
4643

Soft tissue manipulation: neuromuscular and muscle energy techniques
Roberts, B. L.
Journal of Neuroscience Nursing, 1997/04
4644

Case History: Intractable Low Back Pain
Koss, R. M.
The AAO Journal, 1997/03
Free full text
4645

Carpal Tunnel Syndrome
Miller, K.
The AAO Journal, 1997/03
Free full text
4646

Comparison of entrance requirements for health care professions
Doxey, T. T., Phillips, R. B.
Journal of Manipulative and Physiological Therapeutics, 1997/02
4647

Can DOs still 'circle the wagons'? Reflections on the use of osteopathic manipulative treatment
Fry, L. J.
Journal of Osteopathic Medicine, 1997/02
Free full text
4648

Variables influencing the use of osteopathic manipulative treatment in family practice
Johnson, S. M., Kurtz, M. E., Kurtz, J. C.
Journal of Osteopathic Medicine, 1997/02
Free full text
4649

Osteopathic manipulative treatment: student attitudes before and after intensive clinical exposure
Magnus, W. W., Gamber, R. G.
Journal of Osteopathic Medicine, 1997/02
Free full text
4650

Osteopathic physicians and expert medical testimony
McAbee, G. N.
Journal of Osteopathic Medicine, 1997/01
Free full text
4651

Pilot study to establish whether osteopathy reduces general practice consultation rate of musculoskeletal problems based on patient perception of effectiveness of the osteopathic treatment – Part II
Banihasem, M.
The AAO Journal, 1996/12
Free full text
4652

AAO Case History: Iatrogenic injury to the cranial mechanism
Skurla, R. W.
The AAO Journal, 1996/12
Free full text
4653

Obtaining credentials for osteopathic manipulative medicine
Kuchera, M. L.
American Family Physician, 1996/10
4654

A manipulative technique of Andrew Taylor Still as reported by Charles Hazzard, DO, in 1905
Van Buskirk, R. L.
The Journal of the American Osteopathic Association, 1996/10
Free full text
4655

Pilot study to establish whether osteopathy reduces general practice consultation rate of musculoskeletal problems based on patient perception of effectiveness of the osteopathic treatment – Part I
Banihasem, M.
The AAO Journal, 1996/09
Free full text
4656

The efficacy of osteopathic treatment for primary dysmenorrhea in young women
Chadwick, K., Morgan, A.
The AAO Journal, 1996/09
Free full text
4657

Standardization of the hospital record for osteopathic structural examination: Part 2. Effects of an educational intervention on documentation of palpatory and structural findings and diagnosis
Friedman, H. D., Johnston, W. L., Kelso, A. F., Schwartz, F. N., Beal, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 1996/09
Free full text
4658

AAO Case History: Common problems in newborn and infant
Sholars, H.
The AAO Journal, 1996/09
Free full text
4659

Craniosacral therapy
Elsdale, B.
Nursing Times, 1996/07
4660

Osteopathic manipulative treatment applications for the emergency department patient
Paul, F. A., Buser, B. R.
The Journal of the American Osteopathic Association, 1996/07
Free full text
4661

AAO Case Study: Recurrent Otitis Media
Gintis, B. R.
The AAO Journal, 1996/06
Free full text
4662

The Effects of Somatic Dysfunction on the Spinal Accessory Nerve (CN XI) with Subsequent Distal Dysfunction
Gorbis, S.
The AAO Journal, 1996/06
Free full text
4663

An Osteopathic Approach to HIV/AIDS
Mulligan, T.
The AAO Journal, 1996/06
Free full text
4664

(Diagnosis and therapy for reversible hypomobile dysfunction in the chest wall)
Neumann, H.D.
Manuelle Medizin, 1996/04
4665

A functional approach to heel lift therapy
Johnson, K. H.
The AAO Journal, 1996/03
Free full text
4666

Case History: Somatic dysfunctions related to chronic lumbar and hip strain
Jones, J. M.
The AAO Journal, 1996/03
Free full text
4667

Osteopathy and medical evolution (1962)
Korr, I. M.
The AAO Journal, 1996/03
Free full text
4668

Sacral shear: Review and a new treatment for obstetrical patients
Treadwell, R. C., Magnus, W. W.
The AAO Journal, 1996/03
Free full text
4669

Update on osteopathic medical concepts and the lymphatic system
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 1996/02
Free full text
4670

Preliminary findings on the use of osteopathic manipulative treatment by osteopathic physicians
Fry, L. J.
The Journal of the American Osteopathic Association, 1996/02
Free full text
4671

When it comes to OMT, do we practice what we preach?
Kasovac, M.
The Journal of the American Osteopathic Association, 1996/02
Free full text
4672

Studying the impact of women on osteopathic physician workforce predictions
Simpson, M. A., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/02
Free full text
4673

The safety of manipulative treatment: review of the literature from 1925 to 1993
Vick, D. A., McKay, C., Zengerle, C. R.
The Journal of the American Osteopathic Association, 1996/02
Free full text
4674

Marketing key to increased women applicants to COMs
Payson, S. M.
The Journal of the American Osteopathic Association, 1996/01
Free full text
4675

(Manual therapy, chiropractic, osteopathy. From alternative therapy to medicine)
Ylinen, J., Piispanen, J., Silen, K., Airaksinen, O.
Duodecim, 1996/01
4676

AAO Case Study: Trigeminal Neuralgia
Coffey, D.
The AAO Journal, 1995/12
Free full text
4677

Manipulation of the Eustachian Tube
Heatherington, J. S.
The AAO Journal, 1995/12
Free full text
4678

Structural and Hormonal Influences on Pelvic Mechanics in Labor and Delivery
Tettambel, M. A.
The AAO Journal, 1995/12
Free full text
4679

Female enrollment in colleges of osteopathic medicine: five years and five percentage points behind
Baker, H. H.
The Journal of the American Osteopathic Association, 1995/10
Free full text
4680

Hospital guidelines for diagnosis-related groups/osteopathic manipulative treatment
Feely, R. A.
The Journal of the American Osteopathic Association, 1995/09
Free full text
4681

Proposed matrix could yield bountiful 'harvest'
Stiles, E. G.
The Journal of the American Osteopathic Association, 1995/09
Free full text
4682

The Effect of Osteopathic Manipulative Treatment in the Post Abdominal Surgical Patient (A Preliminary Study)
Pratt-Harrington, D., Neptune-Ceran, R.
The AAO Journal, 1995/09
Free full text
4683

AAO Case Study: Demonstration of the Fundamental Tenent of Osteopathy
Stanley, S. A.
The AAO Journal, 1995/09
Free full text
4684

Phenobarbital-induced fibromyalgia as the cause of bilateral shoulder pain
Goldman, S. I., Krings, M. S.
The Journal of the American Osteopathic Association, 1995/08
Free full text
4685

Palpatory diagnosis and manipulative management of carpal tunnel syndrome: Part 2. 'Double crush' and thoracic outlet syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 1995/08
Free full text
4686

A standardized form for DSM-IV review of symptoms and mental status examination for students and residents
Reeves, R. R., Bullen, J. A.
The Journal of the American Osteopathic Association, 1995/06
Free full text
4687

Performance of osteopathic medical school graduates on the American Osteopathic Board of Internal Medicine certifying examinations 1985 to 1994
Slick, G. L., Dolan, S., Draba, R. E.
The Journal of the American Osteopathic Association, 1995/06
Free full text
4688

AAO Case Study: Severe Left Hip Pain
Tenpenny, S. J.
The AAO Journal, 1995/06
Free full text
4689

Nerve compression syndromes as models for research on osteopathic manipulative treatment
Luckenbill-Edds, L., Bechill, G. B.
The Journal of the American Osteopathic Association, 1995/05
Free full text
4690

Asthma Treated by Visceral Manipulation
Bensky, D.
The AAO Journal, 1995/03
Free full text
4691

AAO Case Study: Chronic Upper Extremity Pain
DeFeo, G. A.
The AAO Journal, 1995/03
Free full text
4692

Interexaminer agreement on palpatory diagnosis and patient self-assessment of disability: a pilot study
Beal, M. C., Patriquin, D. A.
The Journal of the American Osteopathic Association, 1995/02
Free full text
4693

Postnatal back care
Parsons, C.
The Modern Midwife, 1995/02
4694

Standardization of the hospital record for osteopathic structural examination: recording of musculoskeletal findings and somatic dysfunction diagnosis
Seffinger, M. A., Friedman, H. D., Johnston, W. L.
The Journal of the American Osteopathic Association, 1995/02
Free full text
4695

AAO Case History: Immune System
Wallace, E. M.
The AAO Journal, 1994/12
Free full text
4696

A Hypothesis for the Facilitated Segment Based Upon Biological Principles Associated with Tumorigenesis
Yonuschot, G., Mokler, J., Winterson, B. J.
The AAO Journal, 1994/12
Free full text
4697

Perception of Osteopathic Women Physician Leaders: Current Status and Future Directions
Chapello, I. A.
The AAO Journal, 1994/09
Free full text
4698

Management of the Cervical Area
Denslow, J. S.
The AAO Journal, 1994/09
Free full text
4699

AAO Case Study: Sinusitis
Sept, K.
The AAO Journal, 1994/09
Free full text
4700

Palpatory diagnosis and manipulative management of carpal tunnel syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 1994/08
Free full text
4701

Sutura continua di laparotomie con l'impiego di filo assorbibile ad asola secondo la tecnica di Smead Jones
(Continuous suture in laparotomy using an absorbable eyelet thread according to the Smead Jones technique)
Ribero, F., Canino, V., Comotti, F., Ragusa, L.
Minerva Chirurgica, 1994/08
4702

Osteopathic manipulation and injection therapy for low back pain
Orman, R.
American Family Physician, 1994/07
4703

AAO Case History: Postpartum Facial Palsy
Lee, R. P.
The AAO Journal, 1994/06
Free full text
4704

You can be both conventional and nonconventional
Abend, D. S.
Archives of Family Medicine, 1994/06
4705

Stranger in a New Land
Mills, M.
The AAO Journal, 1994/06
Free full text
4706

Osteopathic principles underlie treatment of back pain
Moncman, M.G.
The Journal of the American Osteopathic Association, 1994/06
Free full text
4707

Susan Osborne, DO. Interview by Ina May Gaskin
Osborne, S.
The Birth Gazette, 1994/03
4708

Opportunities and Issues for Osteopathic Hospitals
The AAO Journal, 1994/03
Free full text
4709

Manual Medicine and its Role in Psychiatry
Osborn, G. G.
The AAO Journal, 1994/03
Free full text
4710

Outcome Data for Patients Experiencing Chronic Pain
Stiles, E. G.
The AAO Journal, 1994/03
Free full text
4711

Osteopathy – How It Differs from Other Manual Methods
Woodall, P. H.
The AAO Journal, 1994/03
Free full text
4712

Effects of adding sacral base leveling to osteopathic manipulative treatment of back pain: a pilot study
Hoffman, K. S., Hoffman, L. L.
The Journal of the American Osteopathic Association, 1994/03
Free full text
4713

Effects of osteopathic manipulative treatment in patients with cervicothoracic pain: pilot study using thermography
Walko, E. J., Janouschek, C.
The Journal of the American Osteopathic Association, 1994/02
Free full text
4714

Osteopathic manipulative treatment: what does it really do?
Steiner, C.
The Journal of the American Osteopathic Association, 1994/01
Free full text
4715

Osteopathic manipulation for lumbar disk disease
Pearson, R. H.
American Family Physician, 1994/01
4716

Debate continues on the call to reform the profession
Terry, R. R., Comeaux, Z., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text
4717

The osteopathic distinction: fact or fancy?
Peppin, J. F.
The Journal of Medical Humanities, 1993/12
4718

Response: Debate continues on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/12
Free full text
4719

Osteopathic manipulation and tension-type headaches
Baird, R. E., Cullom, S., Deedman, R., Feeney, J., Kellogg, J., Simning, P., Stevens, M. B.
American Family Physician, 1993/11
4720

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text
4721

Primary care DOs, specialists--and OMM--important to profession
Wax, C. M.
The Journal of the American Osteopathic Association, 1993/09
Free full text
4722

AAO Case History
Somner, L.
The AAO Journal, 1993/09
Free full text
4723

Osteopathy vs chiropractic
Friedman, H.
The Journal of Family Practice, 1993/09
Free full text
4724

OMT enhances any medical regimen
Keller, J. A.
The Journal of the American Osteopathic Association, 1993/09
Free full text
4725

(Trends in therapy by “manipulation“, basic concepts of manual therapy)
A “müfogásokkal“ gyógyítás irányzatai, a manuális terápia alapfogalmai
Ormos, G.
Orvosi Hetilap, 1993/08
4726

Complementary medicine. Who prescribes these treatments and when?
Ernst, E.
British Medical Journal, 1993/07
Free full text
4727

Pioneer Women in Medicine
Carlton, C.
The AAO Journal, 1993/06
Free full text
4728

Investigating the role of osteopathic manipulation in the treatment of asthma
Allen, T. W., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 1993/06
Free full text
4729

Osteopathy, chiropractic, and spinal manipulation
Morehouse, M.
Annals of Internal Medicine, 1993/04
4730

Lower Back Pain In An Elderly Patient With Complicated History
Buser, B. R.
The AAO Journal, 1993/03
Free full text
4731

Integrating OMT Into The Hospital Setting
Jones, L. B.
The AAO Journal, 1993/03
Free full text
4732

Outcomes assessment: 'buzz words' in medical education whose time has come
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/03
Free full text
4733

Primary & Secondary Respiration – Part II
Lee, R. P.
The AAO Journal, 1993/03
Free full text
4734

Assessing outcomes of the educational program of the West Virginia School of Osteopathic Medicine
Cope, M. K., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text
4735

Panic Attack – Another View
Wright, H. O. L.
The AAO Journal, 1993/03
Free full text
4736

Early osteopathy gives best results
Nursing Standard, 1993/02
4737

Efficacy of high-velocity low-amplitude manipulative technique in subjects with low-back pain during menstrual cramping
Boesler, D., Warner, M., Alpers, A., Finnerty, E. P., Kilmore, M. A.
The Journal of the American Osteopathic Association, 1993/02
Free full text
4738

Progress in scientifically proving the benefits of OMT in treating symptoms of dysmenorrhea
Chapman, J. D.
The Journal of the American Osteopathic Association, 1993/02
Free full text
4739

Myofascial release of carpal tunnel syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text
4740

Manual force, mechanically assisted articular chiropractic technique using long and/or short level contacts
Bergmann, T. F.
Journal of Manipulative and Physiological Therapeutics, 1993/01
4741

Low back pain: Evaluation of osteopathic manipulation therapy via integration and power spectrum of electromyography and psychophysical-physical analysis
Park, H. K.
Unpublished PhD thesis, 1993/01
4742

Lower back pain: Evaluation of osteopathic manipulation therapy via magnetic resonance imaging and biomechanical modeling
Sumer, A.
Unpublished PhD thesis, 1993/01
4743

Integrate osteopathic principles and practices in postgraduate medical education--now
Kasovac, M., Jones, J. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text
4744

Valutazione riabilitativa su 18 casi di lesione del legamento crociato anteriore trattati chirurgicamente secondo la tecnica di Kenneth-Jones
(Rehabilitative evaluation of 18 cases of anterior cruciate ligament lesions surgically treated by the Kenneth-Jones technique)
Masserano, G., Montanaro, M., Poggi, G., Rusca, L., Vignali, F.
Minerva Medica, 1992/12
4745

Anatomy, Asthma and Dysautonomia
Sanders, E. C.
The AAO Journal, 1992/12
Free full text
4746

Abdominal wound closure using a running, looped monofilament polybutester suture: comparison to Smead-Jones closure in historic controls
Sutton, G., Morgan, S.
Obstetrics & Gynecology, 1992/10
4747

From the AOBSPOMM Files
Feely, R. A.
The AAO Journal, 1992/09
Free full text
4748

Manuelle Medizin an der Wirbelsäule--Indikation, diagnostische und therapeutische Möglichkeiten.
(Manual medicine of the spine--indication, diagnostic and therapeutic possibilities)
Kissling, R. O., Hochstrasser, R., Kubli, D.
Schweizerische Rundschau für Medizin Praxis, 1992/09
4749

Strategy for Addressing Third Party Payors on OMT
O'Connell, J. A.
The AAO Journal, 1992/09
Free full text
4750

Kudos to Dr Frymann and colleagues
Morey, L. W.
The Journal of the American Osteopathic Association, 1992/09
Free full text
4751

A Patient With Bilateral Shoulder Pain
Buser, B. R.
The AAO Journal, 1992/06
Free full text
4752

Somatic Dysfunction: A Neurophysiologic & Osteopathic Overview
Tsompanidis, A. J.
The AAO Journal, 1992/06
Free full text
4753

Rheumatoid Arthritis: The Incurable Disease?
Wright, H. O. L.
The AAO Journal, 1992/06
Free full text
4754

Effect of osteopathic medical management on neurologic development in children
Frymann, V. M., Carney, R. E., Springall, P.
The Journal of the American Osteopathic Association, 1992/06
Free full text
4755

An Integrated Approach for Treating the OB Patient: Treating the Five Diaphragms of the Body, Part II
Johnson, K.
The AAO Journal, 1992/03
Free full text
4756

The Patient Who Wouldn't Give Up
Wright, H. O. L.
The AAO Journal, 1992/03
Free full text
4757

Osteopathy & Chronic Pain
Miller, T. D.
The AAO Journal, 1992/03
Free full text
4758

An Integrated Approach for Treating the OB Patient: Treating the Five Diaphragms of the Body, Part I
Johnson, K.
The AAO Journal, 1991/12
Free full text
4759

Evaluation of Managed Care Contracting
Schnack, T. H.
The AAO Journal, 1991/12
Free full text
4760

A Disease Which No Longer Exists
Wright, H. O. L.
The AAO Journal, 1991/12
Free full text
4761

Alternative and complementary medicine for asthma
Lane, D. J., Lane, T. V.
Thorax, 1991/11
Free full text
4762

Incorporating OMT in hospital training
Cooper, G. J.
The Journal of the American Osteopathic Association, 1991/11
Free full text
4763

Pathophysiologic Models: Aids to the Selection of Manipulative Techniques
Hruby, R. J.
The AAO Journal, 1991/09
Free full text
4764

Cystic Fibrosis and a Victory for Osteopathic Methods: A Case History
Wright, H. O. L.
The AAO Journal, 1991/09
Free full text
4765

Insanity or Hypoglycemia?
Wright, H. O. L.
The AAO Journal, 1991/06
Free full text
4766

External cephalic version of term singleton breech presentations with tocolysis: a retrospective study in a community hospital
DeRosa, J., Anderle, L. J.
The Journal of the American Osteopathic Association, 1991/04
Free full text
4767

A Report to the Statutory Advisory Committee on Medical Care: Craniosacral Manipulation
Lee, R. P.
The AAO Journal, 1991/03
Free full text
4768

Who should teach osteopathic manipulative medicine?
Lo, K. S.
The Journal of the American Osteopathic Association, 1991/03
Free full text
4769

Not every DO masters the art of manipulation
Obarski, T. P.
The Journal of the American Osteopathic Association, 1991/03
Free full text
4770

To manipulate or not to manipulate, that is the question
Padgett, D. K.
The Journal of the American Osteopathic Association, 1991/03
Free full text
4771

Running mass closure of abdominal wounds using absorbable looped suture
Montz, F. J., Creasman, W. T., Eddy, G., Disaia, P. J.
Journal of Gynecological Surgery, 1991/02
4772

Our osteopathic uniqueness needs nurturing
Kuchera, W. A.
The Journal of the American Osteopathic Association, 1991/02
Free full text
4773

Erratum: An open controlled assessment of osteopathic manipulation in nonspecific low-back pain (Spine (15) 5 (364-370))
MacDonald, R. S., Bell, C. M. J.
Spine (Phila Pa 1976.), 1991/01
Free full text
4774

Osteopathic medicine
Eaton, J. A., Bates, B. P., Willard, F. H.
Orthopaedic Nursing, 1991/01
Free full text
4775

The theory of reasoned action as applied to the intention to enroll in an osteopathic medical school
Burnett, P. A.
Unpublished PhD thesis, 1991/01
4776

Do real DOs practice manipulation?
Cole, T. J.
The Journal of the American Osteopathic Association, 1990/12
Free full text
4777

Searching for clues to the origins of OMT
Beatty, D. R.
The Journal of the American Osteopathic Association, 1990/08
Free full text
4778

Time to reemphasize OMT as stress reliever
Northup, G. W.
The Journal of the American Osteopathic Association, 1990/08
Free full text
4779

The effect of helium-neon laser and osteopathic manipulation on soft-tissue trigger points
Greene, C. H., DeBias, D. A., Helig, D., Nicholas, A. S., England, K., Ehrenfeuchter, W., Young, W. L.
The Journal of the American Osteopathic Association, 1990/07
Free full text
4780

An open controlled assessment of osteopathic manipulation in nonspecific low-back pain
MacDonald, R. S., Bell, C. M. J.
Spine (Phila Pa 1976.), 1990/05
4781

Breastfeeding Opinions of Medical Students at the Oklahoma State University College of Osteopathic Medicine
Hoskins, J. A.
Unpublished MSc thesis, 1990/05
Free full text
4782

Quality assurance monitoring of osteopathic manipulative treatment
Koss, R. W.
The Journal of the American Osteopathic Association, 1990/05
Free full text
4783

Low back pain: Evaluation of osteopathic manipulation therapy via biomechanical modeling, electromyography, muscle rigidity and pain quantification
Bolecek-Skeggs, C. M.
Unpublished PhD thesis, 1990/01
4784

An integrated osteopathic treatment approach in acute otitis media
Pintal, W. J., Kurtz, M. E.
The Journal of the American Osteopathic Association, 1989/09
Free full text
4785

Cranial Osteopathy and Its Role in Disorders of the Temporomandibular Joint
Frymann, V. M.
Dental Clinics of North America, 1983/07
4786

A Comparison of the Views of Chiropractors and Osteopathic Physicians in Western Oregon Regarding the Clinical Indications for and the Scientific Rationale Underlying Manipulative Treatment of the Low Back
Gordon, G. F.
Unpublished PhD thesis, 1982/01
4787

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12
4788

Les modifications du stabilogramme qu'entraînent deux ajustements ostéopathiques sont cohérentes avec l'orientation sagittale ou frontale qu'ils impliquent.
(Changes in posture induced by 2 osteopathic manipulations are coherent with the sagittal or frontal orientation they involve)
Scheibel, A., Debusschere, M.
Agressologie: revue internationale de physio-biologie et de pharmacologie appliquées aux effets de l'agression
 
 
 






  • Impressum • Legal notice • Datenschutz •


ostlib.de/advanced



Supported by

OSTLIB recommends