Advanced search



 
 80.2% of the records
 
 19.8 % of the records
 
 57.9 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal hemodynamic maneuverabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabdominopelvic regionabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic detailingacademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute careacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute generalized exanthematous pustulosisacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadherenceadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadversityadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimers diseaseAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangiogramangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior scaleneanterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic enlargementaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial rulearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrographyarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical diabetesatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybicuspid aortic valvebifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanical responsebiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipartate patellabipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblackblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringblistersbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood oxygen saturationblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasebone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone metastasisbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachiocephalic vesselsbrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous emphysemabullous lesionsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcar accidentcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac apex anglecardiac arrestcardiac cirrhosiscardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabiliationcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCBTCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectionCECScecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular accidentcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic exertional compartment syndromechronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic orchialgiachronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccidioidomycosiscoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive latencycognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecold therapycold water exposurecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscolostomycomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconference registrationconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantscryotherapyCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademodex folliculitisdemographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentoalveolar systemdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic ketoacidosisdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary habitsdietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscolorationdiscontinued trialsdiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisembarkment syndromedisengagement-techniquedisinfectiondisinfection protocoldisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal kyphosisdorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug approvaldrug combinationdrug industrydrug legislationdrug prescriptionsdrug reactiondrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenal perforationduodenojejunal junctionduodenumdupilumabduplex scanningDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadysrhythmiadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaeczema herpeticumedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRejection fractionelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiogramselectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendoscopyendothelial dysfunctionendothelial functionendovascular retrievalenduranceendurance sportsenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophiliaeosinophilic fasciitiseosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal auditory canal exostosisexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubationextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyelidseyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfaceface masksfacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial neuropathyfacial painfacial paralysisfacial structurefacial swellingfacial tapingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfebrile neutrophilic dermatosisfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow rateflu testingfluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood attitudesfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenforamen magnumFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiant cell arteritisgiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonadal veingonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgoutgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegritgroingroin injurygroin paingroove signgross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth failuregrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaglund deformityhair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhand surgeryhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth motivationhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionalhealth professionalshealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemochromatosishemodialysishemodynamichemodynamic controlhemodynamicshemoglobinhemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehereditary spherocytosisHermansky-Pudlak syndromehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanicHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghorseshospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxemiahypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincident painincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury recoveryinjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinstrumentationinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview selectioninterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintimate partner violenceintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischemic strokeischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseisotretinoinITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. BockJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournal policyjournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansaskaposi varicelliform eruptionKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney diseasekidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage disorderslanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngeal cancerlaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTlead exposureleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukodermaleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelichen planus pigmentosus inversuslidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung cancerlung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmaltreatmentmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmaskmask mandatemasksMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMay-Thurner syndromeMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedical writingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetatarsophalangeal jointmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrosurgerymicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle scalenemiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal change diseaseminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymitral valve prolapsemix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonoclonal antibodiesmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular latencyneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnevus spilusnevus unius lateralisnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluonchocerciasisoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisonyxopen arteryopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen oval windowopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid usageopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan mobilityorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational behaviororganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic exerciseosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen supplyoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillary fibroelastomapapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepatent ductus arteriosuspatent foramen ovalepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatient-reported outcomespatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer recoverypeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceived weightperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferencepercutaneous coronary interventionperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericarditispericardiumperichondritisperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languageperson-first languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepolitical advocacypoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepositivismpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cortical atrophyposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprehabilitationprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature epiphyseal closurepremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbycusispresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional sportsprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurigo nodularisprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric distresspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary abscesspulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSpyoderma gangrenosumQ angleq-testQEEGqi gongqigongQLQ-C30qtc intervalquackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesracismradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrashrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreaction timereactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundrealismreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared blood cellsred flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulationsregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of liferiverboardingRL1-803rlq painRLSRobert Fulfordrobotic surgeryroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff intervalrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsscent detectionscent dogsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerodermasclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescrambler therapyscreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch interestsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-harmself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsseroprevalenceserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice dogsservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36SGLT2 inhibitorsshadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortageshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromeShulman syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin rashskin temperatureskin testsskin toneskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialtyspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatic cordspermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervespinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainsspringing techniquesprintsprintingSQOR-V questionnainnairesquamous cell carcinomasquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysterilizationsternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain injurystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous emphysemasubcutaneous hemorrhagesubjective cognitive declinesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital muscle inhibition techniquesuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden cardiac deathsudden infant death syndromeSudeck syndromeSufismsugarsuicidal ideationsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial heatsuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperior vena cava syndromesuperoxide anion radicalssupervised exercisesupervised injection sitessupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgSweets syndromeswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandswollen earsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic inertiatherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic surgerythoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthromboembolismthrombolytic therapythrombosisthrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocilizumabtocilizumab therapytocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatracheobronchial casttrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment algorithmstreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment tacticstreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrial qualitytrialstriamcinolone acetonidetriathletestribal healthcaretrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUgandaUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract diseaseurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccination statusvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvalvular heart diseasevancomycinvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular physiologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena cava filtervena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitamin deficienciesvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noisewhitewater kayakingWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework hourswork schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysxeroderma pigmentosumyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

838 results (please see below)  Sort:    
1

Reliability of spinal palpation for diagnosis of back and neck pain: a systematic review of the literature
Seffinger, M. A., Najm, W. I., Mishra, S. I., Adams, A., Dickerson, V. M., Murphy, L. S., Reinsch, S.
Spine (Phila Pa 1976), Oct 1
2

Effect of osteopathic technique on respiratory parameters and pain in thoracic outlet syndrome
Elshinnawy, A. M., Eraky, Z. S., Abdallah, E. A., Elmasry, H. M., El-Samouly, H. M.
Journal of Bodywork and Movement Therapies, 2026/06
3

Integrative approaches to the treatment of idiopathic facial neuropathy
(Интегративные подходы к лечению идиопатической невропатии лицевого нерва)
Novikov, Y. O., Musina, G. M., Akopian, A. P., Musina, S. M.
Russian Osteopathic Journal, 2026/03
4

The relationship between the dentoalveolar system and the musculoskeletal system
(Взаимосвязь зубочелюстной системы и опорно-двигательного аппарата)
Ovsyannikov, K. A., Fadeev, R. A., Mokhov, D. E.
Russian Osteopathic Journal, 2026/03
5

Stabilometry as a method of the osteopathic correction effectiveness assessment in patients with postoperative scars on the anterior abdominal wall and chronic nonspecific lower back pain
(Стабилометрия как метод оценки эффективности остеопатической коррекции у пациенток с послеоперационными рубцами на передней брюшной стенке и хронической неспецифической болью в нижней части спины)
Polismak, O. V., Potekhina, Y. P., Khatkevich, A. V.
Russian Osteopathic Journal, 2026/03
6

Journal Club 2026 – 1
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2026/03
7

Placebo-Effekte in der Osteopathie und anderen manuellen Therapien – Teil 2: Bedeutung für die klinische Praxis, Ausbildung und Forschung
(Placebo effects in osteopathy and other manual therapies – Part 2: Significance for clinical practice, training, and research)
Hohenschurz-Schmidt, D., Liem, T.
Osteopathische Medizin, 2026/03
8

Functional recovery after knee arthroplasty: The role of preoperative manual therapy
(Функциональное восстановление после эндопротезирования коленного сустава: роль предоперационной мануальной терапии)
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S., Linnik, S. A., Kvinikadze, G. E.
Russian Osteopathic Journal, 2026/03
9

Effects of osteopathic manipulative treatment on cardiovascular function: a systematic review and meta-analysis
Johnston, K., Chow, R., Rubinstein, M., Burtner, M., Hollander, S., Humm, A., Chen, L., DeArmond, M., Koshy-Chenthittayil, S., Hightower, C.
International Journal of Osteopathic Medicine, 2026/03
10

Immediate Effects of Osteopathic Manipulative Therapy on Thoracoabdominal Mobility, Respiratory Muscle Strength and Pulmonary Function in Healthy Men: Preliminary Crossover Trial
Zago, J., Rondinel, T., Urueña, B., Amatuzzi, F., Queiroz, R., Nascimento, L., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2026/03
11

Thoracic Biomechanics or Autonomic Modulation? Reframing the Respiratory Effects of Osteopathic Manipulative Therapy
Wahyudin, H.
International Journal of Osteopathic Medicine, 2026/03
12

Bridging the gaps: a holistic approach to strengthening the pediatric medical and surgical workforce
Okoro-Ajuzie, A., Grewal, R. S., Dhillon, M. K., Sees, J. P.
Journal of Osteopathic Medicine, 2026/02
Free full text
13

Pericardium-Focused Osteopathic Treatment in Chronic Cervicothoracic Pain Following Median Sternotomy for Cardiac Surgery
Shehadeh, H.
Cureus, 2026/02
Free full text
14

Challenging hierarchies and fostering collaboration: a critical discourse analysis of interprofessional education in healthcare training
Zorda, E. M., Sargent, M. A., Gose, C. E., Becker, M. T., Garber, S. S., DePrimo, A., Batteson, T.
Journal of Osteopathic Medicine, 2026/02
Free full text
15

Effects of the allopathic and osteopathic graduate medical education merger on U.S. specialty training: a review
Ibrahim, S., Abdelhady, M., Venckus, J., North, C., Bohler, F.
Medical Education Online, 2026/01
Free full text
16

Effect of COMLEX-USA Level 1 pass/fail score reporting on student stress, test preparation, and performance
Jin, R., Sandella, J. M., Gross, G. A., Dawley, M., Boulet, J., Mao, X., Wang, Y.
Journal of Osteopathic Medicine, 2026/01
Free full text
17

The impact of discontinuation and non-publishing of osteoporosis clinical trials
Kennington, D., Simonsen, A., Shae, W., Satterwhite, C.
Journal of Osteopathic Medicine, 2025/12
Free full text
18

Examiner reliability of a systematic osteopathic musculoskeletal examination model in patients with stroke: results from the SOMADC-AC study
Yee, A. H., Brooks, W. J., Palchik, G. A., Akers, B., Li, Y., Dossett, M. L.
Journal of Osteopathic Medicine, 2025/12
19

Placebo-Effekte in der Osteopathie und anderen manuellen Therapien – Teil 1: Hintergründe und Übersicht
(Placebo effects in osteopathy and other manual therapies – Part 1: Background and overview)
Hohenschurz-Schmidt, D., Liem, T.
Osteopathische Medizin, 2025/12
20

Erratum to: Longitudinal outcomes among patients with fibromyalgia, chronic widespread pain, or localized chronic low back pain
Licciardone, J. C., Brownell, E., Nwaichi, U., Patel, A., Do, K.
Journal of Osteopathic Medicine, 2025/12
Free full text
21

Characterization and comparison of osteopathic medical student performance in pathology and laboratory medicine: an analysis of competency in an integrated organ-systems curriculum
Harp, E., Hughes, G.
Journal of Osteopathic Medicine, 2025/12
22

Effects of Lymphatic Pump Treatment and Methotrexate in Arthritis Development and Behavior in Rats with Adjuvant-Induced Arthritis
Kafkis, C., Tamane, S., Manuel, M. J., Zanotti, B., Del Toro, R. M., Incrocci, R., Swanson-Mungerson, M., Volin, M. V.
Journal of Osteopathic Medicine, 2025/12
23

Aus der digitalen Welt: Das glymphatische System
(From the digital world: The glymphatic system)
Sonntag, M.
Osteopathische Medizin, 2025/12
24

Osteopathic Manipulative Treatment (OMT) for Injury Prevention in Collegiate Baseball Pitchers: Findings and Revised Protocol from a Feasibility Study on Shoulder and Hip Interventions
Nandedkar, T.
Journal of Osteopathic Medicine, 2025/12
25

The Escape Room Experience – A Novel Learning Modality to Reinforce Team-based Problem Solving, Communicating under Stress, and Tapping Group Knowledge Among “Trapped” Preclinical Osteopathic Medical Students
Renner, T., Imwalle, S., Cain, T. J.
Journal of Osteopathic Medicine, 2025/12
26

Improving the Reproducibility of the Standing Forward Flexion Test After Specific Training: A Cross-Sectional Study
Colonna, S, D'Alessandro, A., Pozzati, F., Venturi, M., Andrenacci, V., Romeo, D.
Cureus, 2025/12
Free full text
27

Efficacy of Osteopathic Manipulative Treatment for Postoperative Recovery Following Total Knee Arthroplasty: A Meta-Analysis of Randomized Controlled Trials
Oar, D. P., DeFrancisis, J. S., Boesler, D.
Cureus, 2025/12
Free full text
28

Breathing retraining and manual therapy for long COVID – A literature review
Courtney, R., Steele, Z., Collyer, I.
International Journal of Osteopathic Medicine, 2025/12
Free full text
29

The outcome of a short course of osteopathy for older adults with chronic musculoskeletal (MSK) pain. A single-arm, prospective feasibility study
Orchard, D., Bolt, D., Pinna, T., Antoni-Pineda, G.
International Journal of Osteopathic Medicine, 2025/12
30

A Retrospective Comparative Analysis of MD and DO Applicants' Acceptance to Plastic Surgery Residency
Yacoub, S. G., Guyler, M., Zak, A., Marlar, R., Obeid, R., Leavitt, W. III., Bernard, S., Isakov, R., Rampazzo, A., Gharb, B. B.
Annals of Plastic Surgery, 2025/12
31

Gut-Brain Axis in Inflammatory Bowel Disease: Pathogenesis and Therapeutics
Perry, S., Pillarisetti, L., Gelfman, T., Agrawal, D. K.
Archives of Internal Medicine Research, 2025/12
Free full text
32

Assessing the Efficacy of Osteopathic Manipulative Therapy (OMT) in Managing Chronic Back Pain: A Narrative Review
Tu Zahra, H., Farheen, A., Farooq Bacha, Z., Anas Patni, M.
Dubai Medical Journal, 2025/12
33

Osteopathic Manipulative Treatment Protocol for Postoperative Care Following Abdominal Surgery: A Quality Improvement Project
Genewick, J., Amendolara, A., Robinson, S., McDonough, M., Loera, M., Stacey, S. K.
Cureus, 2025/12
Free full text
34

Autonomic Rehabilitation: Cardiovagal and Autonomic Impacts of Post Isometric Muscle Energy at the Upper Cervical Spine
Miller, A., Curran, C., Fanous, S., Nakashima, T., Yates, H., Johns, J., Fotopoulos, T., Gustin, D., Wilson, J., McAllister, J., Moon, J., Thornburgh, K., Wenner, A., Garg, R., Gharbo, R.
The AAO Journal, 2025/12
35

Corrigendum to “Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution”
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/12
36

Rationale for the use of osteopathic correction in the complex rehabilitation of chronic nonspecific low back pain in patients with postoperative scars on the anterior abdominal wall
(Обоснование применения остеопатической коррекции в комплексной реабилитации пациенток с послеоперационными рубцами на передней брюшной стенке и хронической неспецифической болью в нижней части спины)
Polismak, O. V., Potekhina, Y. P., Khatkevich, A. V., Paykov, A. Y.
Russian Osteopathic Journal, 2025/12
37

Manual therapy in preoperative preparation of patients with knee arthroplasty
(Мануальная терапия в предоперационной подготовке пациентов с эндопротезированием коленного сустава)
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/12
38

Osteopathic manipulative treatment improves mobility restrictions and statics in a patient with a pectus excavatum after a sternochondroplasty. A case report
Jeandey, K., Le Nohaïc, A., Solovei, L., Gourjon, G.
Explore, 2025/11
39

The role of osteopathic manipulative medicine in cerebral palsy: bridging treatment gaps and enhancing care
Ngo, A. L., Gharavi Alkhansari, N., Tadakamalla, R., Hess, M., Nguyen, U. T., Yazji, J., Rogers, R. S.
Journal of Osteopathic Medicine, 2025/11
Free full text
40

Reliabilität des faszialen Beckentests in der globalen osteopathischen Befundung
(Reliability of the fascial pelvic test in the global osteopathic assessment)
Meissl, A.
Unpublished MSc thesis, 2025/11
41

A preliminary study on the effect of quantified cranial osteopathic manipulation on wild-type and transgenic rat models of Alzheimer's disease
Hines, D., Tobey, H., Dugan, P., Boehringer, S., Helm, R., Anandakrishnan, R., Werre, S., VandeVord, P., Costa, B. M.
Journal of Alzheimer's Disease Reports, 2025/11
Free full text
42

Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Bethea, J., Sharma, H., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
Cureus, 2025/10
Free full text
43

Corrigendum to: Comprehensive review of the heart failure management guidelines presented by the American College of Cardiology and the current supporting evidence
Lazareva, L., Shubrook, J. H., Dhond, M.
Journal of Osteopathic Medicine, 2025/10
Free full text
44

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10
45

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10
46

The Predictors of COMLEX-USA (Comprehensive Osteopathic Medical Licensing Examination of the United States) Level 1 Success Among Osteopathic Medical Students: The Role of Study Habits and Post-baccalaureate Background
Shults, R., Belizaire, S., Kennedy, C., Chosie, K.
Cureus, 2025/10
Free full text
47

Osteopathic Approaches in the Diagnosis and Treatment of Temporomandibular Joint Dysfunction: An Interdisciplinary Review
Makichyan, T., Frolov, V., Habadze, Z., Starodubtseva, E., Dolzhikov, N., Avetisian, G., Rasulova, D.
Georgian Medical News, 2025/10
Free full text
48

Corrigendum to: The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T.H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/09
Free full text
49

Interrater Reliability of a Manual Diagnostic Protocol for Pancreatic Functional Visceral Dysfunction
Faria, M., Machado, N., de Sousa, M. C., Pires, P. M., Pires, T.
Journal of Integrative and Complementary Medicine, 2025/09
50

Manual Therapy in Post-operative Knee Management: A Systematic Review of Effects on Pain in Total Knee Replacement (TKR) Patients
Sahni, S., Fares, J. E., Jordan, H.
Cureus, 2025/09
Free full text
51

Retrospective Study of Osteopathic Manipulative Treatment on Length of Stay and Opioid Use After Vestibular Schwannoma Resection
Chen, A. I., Golshan, S., Schwartz, M. S., Friedman, R. A.
Otology & Neurotology Open, 2025/09
52

Equity reporting in systematic reviews and meta-analysis for geographic atrophy: a PROGRESS-Plus assessment
Emmert, R., McKenzie, T., Smith, D., Russell, H., Schultheis, G., Hartwell, M.
Journal of Osteopathic Medicine, 2025/09
Free full text
53

Dermatology match disparities: analyzing osteopathic vs. allopathic student outcomes post-ACGME/AOA single accreditation system (2020-2024)
Wan, L., Bawa, K., Park, A., Kadri, H., Cusick, A., Trotter, S. C.
Journal of Osteopathic Medicine, 2025/09
54

The Emerging Role of Osteopathic Manipulative Medicine in Enhancing Quality of Life for Palliative and End-of-Life Patients: A Narrative Review
Ngo, A. L., Nguyen, L., Shahbandeh, C., Nichols, J.
Cureus, 2025/09
Free full text
55

Erythromelalgia: a cutaneous manifestation of polycythemia vera
Saad, M., Dazé, R.
Journal of Osteopathic Medicine, 2025/09
Free full text
56

Use of a community care coordination team to reduce emergency department utilization and hospital readmissions for the highest utilizers
Shipman, S., Painter, K., Epperson, L. C., Smith, K.
Journal of Osteopathic Medicine, 2025/09
Free full text
57

Post-COVID-19 Respiratory Dysfunction and Musculoskeletal Pain: Improvement with Osteopathic Manipulative Treatment (OMT)
Dehghani Ashkezari, A., Graber, Z., Yao, S. C.
The AAO Journal, 2025/09
58

Impact of Osteopathic Manipulative Treatment on Improving Function and Restoring Quality of Life After Sternoclavicular Joint Resection
Krueger, A., Schaefer, M.
The AAO Journal, 2025/09
59

Physiological substantiation of the effect of mechanical impact on internal organs (literature review
(Физиологическое обоснование влияния механических воздействий на внутренние органы (обзор литературы)
Ikhlef, A., Potekhina, Y. P., Simenko, E. V.
Russian Osteopathic Journal, 2025/09
60

Osteopathy as a direction of integrative medicine
(Остеопатия как направление интегративной медицины)
Moiseev, V. I.
Russian Osteopathic Journal, 2025/09
61

Corrigendum to: Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/08
Free full text
62

The effect of osteopathic manipulative treatment on length of stay and pain relief in pediatric appendectomy: a pilot non-randomized time-controlled clinical trial
Lo Piccolo, R., Cantagalli, M. M., Ferroni, T., Fracchiolla, F., Morabito, A.
Frontiers in Pediatrics, 2025/08
Free full text
63

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text
64

Integrating a Microbiology Laboratory Improves the Attitudes and Performance of First-Year Osteopathic Medical Students
Hrach, V. L.
Cureus, 2025/08
Free full text
65

Osteopathic diagnosis and treatment of the spine in patients with chronic back pain through the lens of medical infrared thermography: A randomized controlled pilot study
Bohlen, L., Biester, A., Rapp, O., Wentzel, J., Liem, T., Cerritelli, F., Schmidt, T.
Complementary Therapies in Clinical Practice, 2025/08
66

Rezul'taty primeneniya manual'noi terapii pri degenerativnykh zabolevaniyakh pozvonochnika s radikulopatiei i bez nee (Obzor literatury)
(Results of manual therapy in degenerative spine diseases with and without radiculopathy (Literature review))
Gameeva, E. V., Miryutova, N. F., Badalov, N. G., Novikov, Y. O., Stepanova, A. M., Tonkoshkurova, A. V.
Problems of Balneology, Physiotherapy and Exercise Therapy, 2025/08
67

Impact of osteopathic tests on heart rate and heart rate variability: an observational study on osteopathic students
Gillet, F., Gault, M., Dussault, V., Cheggour, S., Grinand, M., Martinez, P.
Journal of Osteopathic Medicine, 2025/08
Free full text
68

Effects of osteopathic treatments in a patient who underwent two cardiac surgeries - A case report
Aubin, A., Bekhazi, J., Fortin, A., Paradis, A., Morin, C.
International Journal of Osteopathic Medicine, 2025/06
69

Development of Standardized Osteopathic Manipulative Treatment Tracking Forms Recording Pain and Functional Outcomes to Facilitate Osteopathic Research
Joseph, C., Mintle, L. S., Hoegerl, C., Asher, D., Adams, K., Fugler, P., McKinney, J.
International Journal of Osteopathic Medicine, 2025/06
70

Inter-rater and intra-rater reliability of belt-stabilized hand-held dynamometer using make test in lower extremity muscle strength assessment among healthy adults
Espino, R. V. S., Gonzalez-Suarez, C., Ingram, L. A., Gomez, I. N. B., Agarao, K. A. T., Flores, J. G., Bulseco, N.
International Journal of Osteopathic Medicine, 2025/06
71

Optimization of Abdominal Surgery and Controlling Intractable Neuropathic Pain with Peri-operative OMT
Cruz, C., Ural, E., Gailius, G. C., Neuer, K.
The AAO Journal, 2025/06
72

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma—Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text
73

A Novel Calibration Methodology for Osteopathic Manipulative Medicine Research: Improving Study Validity by Standardizing Intra-researcher Techniques
Hahn, D., Krakowski, M., Kadriovski, S., Pierides, M., Velasquez, L., Volokitin, M.
The AAO Journal, 2025/06
74

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06
75

The Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Sharma, H., Bethea, J., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
The AAO Journal, 2025/06
76

Besteht eine Korrelation zwischen dem Zink-Test und den gängigen HVR-Parameter, gemessen an einer heterogenen Stichprobe, die sich aus Long-/Post-COVID-19-Syndrom PatientInnen und einer Kontrollgruppe zusammensetzt? und Bestehen Unterschiede in den Ergebnissen des Zink-Test zwischen der Gruppe der Long-/Post-COVID-19-Syndrom PatientInnen und der Kontrollgruppe?
(Is there a correlation between the CCP and commonly used HRV-Parameters, measured in a heterogeneous sample consisting of Long-/post-COVID-19-Syndrom patients and a control group, Are there differences in the CCP between the patient group and the control group)
Klupsch, K.
Unpublished MSc thesis, 2025/06
77

Effekte der Osteopathie auf die HRV, die NRS und die Lebensqualität bei Patientinnen mit primärer Dysmenorrhoe: Eine integrative Fallserie
(Effects of Osteopathy on HRV, NRS, and Quality of Life in Patients with Primary Dysmenorrhea: An Integrative Case Series)
Markovics, M.
Unpublished MSc thesis, 2025/06
78

Integrative medicine
(Интегративная медицина)
Shabrov, A. V., Mokhov, D. E., Tregubova, E. S., Korotkov, K. G., Moiseev, V. I., Partsernyak, S. A.
Russian Osteopathic Journal, 2025/06
79

Osteopathische Nachbehandlung alter offener Appendektomien und ihre Auswirkung auf chronische Rückenschmerzen – eine pragmatische, quasirandomisierte, kontrollierte Pilotstudie
(Effect of Osteopathic Treatment After Historical Open Appendectomy on Chronic Low Back Pain: A Pragmatic Quasi-Randomized Controlled Pilot Study)
Rottensteiner, M.
Unpublished MSc thesis, 2025/06
80

Effekte einer osteopathischen Behandlung auf die Herzratenvariabilität bei Patientinnen mit Colitis Ulcerosa: Eine integrative Fallserie
(Effects of Osteopathic Treatment on Heart Rate Variability in Patients with Ulcerative Colitis: An Integrative Case Series)
Schabauer, O.
Unpublished MSc thesis, 2025/06
81

Die Auswirkung einer kranialen venösen Drainage auf die Konzentrationsleistung bei Personen im Alter von vierzig bis sechzig Jahren: eine randomisierte kontrollierte Studie
Wöckinger, M.
Unpublished MSc thesis, 2025/06
82

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/06
83

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma-Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text
84

Efficiency of physical therapy and osteopathic techniques in the treatment of operated and recurrent lumbar disc herniation - a case report
Antohe, B.A., Rață, M., Rață, B., Rață, G.
Journal of Bodywork and Movement Therapies, 2025/06
85

Pilot study MOVENDOP protocol - impact on quality of life following postoperative osteopathic abdominal mobilizations in patients operated for endometriosis
Comptour, A., Dechambenoit, C., Kwiatkowski, F., Vidal, A., Duval, M., De Antonio, M., Jacobs, A., Bourdel, N.
PLoS One, 2025/05
Free full text
86

Breath of Relief: Osteopathic Manipulative Treatment of Chronic Postoperative Pain in a Bilateral Lung Transplant Patient
Duggal, V., Finkelstein, A., Radigan, R., Bhushan, P.
Cureus, 2025/05
Free full text
87

Author Correction: Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., Perpetuini, D., Keys, J., Merla, A., Cardone, D.
Scientific Reports, 2025/05
Free full text
88

Reduction in deep organ-space infection in gynecologic oncology surgery with use of oral antibiotic bowel preparation: a retrospective cohort analysis
Kennedy, K., Gaertner-Otto, J., Lim, E.
Journal of Osteopathic Medicine, 2025/05
Free full text
89

Effects of the Strong Hearts program at two years post program completion
Murphy, B. E., Card, P. D., Ramirez-Kelly, L., Wensley, B., Heidel, R. E.
Journal of Osteopathic Medicine, 2025/05
Free full text
90

Recent and future trends in osteopathic orthopedic surgery residency match rates following the transition to a single accreditation system
Turnow, M., Nemani, M. G., Gupta, N., Hartman, H., Manes, T., Williamson, T., Gianakos, A.
Journal of Osteopathic Medicine, 2025/05
Free full text
91

Osteopathic, logopedic and psychological assessment to improve outcome in patients undergoing cardiac surgery: A randomized clinical trial (TITANIC trial)
Volpato, E., Stilo, L., Tavanelli, M., Bordoni, B., Oreni, L., Toccafondi, A., Moraschi, A., Morici, N.
European Journal of Preventive Cardiology, 2025/05
92

Fascial Manual Medicine: The Concept of Fascial Continuum
Bordoni, B., Escher, A. R.
Cureus, 2025/04
Free full text
93

Patient-Practitioner-Environment Synchronization: Four-Step Process for Integrating Interprofessional and Distinctive Competencies in Osteopathic Practice-A Scoping Review with Integrative Hypothesis
Lunghi, C., Baroni, F., D'Alessandro, G., Consorti, G., Tramontano, M., Stubbe, L., Conte, J., Liem, T., Zegarra-Parodi, R.
Healthcare, 2025/04
Free full text
94

Evaluation of the effectiveness of osteopathic treatment on the mother-newborn dyad in the event of painful breastfeeding in a maternity hospital despite the application of all usual aids: randomized interventional trial in two parallel arms without blinding
Elleau, C., Missmahl, C., Belcadi, W., Aurillac-Lavignolle, V., Sentilhes, L.
Frontiers in Nutrition, 2025/04
Free full text
95

Alleviating abnormal stress on compressed cranial sutures: a potential mechanism for treating and preventing deformational plagiocephaly
Ye, X., Huang, J., Liu, Y., Sun, Q., Zhang, F., Shen, W., Chen, H., Liu, L., Chen, S., Yang, N., Yan, M., Liu, Z.
Italian Journal of Pediatrics, 2025/04
Free full text
96

Tradition-Dismissive vs. Tradition Reconceptualization Approaches in Musculoskeletal Care: The Example of Osteopathic Care
DAlessandro, G., Lunghi, C., Consorti, G., Zanon, S., Berti, F., Turinetto, M., Di Pietrantonio, L., Longobardi, M., Zegarra-Parodi, R., Baroni, F.
Applied Sciences, 2025/03
Free full text
97

Efficacy of preoperative exercise rehabilitation for patients after total knee arthroplasty: An updated systematic review and meta-analysis
Zhou, Y., Wang, S.
International Journal of Osteopathic Medicine, 2025/03
98

Indigenous Epistemological Frameworks and Evidence-Informed Approaches to Consciousness and Body Representations in Osteopathic Care: A Call for Academic Engagement
Zegarra-Parodi, R., Loum, T., D&rsquo, Alessandro, G., Baroni, F., Zweedijk, R., Schillinger, S., Conte, J., Mehl-Madrona, L., Lunghi, C.
Healthcare, 2025/03
99

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R, 2025/03
100

Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., David, P., Jordan, K., Arcangelo, M., Daniela, C.
Scientific Reports, 2025/03
Free full text
101

Osteopathische Behandlung therapieresistenter Schmerzen: Chronisch abdominaler Schmerz, eingeschränkte Atmung und Unverträglichkeit von Schmerzmitteln bei Zustand nach Colon-ascendens-Karzinom
(Osteopathic treatment of therapy-resistant pain: Chronic abdominal pain, restricted breathing and intolerance to painkillers in the condition after ascending colon cancer)
Geilgens, A., Repik, I.
Osteopathische Medizin, 2025/03
102

Effect of osteopathic correction on the manifestations of postcholecystectomy syndrome
(Влияние остеопатической коррекции на проявления постхолецистэктомического синдрома)
Bibikov, A. A., Nenashkina, E. N., Oreshko, A. Y.
Russian Osteopathic Journal, 2025/03
103

Non-medicamentous methods in conservative treatment and preoperative preparation of patients with gonarthritis (literature review
(Немедикаментозные методы в консервативном лечении и предоперационной подготовке пациентов с гонартритом (обзор литературы)
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/03
104

Usage of local infrared thermometry to objectify local and regional somatic dysfunctions in patients with cervical dorsopathy
(Применение локальной инфракрасной термометрии для объективизации локальных и региональных соматических дисфункций у пациентов с дорсопатией шейного отдела позвоночника)
Belash, V. O., Mokhov, D. E.
Russian Osteopathic Journal, 2025/03
105

Comparison of the functional activity of fibroblast culture taken from preschool children and adults after surgery
(Сравнение функциональной активности культуры фибробластов, взятых у детей дошкольного возраста и у взрослых после оперативного вмешательства)
Aptekar, I. A., Abramova, E. V., Kostolomova, E. G., Sukhovey, Y. G., Aptekar, V. I.
Russian Osteopathic Journal, 2025/03
106

Diaphragm functions and their disorder during artificial ventilation of the lungs (literature review)
Функции диафрагмы и их нарушение при искусственной вентиляции легких (обзор литературы)
Tolmachev, K. M., Potekhina, Y. P.
Russian Osteopathic Journal, 2025/03
107

Osteopathic Manual Therapy Versus Conventional Conservative Therapy in the Management of Temporomandibular Disorders
Rahman, S.
Journal of Modern Health and Rehabilitation Sciences, 2025/03
Free full text
108

Integration of Osteopathy in Portuguese National Health Service: Perceptions and Expectations of Citizens and Health Professionals
Maria, B., Gomes, S., Goes, A. R.
International Journal of Osteopathic Medicine, 2025/02
Free full text
109

“The Dark Side of Musculoskeletal Care”: Why Do Ineffective Techniques Seem to Work? A Comprehensive Review of Complementary and Alternative Therapies
Mamud-Meroni, L., Tarcaya, G. E., Carrasco-Uribarren, A., Rossettini, G., Flores-Cortes, M., Ceballos-Laita, L.
Biomedicines, 2025/02
Free full text
110

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text
111

“There is a way to work together“: A qualitative study on complementary medicine therapists' perceptions of their role in the Swiss healthcare system
Dubois, J., Rodondi, P.Y., Akre, C.
Complementary Therapies in Clinical Practice, 2025/02
Free full text
112

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text
113

Comprehensive review of the heart failure management guidelines presented by the American College of Cardiology and the current supporting evidence
Lazareva, L., Shubrook, J. H., Dhond, M.
Journal of Osteopathic Medicine, 2025/01
Free full text
114

An Unusual Presentation of Respiratory Dysfunction in Parkinson’s Disease: A Case Study
Rundquist, L. D., Lyons, S. E., Moljo, R. J., Blavo, C.
Cureus, 2025/01
Free full text
115

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
116

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text
117

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01
118

O efeito do tratamento manipulativo osteopático na função pulmonar em pós-operatório imediato de lobectomia ou segmentectomia, um estudo clínico randomizado
(The Effect of Osteopathic Manipulative Treatment on Pulmonary Function in the Immediate Postoperative Period Following Lobectomy or Segmentectomy: A Randomized Clinical Trial)
Ferreira, L. B.
Unpublished MSc thesis, 2025/01
Free full text
119

Osteopathic Manipulative Treatment During Post-operative Recovery: A Scoping Review
Randall, C. G., Paul, H. A., Lumley, H., Ortega, A., Rowley, J., Brown, B., Mohan, S., Smith, K., Messer, T., Swan, E., Mehra, R. S.
Cureus, 2024/2
Free full text
120

Dynamometry for the assessment of trunk muscle strength in postpartum women with pregnancy-related posterior pelvic girdle pain: A reliability study
Jafarian, F.S., Jafari-Harandi, M., Yeowell, G., Sadeghi-Demneh, E.
International Journal of Osteopathic Medicine, 2024/12
121

Neuropsychiatric considerations in treating anorexia nervosa patients with osteopathic manipulative medicine: a narrative review
Talebi-Talghian, T., Schulz, P., Huzij, T.
Journal of Osteopathic Medicine, 2024/12
Free full text
122

Physiological Mechanisms Underlying the Primary Respiratory Mechanism (PRM) and Cranial Rhythmic Impulse (CRI) in Osteopathy: A Systematic Review
Mériaux, F., Stubbe, L., Guyon, A.
Healthcare, 2024/12
Free full text
123

Autonomic Nervous System and Viscera-Related Responses to Manual Therapy: A Narrative Overview
Alanazi, M. S., Degenhardt, B., Franklin, G., Jacobson, E., Fritz, S., Kettner, N., Kremen, V., Lipke, L., Reed, W. R.
International Journal of Osteopathic Medicine, 2024/12
Free full text
124

An appraisal of neuroimmune changes and potential benefits of Osteopathic Manipulative Treatment integration with therapeutic management of Post COVID-19 Condition: a literature review
Senigagliesi, F., Scialla, S., Marasco, M. L.
International Journal of Osteopathic Medicine, 2024/12
125

Evidence-informed approach of sighs in the scope of osteopathic practice
Vicart, A., Wagner, A.
International Journal of Osteopathic Medicine, 2024/12
126

Evaluating perspectives, knowledge and behaviors of osteopathic medicine in a United States osteopathic medical school: A study in employee education and changes in understanding
Glaser, K., Roberts, J., Coleman, M. K., Payton, M., Wilke, S., Linton, M., Waller, J.
International Journal of Osteopathic Medicine, 2024/12
127

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität – Teil 2: Ergebnisse der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability - Part 2: Results of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/12
128

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12
129

Multifaceted Therapeutic Approaches for the Management of Dyspareunia: A Narrative Review
Rastogi, M., Deka, K., Krishnan, S., Narayan, A., Nayak, M. M., Kumar, K. V.
The Open Public Health Journal, 2024/12
Free full text
130

Manual medical technologies in complex treatment and rehabilitation of patients with primary osteoarthritis (literature review
(Мануальные медицинские технологии в комплексном лечении и реабилитации пациентов с первичным остеоартритом (обзор литературы)
Mokhov, A. D., Belyaeva, I. B., Mokhov, D. E., Gavrilova, T. A.
Russian Osteopathic Journal, 2024/12
131

A Quantitative Program Evaluation of Restorative Justice Practices at United States Medical Schools
Harrison Schulman, J.
Unpublished MSc thesis, 2024/12
132

The use of respiratory patient reported outcome measures (PROMs) in the management of COPD: Perceptions of Australian osteopaths
Engel, R., Baxter, D., Muddle, L., Vaughan, B., Grace, S.
Complementary Therapies in Clinical Practice, 2024/11
Free full text
133

Eine Inter-Rater-Reliabilitätsstudie zur anterolateralen Mobilitätstestung des proximalen Tibiofibulargelenks
(An inter-rater reliability study for the anterolateral mobility test of the proximal tibiofibular joint)
Gomm, E.
Unpublished MSc thesis, 2024/11
134

Die Interrater Reliabilität des passiven Mobilitätstest des Os Coccygis im Sitzen
(The inter-rater reliability of the passive motion test of the os coccygis in the sitting position)
Ouschan, J.
Unpublished MSc thesis, 2024/11
135

Effizienz einer osteopathischen Intervention des Diaphragma bei Betroffenen mit Amyotropher Lateralsklerose (ALS)
(Efficacy of osteopathic intervention through the Diaphragm technique in ALS patients)
Wendel, J.
Unpublished MSc thesis, 2024/11
136

Corrigendum to: A superficial dissection approach to the sphenopalatine (pterygopalatine) ganglion to emphasize osteopathic clinical relevance
Matz, O. C., Rudberg-Post, L. J., Gustafson, H. C., Hartwell, L. E., Matz, D. G.
Journal of Osteopathic Medicine, 2024/10
Free full text
137

The Effect of an Anatomy Prep Course on OMS-1 Student's Performance During the Fall Semester
Prasad, D. M., Inman, A. M., Blanc, P. K., Gaunt, J. A., Guzik, H. M., Peterson, J. L.
Clinical Anatomy, 2024/10
138

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10
139

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität: Teil 1 – Ziele, Material und Methoden der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability: Part 1 - Objectives, material and methods of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/09
140

Das respiratorisch-zirkulatorische Modell in der osteopathischen Praxis
Tozzi, P.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
141

Osteopathic Considerations in the Medical Treatment of a Patient with COVID-Related Respiratory Distress
Yang, Y., Carnes, M., Kingery, J., Stiles, E.
The AAO Journal, 2024/09
142

The method of the etiological factor′s evaluation of the gingival recession, with count of their′s separately and common complicity in the pathogenesis
(Системный подход к изучению этиологических факторов рецессии десны с учётом их дифференциального и интегрального влияния на патогенез)
Nosova, M. A., Sharov, A. N., Trunin, D. A., Posnikov, M. A., Aptekar, I. A., Privalova, K. A.
Russian Osteopathic Journal, 2024/09
143

Chronic Rhinosinusitis Management: A Narrative Review Comparing Interventional Treatment With Osteopathic Manipulation
Klover, C. R., Gorantla, V. R.
Cureus, 2024/09
Free full text
144

Efectos de la terapia osteopática en pacientes intervenidos quirúrgicamente de esternotomía media por problemas cardíacos
(Effects of osteopathic therapy in patients who have undergone median sternotomy surgery for heart problems)
Garro Sais, C.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
145

A Test of Reliability: Cranial Rhythmic Impulse for Distant Diagnoses
Alvarez, L. A., Cook, A. C., Sweeney, C. P., Walter, M. R., South, S. C., Myers, N., Boesler, D., Ma, S., Thomas, K., Quinn, T. A.
Cureus, 2024/08
Free full text
146

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text
147

Inhibition zwischen zwei Somatischen Dysfunktionen messbar machen
(Making inhibition between two Somatic Dysfunctions measureable)
Lemburg, K.
Unpublished MSc thesis, 2024/08
148

Post-operative osteopathic manipulative treatment of Morel-Lavallee syndrome assessed using infrared thermal imaging: A case report
Maillot, C., Riquet, D., Stubbe, L., Bodnar, J.L., Houel, N.
Journal of Bodywork and Movement Therapies, 2024/07
Free full text
149

The Neurophysiological Effects of Craniosacral Treatment on Heart Rate Variability: A Systematic Review of Literature and Meta-Analysis
Cook, A. C., Egli, A. E., Cohen, N. E., Bernardi, K., Chae, M. Y., Kapalko, B. A., Coyne, S. A., Scott, R.
Cureus, 2024/07
Free full text
150

Evidence of anchoring bias in novice (first year) osteopathic French students in the context of the primary respiratory mechanism: A randomized-experimental study
Driaï-Allègre, C., Coste, F., Olmière, C., Grinand, M., Le Nohaïc, A., Romanet, F., Gourjon, G.
International Journal of Osteopathic Medicine, 2024/06
151

Effects of osteopathic manipulative therapy on recurrent pelvic pain and dyspareunia in women after surgery for endometriosis: a retrospective study
Alboni, C., Melegari, S., Camacho Mattos, L., Farulla, A.
Minerva Obstetrics and Gynecology, 2024/06
152

Die Inter- Rater- Reliabilitätstestung des Vorlauftests im Stand und im Sitz
(Inter- rater- reliability of the standing and sitting forward flexion test in symptomatic and asymptomatic adults)
Flicker-Niederl, T.
Unpublished MSc thesis, 2024/06
153

Fasziale Manipulation© nach Stecco: Interrater-Reliabiltätstestung der Palpationsprüfung
(Fascial Manipulation© by Stecco: Interrater Reliability of the Palpation Evaluation)
Floner, M.
Unpublished MSc thesis, 2024/06
154

Die Intertester-Reliabilität des lumbosakralen Spring-Tests in Bauchlage
(The inter-rater reliability of the lumbosacral spring test in prone position)
Kampl, A.
Unpublished MSc thesis, 2024/06
155

ISG-Bewegungstest nach Becker – Eine Inter-Rater-Reliabilitätsstudie
(ISG mobility test according to Becker - An inter-rater reliability study)
Simon, M.
Unpublished MSc thesis, 2024/06
156

An Osteopathic Approach to Prolonged Surgical Scar and Epidural Site Pain after Cesarean Section: A Case Study
Whitaker, Z., Gailius, G.
The AAO Journal, 2024/06
157

Die Inter Rater- Reliabilitätstestung des Vorlauftests im Stand und im Sitz
(Inter- rater- reliability of the standing and sitting forward flexion test in symptomatic and asymptomatic adults)
Flicker-Niederl, T.
Unpublished MSc thesis, 2024/06
158

Invasive Beatmung und prolongiertes Weaning: Auswirkungen osteopathischer Techniksequenzen
(Invasive ventilation and prolonged weaning. Effects of osteopathic sequences of techniques)
Boehme, A., Thönnessen, P., Ibel, R.
Osteopathische Medizin, 2024/06
159

Osteopathic Management of Chronic Pain Following Bilateral Periacetabular Osteotomy in Developmental Hip Dysplasia
Edgar, T., Heller, G. R., Hutson, M., Melin, D., Bardowell, A.
The AAO Journal, 2024/06
160

“That’s The Way We Have Always Done It”: Resetting the Hips
Tschantz, V., Fremarek, N., Hammond, E., Digambar, S., Vargas, E., Harden, D., Tobey, A. H., Kozar, A. J.
The AAO Journal, 2024/06
161

Manual Therapy Interventions in Patients With Chronic Obstructive Pulmonary Disease: A Comprehensive Narrative Review
Chilhate, P. K., Lalwani, L.
Cureus, 2024/06
Free full text
162

The Fascial Relationships Between the Psoas and the Respiratory Diaphragm
Li, V., Voas, A., Delaney, C., Wirth, K., Gubatina Jr., A., Figueroa, J. S., Woolley, A.
The AAO Journal, 2024/06
163

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06
164

Impact of Cervical High-Velocity, Low-Amplitude Osteopathic Manipulative Technique on Blood Flow in the Middle Cerebral, Internal Carotid, and Vertebral Arteries
Mehmert, R., Troyer, E., Jones, J., Stull, C., Brunk-Grady, M., Kondrashov, P.
The AAO Journal, 2024/06
165

A Qualitative and Quantitative Analysis of Suboccipital Release on Heart Rate Variability
Moon, J., Fotopoulos, T. J., Gustin, D., Thornburgh, K. R., Wenner, A. R., McAllister, J. M.
The AAO Journal, 2024/06
166

Post Isometric Muscle Energy at the Cervical Spine (OA, C1, C2) Increases Vagal Tone as Quantified by Heart Rate Variability Metrics
Nakashima, T., Curran, C., Yates, H., Fanous, S., Johns, J., Fotopoulos, T. J., Miller, A.
The AAO Journal, 2024/06
167

Post-surgical Median Arcuate Ligament Syndrome (MALS) Symptom Exacerbation Treated With Osteopathic Manipulative Treatment (OMT): A Case Report
Volokitin, M., Bergman, A.
Cureus, 2024/06
Free full text
168

Research integrity and academic medicine: the pressure to publish and research misconduct
Kearney, M., Downing, M., Gignac, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text
169

Interrater-Reliabilität des O'Brien-Tests
(Interrater reliability of the O'Brien test)
Rautenstengel, R.
Unpublished MSc thesis, 2024/05
170

Immediate Effects of Integrative Health and Medicine Modalities Among Outpatients With Moderate-To-Severe Symptoms
Rodgers-Melnick, S. N., Srinivasan, R., Rivard, R. L., Adan, F., Dusek, J. A.
Global Advances in Integrative Medicine and Health, 2024/05
Free full text
171

Interrater-Reliabilität des O'Brien-Tests
(Interrater reliability of the O'Brien test)
Rautenstengel, R.
Unpublished MSc thesis, 2024/05
172

The Effects of Osteopathic Manipulative Treatment (OMT) on Postoperative Length of Stay: A Meta-Analysis
Henwood, L., Le Donne, M. E., Vaughn, A., Kamil, S., Harrington, A., Scott, R.
Cureus, 2024/05
Free full text
173

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text
174

The effectiveness of an osteopathic manual technique compared with a breathing exercise on vagal tone as indicated by heart rate variability, a crossover study
Cavanagh, M., Cope, T., Smith, D., Tolley, I., Orrock, P., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text
175

Reliabilität der Testung der 4 Diaphragmen nach dem Zink - Modell (Inter-rater Test Studie)
(Reliability of testing the 4 diaphragms according to the zink-model (inter-rater test study))
Hansmann, M.
Unpublished MSc thesis, 2024/04
176

Effect of manual osteopathic techniques on the autonomic nervous system, respiratory system function and head-cervical-shoulder complex—a systematic review
Stępnik, J., Czaprowski, D., Kędra, A.
Frontiers in Medicine, 2024/04
Free full text
177

Der unmittelbare Effekt einer osteopathischen Behandlung des Caecums - bei PatientInnen nach offener Appendektomie - auf die lumbopelvine Mobilität: eine randomisierte kontrollierte Studie
(The immediate effect of osteopathic treatment of the caecum - in patients after open appendectomy - on lumbopelvic mobility: a randomized controlled trial)
Prodinger, R.
Unpublished MSc thesis, 2024/04
178

Overview of Treatment Options for Mild Traumatic Brain Injury: A Literature Review
Patel, H., Polam, S., Joseph, R.
Cureus, 2024/04
Free full text
179

A framework for the interpretation of heart rate variability applied to transcutaneous auricular vagus nerve stimulation and osteopathic manipulation
Kania, A., Roufail, J., Prokop, J., Stauss, H. M.
Physiological Reports, 2024/03
Free full text
180

Inter-rater and intra-rater reliability of manual assessment of respiratory motion in patients with unilateral cervical radiculopathy: A cross-sectional study
Kordi Yoosefinejad, A., Yousefiyan, R., Nazari, R., Rezaei, I.
International Journal of Osteopathic Medicine, 2024/03
181

The inter- and intra-rater reliability of the manual diaphragm assessment scale in healthy participants
Viegas, I., Francisco, C., Farinha, E., Nunes, A.
International Journal of Osteopathic Medicine, 2024/03
182

Osteopathic status of children doing karate
(Остеопатический статус детей, занимающихся карате)
Ryauzova, M. V., Dmitriev, A. A., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/03
183

Fallbericht einer psychosomatischen Osteopathie
(Case report of psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2024/03
Free full text
184

Osteopathische Behandlungsmöglichkeiten chronisch entzündlicher Darmerkrankungen: Eine qualitative Analyse von Interviews
(Osteopathic treatment options for chronic inflammatory bowel disease: A qualitative analysis of interviews)
Pestonit, J. F., Hesse, T.
Osteopathische Medizin, 2024/03
185

The evolution of type 2 diabetes management: glycemic control and beyond with SGLT-2 inhibitors and GLP-1 receptor agonists
Serowik, T. C., Pantalone, K. M.
Journal of Osteopathic Medicine, 2024/03
Free full text
186

Interrater agreement and reliability of a palpation method for locating C1 transverse process in the cervical spine
Ferreira, A. P. A., Maddaluno, M. L. M., Curi, A. C. C., Ferreira, A. d. S.
International Journal of Osteopathic Medicine, 2024/03
187

Application Of Osteopathic Treatment for Non-Pain–Related Discomforts of Pregnancy: A Literature Review
Gomperts, J., Carroll, L., Powers, B., Rodriguez, A.
Osteopathic Family Physician, 2024/02
188

Analysis of Variation in the Origin of the Obturator Artery in Midwestern American Donor Bodies
Diemer, C., Schubert, B., Funk, S., Markand, S.
Cureus, 2024/02
Free full text
189

Reliability and Validity of the Variability Model Testing Procedure for Somatic Dysfunction Assessment: A Comparison with Gait Analysis Parameters in Healthy Subjects
Vismara, L., Bergna, A., Tarantino, A. G., Dal Farra, F., Buffone, F., Vendramin, D., Cimolin, V., Cerfoglio, S., Pradotto, L. G., Mauro, A.
Healthcare, 2024/02
Free full text
190

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text
191

Das Mundatmungssyndrom in der osteopathischen Praxis
(Mouth breathing syndrome in the osteopathic practice)
Keller, M., Brümmer, M., Schulz, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
192

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text
193

Does Osteopathic Heart-Focused Palpation Modify Heart Rate Variability in Stressed Participants with Musculoskeletal Pain? A Randomised Controlled Pilot Study
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Healthcare, 2024/01
Free full text
194

Integrating Osteopathic Principles for Enhanced Dermatological Outcomes: A Literature Review
Ventura, N., Soti, V.
Cureus, 2024/01
Free full text
195

Construct validity and reliability of a test for sacroiliac dysfunction: Downing test
Ribeiro, R. P., Guerrero, F. G., Camargo, E. N., Pivotto, L. R., Aimi, M. A., Candotti, C. T., Loss, J. F.
International Journal of Osteopathic Medicine, 2023/12
196

Application of high-velocity low-amplitude technique in cervicothoracic junction produces cardiovascular responses in subjects with C7-T1 dysfunction: Randomized crossover trial
Zago, J., de Souza, B. U. L., Amatuzzi, F., Rondinel, T. Z., Queiroz, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2023/12
197

A Literature Review on the Potential Benefits of OMM on the Cervical Region for Race Car Drivers Before and After Motorsports Races
Chung, T. C., Sicari, G., Shoup, D., Keane, J. F., Goldstein, L. B.
Journal of Osteopathic Medicine, 2023/12
198

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12
199

Osteopathic Cranial Manipulation and its Possible Application in Managing Hypertension for the Optimization of Care
Jackson, S., Chung, T. C., Arellano, A., Keane, J. F., Goldstein, L. B.
Journal of Osteopathic Medicine, 2023/12
200

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12
201

The Efficacy of Osteopathic Manipulation Treatment (OMT) on Post-Operative Outcomes: An Abstract
Reddy, P., Santhakumar, K.
Journal of Osteopathic Medicine, 2023/12
202

Neurophysiology, Neuro-Immune Interactions, and Mechanobiology in Osteopathy in the Cranial Field: An Evidence-Informed Perspective for a Scientific Rationale
Barsotti, N., Casini, A., Chiera, M., Lunghi, C., Fornari, M.
Healthcare, 2023/11
Free full text
203

Interrater-Reliabilität des dynamischen Michaelis-Rauten-Tests bei StudienteilnehmerInnen mit und ohne lumbale und/oder urogenitale Beschwerden
(Interrater reliability of the dynamic Michaelis diamond test in study participants with and without lumbar and/or urogenital complaints)
Crone, A.
Unpublished MSc thesis, 2023/11
204

Interrater-Reliabilität eines Mobilitätstests der Harnblase bei symptomatischen und asymptomatischen Frauen
(Interrater reliability of a mobility test of the urinary bladder in symptomatic and asymptomatic women)
Hopfner, R.
Unpublished MSc thesis, 2023/11
205

Testung der Interrater Reliabilität bei Verwendung der MED-Skala zur Mobilitätstestung des Diaphragmas abdominale
(Testing of interrater reliability when using the MED scale for mobility testing of the abdominal diaphragm)
Pleterski, L.
Unpublished MSc thesis, 2023/11
206

Der Effekt einer osteopathischen Behandlung verglichen mit einer Scheinbehandlung, auf das autonome Nervensystem, gemessen mit der Herzratenvariabilität, bei Long/Post COVID-19 Patienten mit Fatigue Syndrom: Eine klinische randomisierte kontrollierte Studie
(The effect of osteopathic treatment compared with sham treatment on the autonomic nervous system, as measured by heart rate variability, in long/post COVID-19 patients with fatigue syndrome: A clinical randomized controlled trial)
Pöhlmann, T.
Unpublished MSc thesis, 2023/11
207

Interrater-Reliabilität des Active Straight Leg Raise Tests
(Interrater reliability of the Active Straight Leg Raise Test)
Tinodi, N.
Unpublished MSc thesis, 2023/11
208

Ein systematischer Überblick über die Wirkung der Osteopathie auf die Atemfunktion bei gesunden und kranken Erwachsenen
(A Systematic Review on the Effect of Osteopathic Treatment on Respiratory Function in Healthy and Sick Adults)
Haas, E.
Unpublished MSc thesis, 2023/11
209

Palpation von Hypomobilität im distalen Tibiofibulargelenk
(Palpation of hypomobility of the distal tibiofibular joint)
Kunter, T.
Unpublished MSc thesis, 2023/11
Free full text
210

Interrater-Reliabilitätstestung des kranialen Ecoute-Tests der Dura mater spinalis
(Inter-rater reliability for the cranial Ecoute-Test of the Dura mater spinalis)
Raffeiner, E.
Unpublished MSc thesis, 2023/11
211

Interrater-Reliabilität des Tissue Tension Tests
(The interrater reliability of the Tissue Tension Test)
Roch, M.
Unpublished MSc thesis, 2023/11
212

Die Wirksamkeit osteopathischer Interventionen auf die Parameter FEV1 and FVC gemessen mittels Spirometrie
(Effectiveness of osteopathic interventions on the spirometric values FEV1 and FVC)
Söllradl, C.
Unpublished MSc thesis, 2023/11
213

Uterusmobilität – eine Inter-Rater-Reliabilitätsstudie
(Uterine mobility test – an inter-rater-reliability study)
Wuschko, M.
Unpublished MSc thesis, 2023/11
214

Pericardial Adhesion and Chronic Non-Specific Neck Pain following Thoracentesis: An Osteopathic Approach
Bordoni, B., Escher, A.
Clinics and Practice, 2023/10
Free full text
215

Implementation of an enhanced recovery after surgery (ERAS) protocol for total abdominal hysterectomies in the division of gynecologic oncology: a network-wide quality improvement initiative
Ackert, K. E., Bauerle, W., Pellegrino, A. N., Stoltzfus, J., Pateman, S., Graves, D., Graul, A., Taylor, N., Zighelboim, I.
Journal of Osteopathic Medicine, 2023/10
Free full text
216

Effect of acupuncture combined with rehabilitation on Postoperative gastrointestinal dysfunction after abdominal operation
Xing, W.
Clinical Nutrition ESPEN, 2023/10
217

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text
218

Case History #4
Coffey, D.
The AAO Journal, 2023/09
Free full text
219

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09
220

The effectiveness of disinfection protocols in medical school osteopathic manipulative medicine labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/09
Free full text
221

Osteopathic Manipulative Therapy (OMT) as an adjunct to postoperative care for patients with gynecologic malignancies (174)
Ettorre, V., Wagreich, A., Meelheim, B., Torres, J.
Gynecologic Oncology, 2023/09
222

Short-term effects on heart rate variability of occipito-mastoid suture normalization in healthy subjects
Besson, C., Mur, T., Benaim, C., Schmitt, L., Gremeaux, V.
Frontiers in Neuroscience, 2023/09
Free full text
223

Equal but Separate: The Slow Assimilation of Osteopathic Surgery Residents Two Years After the Unified Match
Bello, G., Lyles, E., Owens, S., Wilson, A. S., Westby, R. W., Evans, W., Edmondson, E., Lindsey, T. G. II., Falcone, J. L., Boyev, A.
Journal of Surgical Education, 2023/09
224

Osteopathic manipulative treatment for concussions and postconcussive syndrome in athletes: a literature review
Thomas, K. D., Lombard, Z. K., Shadiack, A. L.
Journal of Osteopathic Medicine, 2023/08
Free full text
225

Effects of the Fourth Ventricle Compression Technique and Rib Raising Osteopathic Technique on Autonomic Nervous System Activity Measured by Heart Rate Variability in 35 Healthy Individuals
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2023/08
Free full text
226

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text
227

Peritoneal Adhesions in Osteopathic Medicine: Theory, Part 1
Bordoni, B., Escher, A. R., Girgenti, G. T.
Cureus, 2023/07
Free full text
228

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/07
229

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text
230

Osteopathy—A philosophical perspective. Reflections on Sutherland’s experience of the tide
Masiello, D. J.
The AAO Journal, 2023/06
Free full text
231

Examination of “The Tide,” CRI, and Physiologic Respiration: A Mathematical Analysis
Berkowitz, M. R.
The AAO Journal, 2023/06
Free full text
232

A Case of Chronic Postoperative Abdominal Wall Pain Successfully Treated with the Fascial Distortion Model
Pelletier, J., Boucher, J.
The AAO Journal, 2023/06
Free full text
233

The Effect of OMT on Insulin Sensitivity and Glucose Control in Rodent Models: A Pilot Study
Petrillo, G., Cai, W., Keys, J.
The AAO Journal, 2023/06
Free full text
234

Das Ligamentum gastrophrenicum: Über die Verbindung vom Zwerchfell zum Magen
(The gastrophenic ligament: About the connection of the diaphragm to the stomach)
Kleimeyer, S.
Osteopathische Medizin, 2023/06
Free full text
235

26.2 Miles: A Case Study of Osteopathic Manipulative Treatment in Marathon Training
Sofka, M., Giovanis, A.
The AAO Journal, 2023/06
Free full text
236

Osteopathic Manipulative Treatment of Chronic Pelvic Pain due to High-Tone Pelvic Floor Dysfunction
Barnett, M. E., Henderson, K. K., Elliott-Burke, T. L., Heinking, K. P.
Osteopathic Family Physician, 2023/06
237

Exploring the effects of standardized soft tissue mobilization on the viscoelastic properties, pressure threshold and touch threshold of the caesarean section scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2023/06
238

Osteopathy in the Early Diagnosis and Management of Degenerative Cervical Myelopathy: National Survey
Brannigan, J. F. M., Mowforth, O. D., Rogers, M., Wood, H., Karimi, Z., Kotter, M. R. N., Davies, B. M.
JMIR Formative Research, 2023/05
Free full text
239

The effect of cranial techniques on the heart rate variability response to psychological stress test in firefighter cadets
Wójcik, M., Siatkowski, I.
Scientific Reports, 2023/05
Free full text
240

The Short-Term and Long-Term Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D. Y., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
241

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
242

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text
243

Validation of subjective manual palpation using objective physiological recordings of the cranial rhythmic impulse during osteopathic manipulative intervention
Pelz, H., Müller, G., Keller, M., Mathiak, K., Mayer, J., Borik, S., Perlitz, V.
Scientific Reports, 2023/04
Free full text
244

Osteopathic Findings and Treatment of Patient with Crohn's Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text
245

Naturwissenschaftliche Entsprechungen für osteopathische Begriffe: Ausgehend von ursprünglichen Überlegungen des Rollin Becker
(Scientific equivalents of osteopathic terms: Starting from original thoughts of Rollin Becker)
Pelz, H.
Osteopathische Medizin, 2023/03
Free full text
246

Covid-19 Fatigue: Diagnosis and Treatment for the Osteopathic Physician
Foss, V. B., Maddie, N., Frankini, E. L., Landman, S., Maccagnano, J., Yao, S. C.
Osteopathic Family Physician, 2023/03
247

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03
248

Osteopathic Findings and Treatment of Patient with Crohn’s Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text
249

Results of osteopathic correction according to the stabilography data in patients with lower limb amputation at the transtibial level
(Результаты остеопатической коррекции по данным стабилографии у пациентов с ампутацией нижних конечностей на уровне голени)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2023/03
Free full text
250

Substantiation of the effectiveness of osteopathic correction in the treatment of patients suffering from post-puncture syndrome
(Обоснование эффективности остеопатической коррекции при лечении пациентов, страдающих постпункционным синдромом)
Krivenya, M. S., Gorobets, L. V.
Russian Osteopathic Journal, 2023/03
Free full text
251

Substantiation of the application of osteopathic correction in the complex rehabilitation of patients after anterior cruciate ligament reconstruction surgery
(Обоснование применения остеопатической коррекции в комплексной реабилитации пациентов после операции реконструкции передней крестообразной связки)
Vorobyev, S. V., Dolinina, O. Y., Mokhov, A. D., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/03
Free full text
252

Inter-rater reliability between osteopaths of differing clinical experience on sagittal plane running gait analysis: A pilot study
Tripodi, N., Dagiandis, T., Hameed, A., Heilberg, L., Olbinski, E., Reid, C., White, A., McLaughlin, P.
International Journal of Osteopathic Medicine, 2023/03
253

Effects of face masks on oxygen saturation at graded exercise intensities
Vishwanath, V., Favo, C. L., Tu, T. H., Anderson, B., Erickson, C., Scarpulla, M., Kern, J., DeWinter, L., Gawelko, A., Bolch, C., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2023/03
Free full text
254

Der liegende Gehtest – eine Interrater-Reliabilitätsstudie
(The supine walking test – an inter-rater reliability study)
Sendlhofer, J.
Unpublished MSc thesis, 2023/03
255

Efectividad del tratamiento osteopático manipulativo y fascial en el postoperatorio de cirugía de injerto de derivación de arteria coronaria
(Effectiveness of osteopathic manipulative and fascial treatment in the postoperative period of coronary artery bypass graft surgery)
Bruni, E.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
256

Eficacia del tratamiento osteopático en pacientes con patologías respiratorias
(Effectiveness of osteopathic treatment in patients with respiratory conditions)
Ortiz Armiñana, R.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
257

Der Effekt einer Stillpunktinduktion am Sakrum auf das vegetative Nervensystem, im Vergleich zu einer Scheinbehandlung, gemessen anhand der Herzratenvariabilität (HRV)
(The Effect of a sacrum stillpoint induction on the autonomic nervous system compared to a sham treatment, as measured by heart rate variability (HRV))
Franzin, K.
Unpublished MSc thesis, 2023/03
258

Effekt einer Unwinding-Technik des zervikothorakalen Diaphragmas auf die Herzratenvariabilität (HRV) im Vergleich zu einer Scheinbehandlung
(Effect of an unwinding technique of the cervicothoracic diaphragm on the heart rate variability (HRV) compared to a sham treatment)
Gwendolyn, A.
Unpublished MSc thesis, 2023/03
259

Die Interrater Reliabilitätstestung des passiven Bewegungstests des Os coccygis in der Bauchlage
(The interrater reliability of the passive motion test from the os coccygis in prone position)
Matschek, T.
Unpublished MSc thesis, 2023/03
260

Die Interrater Reliabilitätstestung des passiven Bewegungstests des Os coccygis in der Bauchlage
(The interrater reliability of the passive motion test from the os coccygis in prone position)
Matschek, T.
Unpublished MSc thesis, 2023/03
261

Die Interrater-Reliabilität der osteopathischen Untersuchung des Caecums
(The Interrater-reliability of the osteopathic examination of the cecum)
Beyer, L.
Unpublished MSc thesis, 2023/03
262

Der liegende Gehtest – eine Interrater- Reliabilitätsstudie
(The supine walking test – an inter- rater reliability study)
Sendlhofer, J.
Unpublished MSc thesis, 2023/03
263

Characteristics of patients presenting at a university outpatient department for com-plementary and integrative medicine
Rotter, G., Binting, S., Teut, M., Ortiz, M., Willich, S. N., Brinkhaus, B.
Complementary Medicine Research, 2023/02
264

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text
265

The Impact of Complementary and Integrative Medicine Following Traumatic Brain Injury: A Scoping Review
Kim, S., Mortera, M. H., Wen, P. S., Thompson, K. L., Lundgren, K., Reed, W. R., Sasson, N., Towner Wright, S., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
The Journal of Head Trauma Rehabilitation, 2023/02
Free full text
266

Abordaje de Manejo de dolor en Niños desde la perspectiva de la Medicina Alternativa
(Approach to Pain Management in Children from an Alternative Medicine Perspective)
Sierra Sánchez, A. P.
Unpublished MSc thesis, 2023/02
Free full text
267

Effect of compression of fourth ventricle on the respiratory capacity in the post COVID patients
Agarwal, K., Ghosh, T.
Biomedicine, 2023/02
Free full text
268

Zuverlässigkeit eines Klassifizierungssystems zur Beurteilung eines Tortikollis beim Säugling
(Reliability of a classification system for the assessment of torticollis in infants)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
269

Historical Osteopathic Principles and Practices in Contemporary Care: An Anthropological Perspective to Foster Evidence-Informed and Culturally Sensitive Patient-Centered Care. A Commentary
Zegarra-Parodi, R., Baroni, F., Lunghi, C., Dupuis, D.
Healthcare, 2023/01
Free full text
270

“It's all about the story”. Osteopaths' experiences of exploring menopausal symptoms: A qualitative interview study
Gelli, N., Abbey, H.
International Journal of Osteopathic Medicine, 2023/01
271

A narrative review of nine commercial point of care influenza tests: an overview of methods, benefits, and drawbacks to rapid influenza diagnostic testing
Morehouse, Z. P., Chance, N., Ryan, G. L., Proctor, C. M., Nash, R. J.
Journal of Osteopathic Medicine, 2023/01
Free full text
272

Dynamic touch induces autonomic changes in preterm infants as measured by changes in heart rate variability
Manzotti, A., Cerritelli, F., Monzani, E., Savioli, L., Esteves, J. E., Lista, G., Lombardi, E., Rocca, S. L., Biasi, P., Galli, M., Chiera, M., McGlone, F. P.
Brain Research, 2023/01
273

What are the current rehabilitative approaches to ACL recovery post reconstruction surgery that osteopaths may implement?: A scoping review
Caughey, C.
Unpublished MSc thesis, 2023/01
Free full text
274

Safe endovascular retrieval of a vena cava filter after duodenal perforation
Avery, M. J., Cullen, N. R., Lessne, M. L., Thomas, B. W., Sing, R. F.
Journal of Osteopathic Medicine, 2022/12
Free full text
275

The intersection of the two complimentary fields of preventive cardiology and integrative cardiology: A Fellow's voice
Cheung, B.
American Journal of Preventive Cardiology, 2022/12
Free full text
276

Corrigendum to “Treatment of infant colic with craniosacral therapy. A randomized controlled trial“ [Complement Ther Med 71 (2022) 102885]
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/12
Free full text
277

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12
278

Osteopathie als personenzentrierte und integrierende Behandlungsmethode (Teil 2)
(Osteopathy as a person-centered and integrative treatment method (Part 2))
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/12
279

Application of infrared thermography in the study of the osteopathic correction results in patients with amputation defects of the lower extremities
(Инфракрасная термография в исследовании результатов остеопатической коррекции у пациентов с ампутационными дефектами нижних конечностей)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2022/12
280

Electron-donor and regulatory effects of superoxide anion radicals on the processes of osteogenesis and bone remodeling: literature review
(Регуляторное действие пероксидных анион-радикалов на процессы остеогенезиса и костного ремоделирования: обзор литературы)
Rakhmanin, Y. A., Fesyun, A. D., Stekhin, A. A., Yakovleva, G. V.
Russian Osteopathic Journal, 2022/12
281

Preliminary Effects of Osteopathic Manipulative Medicine on Reactive Oxygen Species in Parkinson’s Disease: A Randomized Controlled Pilot Study
Docherty, J., Leheste, J. R., Mancini, J, Yao, S.
Cureus, 2022/11
Free full text
282

Promoting cultural competency and osteopathic medicine awareness among premedical students through a summer premedical rural enrichment program
Kadavakollu, S., Lund, K. S., Swamy, V., Kim, W. D., Llenado, R. A., Nunes, T. F., Qureshi, M., Graneto, J. W., Boyanovsky, B. B.
Journal of Osteopathic Medicine, 2022/11
Free full text
283

Release of Cervical Muscle Tension Improves Psychological Stress and Symptoms of Moderate-to-Severe Atopic Dermatitis: a Case Series with 20 Patients
Hosono, S., Fujita, K., Nimura, A., Akita, K.
Dermatology and Therapy, 2022/10
Free full text
284

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text
285

Multidisciplinary approach in the treatment of chronic tension headache on the background of COVID-19
(Мультидисциплинарный подход при лечении хронической головной боли напряжения на фоне COVID-19)
Novikov, Y. O., Akopian, A. P., Amigues, F. A.
Russian Osteopathic Journal, 2022/09
286

Chest physiotherapy for pneumonia in adults
Chen, X., Jiang, J., Wang, R., Fu, H., Lu, J., Yang, M.
Cochrane Database of Systematic Reviews, 2022/09
Free full text
287

Interaktion zwischen Gehirn und Herz: Modifikation der Interaktion zwischen Gehirn und Herz bei chronischen Schmerzen durch osteopathische Behandlung
(Interaction between brain and heart: modification of brain-heart interaction in chronic pain by osteopathic treatment)
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Osteopathische Medizin, 2022/09
288

Osteopathie als personenzentrierte und integrierende Behandlungsmethode – Teil 1
(Osteopathy as a person-centered and integrative treatment method - Part 1)
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/09
289

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09
290

Osteopathische Medizin – Wo bleibt der Beweis?
(Osteopathic medicine - Where is the evidence?)
Schleusener, R.
Osteopathische Medizin, 2022/09
291

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08
292

The association between operating margin and surgical diversity at Critical Access Hospitals
Hopper, W., Zeller, R., Burke, R., Lindsey, T.
Journal of Osteopathic Medicine, 2022/07
Free full text
293

Effects of Muscle Energy Technique and Joint Manipulation on Pulmonary Functions, Mobility, Disease Exacerbations, and Health-Related Quality of Life in Chronic Obstructive Pulmonary Disease Patients: A Quasiexperimental Study
Bains, D., Chahal, A., Shaphe, M. A., Kashoo, F. Z., Ali, T., Alghadir, A. H., Khan, M.
Biomed Research International, 2022/07
Free full text
294

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07
295

Successful Osteopathic Manipulative Treatment of Foot Drop
Tafler, L., Katz, V., Kolesnikov, V., Singh, R.
Cureus, 2022/07
Free full text
296

Cervical cancer screening among women with comorbidities: a cross-sectional examination of disparities from the behavioral risk factor surveillance system
Austin, J., Delgado, P., Gatewood, A., Enmeier, M., Frantz, B., Greiner, B., Hartwell, M.
Journal of Osteopathic Medicine, 2022/07
Free full text
297

Hüft-Totalendoprothese
(Total hip replacement)
Grasmück, J., Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
298

Técnicas osteopáticas para la liberación emocional: Monografía
(Osteopathic Techniques for Emotional Release: Monograph)
Vallecia Barragán, L. J.
Unpublished MSc thesis, 2022/07
Free full text
299

The Effect of Osteopathic Manipulative Treatment in Pregnancy on Labor Duration: A Meta-Analysis
Zak, A., Streeter, E., Tran, N., Wales, A., Yep, M., Rowane, M.
The AAO Journal, 2022/06
Free full text
300

Deutschsprachige Osteopathieliteratur: Eine Übersicht von der Entdeckung der Osteopathie bis zum Jahr 2000
(German-language osteopathic literature: a survey from the discovery of osteopathy to the year 2000)
Engel, M.
Osteopathische Medizin, 2022/06
301

Osteopathic Evaluation and Positional Plagiocephaly: A Descriptive Study on a Population of Children with ASD
Di Renzo, M., Laurenti, A., Di Castelbianco, F. B., Vanadia, E., Petrillo, M., D’Errico, S., Ferrara, R., Racinaro, L., Rea, M.
American Journal of Pediatrics, 2022/06
Free full text
302

Komplementäre und integrative Medizin (CIM) in der Kinderheilkunde: Untersuchung zur Bereitschaft und zum Wunsch der Eltern, CIM als Selbstzahlerleistung in Anspruch zu nehmen
(Complementary and integrative medicine (CIM) in pediatrics: survey of parents' willingness and desire to use CIM as a self-pay service.)
Anheyer, Dennis
Osteopathische Medizin, 2022/06
303

Adjunctive osteopathic therapy for hospitalized COVID-19 patients: A feasibility-oriented chart review study with matched controls
Lennon, R. P., Dong, H., Zgierska, A. E., Demetriou, T., Croad, J., Livelsberger, C., Hodge, L., Mendez-Miller, M., Darby, A., Rabago, D.
International Journal of Osteopathic Medicine, 2022/06
304

Impact of timing of preoperative gabapentin administration on postoperative somnolence
Ghaith, S., Quillen, J. K., Mead-Harvey, C., Buras, M. R., Wasson, M. N.
Journal of Osteopathic Medicine, 2022/06
Free full text
305

Does the inter-osseous membrane fascial dysfunction exist ? An observational study comparing palpation to ultrasound measurements
Lecardonnel, T., Salmon, M., Merdy, O., Sarzeaud, R., Matthew, T.
International Journal of Osteopathic Medicine, 2022/06
306

Native American Student Perspectives on Culturally Integrated Education at a Tribal College of Osteopathic Medicine
Gatewood, A., Terry, R., Bray, N., Hartwell, M.
The AAO Journal, 2022/06
Free full text
307

A Guide for Transitioning Osteopathic Research from Medical School to Residency to Increase Research Productivity across Medical Training
Gober, C., Daly, E., Heinking, K. P.
The AAO Journal, 2022/06
Free full text
308

Advocacy for Change: An Osteopathic Review of Traumatic Brain Injury Among Combat Veterans
Pendlebury, G. A., Oro, P., Haynes, W., Byrnes, T. R., Keane, J., Goldstein, L.
Cureus, 2022/05
Free full text
309

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text
310

Upgrade rate of percutaneously diagnosed pure flat epithelial atypia: systematic review and meta-analysis of 1,924 lesions
Ferre, R., Kuzmiak, C. M.
Journal of Osteopathic Medicine, 2022/05
Free full text
311

Assessing the United States' most frequently asked questions about osteopathic medicine, osteopathic education, and osteopathic manipulative treatment
Sajjadi, N. B., Ottwell, R., Shepard, S., Bray, N., Dyer, R., Wilson, J., Vassar, M., Hartwell, M.
Journal of Osteopathic Medicine, 2022/05
Free full text
312

Die Interrater-Reliabilität der Routineuntersuchung cranialer Dysfunktionen der vier Schädelzonen
(The Interrater-Reliability of the routine examination of cranial dysfunctions based on four skull zones)
Götz, T.
Unpublished MSc thesis, 2022/05
Free full text
313

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text
314

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text
315

The effectiveness of rehabilitation of patients after covid pneumonia with osteopathic methods
(Эффективность реабилитации пациентов после перенесенной ковид-пневмонии методами остеопатии)
Belyaev, A. F., Fotina, O. N., Kharkovskaya, T. S., Yurchenko, A. A.
Russian Osteopathic Journal, 2022/03
Free full text
316

Die Macht der verbalen und nonverbalen Kommunikation – Placebo und Nocebo in der Osteopathie
(The empowerment of verbal and nonverbal communication – placebo and nocebo in the osteopathic treatment)
Wieland, M. I.
Unpublished MSc thesis, 2022/03
317

Active learning in osteopathic education: Evaluation of think-pair-share in an undergraduate pathology unit
Wong, D.
International Journal of Osteopathic Medicine, 2022/03
318

Die Einstellung von Medizinstudierenden zur Komplementärmedizin: Ergebnisse einer Querschnittsstudie
(The attitude of medical students towards complementary medicine: Results of a cross-sectional study)
Rotter, G., Jerzynski, L., Hinse, M., Binting, S., Brinkhaus, B.
Osteopathische Medizin, 2022/03
319

Interrater-Reliabilitätsstudie des allgemeinen osteopathischen Diaphragma-Schnelltests kranial der Symphysis pubica hinsichtlich Bewegung bei tiefer und tiefer abdominaler Inspiration
(Interrater reliability study of the general osteopathic diaphragm rapid test cranial to the symphysis pubica regarding movement during deep and deep abdominal inspiration)
Gärber, A.
Unpublished MSc thesis, 2022/03
320

A renaissance in the treatment of diabetic kidney disease, hypertension in chronic kidney disease, and beyond
Yahr, J., Calle, J., Taliercio, J. J.
Journal of Osteopathic Medicine, 2022/01
321

Effects of Adding Respiratory Training to Osteopathic Manipulative Treatment on Exhaled Nitric Oxide Level and Cardiopulmonary Function in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
The American Journal of Cardiology, 2022/01
322

The immediate effect of thoracolumbar manipulation and diaphragmatic release on inspiratory muscle strength in healthy smokers: A randomized clinical trial
Albarrati, A., Taher, M., Nazer, R., Alshameri, T.
Journal of Back and Musculoskeletal Rehabilitation, 2022/01
323

Cranial manipulation affects cholinergic pathway gene expression in aged rats
Anandakrishnan, R., Tobey, H., Nguyen, S., Sandoval, O., Klein, B. G., Costa, B. M.
Journal of Osteopathic Medicine, 2022/01
Free full text
324

Anxiety among Adults Undergoing Elective Lumbar Spine Surgery at University of California – San Diego Medical Center – La Jolla
Rusinov, V.
Unpublished Dissertation, 2022/01
Free full text
325

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05
326

A New Zealand osteopathic perspective on the choice of working in an integrated care environment alongside other regulated health care providers: A qualitative descriptive study
Cox, V.
Unpublished MSc thesis, 2022
Free full text
327

Erratum to “The legacy and implications of the body-mind-spirit osteopathic tenet: A discussion paper evaluating its clinical relevance in contemporary osteopathic care” [Int J Osteopath Med 41 (2021) 57–65]
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/12
Free full text
328

Die Lungen als Hohlorgan zwischen Luftbewegung und Gasaustausch: Ist eine osteopathische Behandlung des Lungengewebes möglich?
(The lungs as hollow organ between air movement and gas exchange: Is an osteopathic treatment of lung tissue possible?)
Levin, P.
Osteopathische Medizin, 2021/12
329

The effect of osteopathic correction on the function of external respiration in patients after COVID-19 coronavirus pneumonia
(Влияние остеопатической коррекции на функцию внешнего дыхания у пациентов, перенесших коронавирусную пневмонию COVID -19)
Belyaev, A. F., Kharkovskaya, T. S., Fotina, O. N., Yurchenko, A. A.
Russian Osteopathic Journal, 2021/12
330

Epidemiology, common diagnoses, treatments and prognosis of shoulder pain: A narrative review
Hodgetts, C., Walker, B.
International Journal of Osteopathic Medicine, 2021/12
331

Effect of Self-Performed Osteopathic Manipulative Treatment (suboccipital release) on Heart Rate Recovery: A Pilot Study
Loquist, D. C., Wong, T., Warner, M., Cannumay, S., Singh, G., Nazarian, D., Saukhla, N., Hovsepian, T.
Journal of Osteopathic Medicine, 2021/12
332

Correction: Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/12
Free full text
333

Construct validity and reliability of tests for sacroiliac dysfunction: standing flexion test (STFT) and sitting flexion test (SIFT)
Ribeiro, R. P., Guerrero, F. G., Camargo, E. N., Pivotto, L. R., Aimi, M. A., Loss, J. F., Candotti, C. T.
Journal of Osteopathic Medicine, 2021/11
Free full text
334

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text
335

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11
336

The use of person-first language in scientific literature focused on drug-seeking behavior: a cross-sectional analysis
Sharp, P., Slattery, J., Johnson, A., Torgerson, T., Ottwell, R., Vassar, M., Hartwell, M.
Journal of Osteopathic Medicine, 2021/11
Free full text
337

Analyzing the cost of medical student virtual conference registration by specialty during the COVID-19 pandemic
Veyg, D., Gurevich, R.
Journal of Osteopathic Medicine, 2021/11
Free full text
338

Effekt sakraler Mobilisationen auf die Herzratenvariabilität bei Patienten mit einem milden bis hohen Stressempfinden. Eine randomisierte, kontrollierte Einzelblindstudie
(Effect of sacrum mobilizations on the heart rate variability in patients with a moderate to high perceived stress score. A single blind randomized controlled study)
Chaumont, Y.
Unpublished MSc thesis, 2021/11
339

Evaluation of the clinical effectiveness of the osteopathic correction in children with chronic bronchitis in a sanatorium
(Оценка клинической эффективности остеопатической коррекции у детей с хроническим бронхитом в условиях санатория)
Belash, V. O., Khaibullina, G. A.
Russian Osteopathic Journal, 2021/10
Free full text
340

The pandemic silver lining: preparing osteopathic learners to address healthcare needs using telehealth
Taylor, J., Wright, A., Summers, M.
Journal of Osteopathic Medicine, 2021/10
Free full text
341

Palpation of the Respiratory System in Osteopathic Manual Medicine: From the Trachea to the Lungs
Bordoni, B., Escher, A. R.
Cureus, 2021/09
Free full text
342

Efficacy of osteopathic manipulative treatment in patients with Parkinson's disease: a narrative review
Li, R., Jose, A., Poon, J., Zou, C., Istafanos, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/09
Free full text
343

Gait Analysis in Anterior Cruciate Ligament Reconstruction & Controls Across Different Levels of Visual Feedback
Bennison, J. C.
Unpublished MSc thesis, 2021/09
Free full text
344

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09
345

Intertester Reliabilität des costoclaviculären Manövers bei symptomatischen und asymptomatischen Erwachsenen
(Interrater Reliability for the costoclavicular maneuver in symptomatic and asymptomatic adults)
Puhr, M.
Unpublished MSc thesis, 2021/09
346

Durchführung von Listening-Tests im Rahmen der osteopathischen Routinebefundung – Eine videobasierte Beobachtungsstudie.
Intertester Reliabilität des costoclaviculären Manövers bei symptomatischen und asymptomatischen Erwachsenen
Puhr, M.
Unpublished MSc thesis, 2021/09
Free full text
347

Interrater Reliabilitätstestung des Flexionstests der ersten Rippe bei symptomatischen und asymptomatischen Erwachsenen
(Interrater reliability of the flexion test for the first rib in symptomatic and asymptomatic adults)
Kondler, V.
Unpublished MSc thesis, 2021/09
348

The role of tocilizumab therapy in critically ill patients with severe acute respiratory syndrome coronavirus 2
Saffo, Z., Guo, W., Springer, K., Maksimowicz-McKinnon, K., Kak, V., McKinnon, J. E., Bhargava, P.
Journal of Osteopathic Medicine, 2021/08
Free full text
349

Orange palpebral spots
Blannett, S., Swink, S. M., Purcell, S. M.
Journal of Osteopathic Medicine, 2021/07
Free full text
350

“Understanding patients' narratives” A qualitative study of osteopathic educators’ opinions about using Medical Humanities poetry in undergraduate education
Maretic, S., Abbey, H.
International Journal of Osteopathic Medicine, 2021/06
351

Non-surgical management and return to play of an anterior cruciate ligament rupture: A case report
Bibby, L., Tripodi, N.
International Journal of Osteopathic Medicine, 2021/06
352

Spinale Chiropraktische Manipulation (spinale HVLAM): Ein integrativer osteopathischer Ansatz
Spinal chiropractic manipulation (spinal HVLAM): An integrative osteopathic approach
Muntinga, E.
Osteopathische Medizin, 2021/06
353

Effect of integrated neuromuscular inhibition technique compared with positional release technique in the management of piriformis syndrome
Danazumi, M. S., Yakasai, A. M., Ibrahim, A. A., Shehu, U. T., Ibrahim, S. U.
Journal of Osteopathic Medicine, 2021/05
Free full text
354

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text
355

Treatment options and current guidelines of care for pediatric type 2 diabetes patients: a narrative review
Molinari, A. M., Shubrook, J. H.
Journal of Osteopathic Medicine, 2021/04
Free full text
356

Substantiation of the possibility of osteopathic correction inclusion in the measures complex for the preoperative preparation of patients planned for extended abdominal surgery
(Обоснование возможности включения остеопатической коррекции в комплекс мер по предоперационной подготовке пациентов, планируемых на расширенные абдоминальные операции)
Volkov, P. A., Litvinov, N. I., Bolotov, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
357

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text
358

La collaboration entre ostéopathes et logopédistes en Suisse romande, sa qualité, ses freins, les signes et symptômes cliniques qui appellent à collaborer : une étude quantitative
(Collaboration between osteopaths and speech therapists in French-speaking Switzerland, its quality, its obstacles, the clinical signs and symptoms that call for collaboration: a quantitative study)
Dahinden, L., Sieber, L.
Unpublished MSc thesis, 2021/04
Free full text
359

Proprioceptive Coherence: An Expanded View of the Mechanics Behind the Indirect Method and the Introduction of an Innovative Variation
Lockwood, M. D.
The AAO Journal, 2021/03
Free full text
360

Poor match rates of osteopathic applicants into ACGME dermatology and other competitive specialties
Craig, E., Brotzman, E., Farthing, B., Giesey, R., Lloyd, J.
Journal of Osteopathic Medicine, 2021/03
Free full text
361

Breathing and the Center of Command - The influence of respiration on the Central Nervous System
Auer-Rizzi, K.
Unpublished MSc thesis, 2021/03
Free full text
362

Toward the use of medical scent detection dogs for COVID-19 screening
Dickey, T., Junqueira, H.
Journal of Osteopathic Medicine, 2021/02
Free full text
363

SGLT2 inhibitors: a narrative review of efficacy and safety
Nelinson, D. S., Sosa, J. M., Chilton, R. J.
Journal of Osteopathic Medicine, 2021/02
Free full text
364

Evaluating disease outbreaks with syndromic surveillance using medical student clinical rotation patient encounter logs
Bruzda, G., Rawlins, F., Sumpter, C., Garner, H. R.
Journal of Osteopathic Medicine, 2021/02
Free full text
365

Osteopathische Behandlung bei Erwachsenen mit Zerebralparese - Wirkung eines osteopathischen Behandlungsprotokolls im Vergleich zur Vojta-Therapie auf Lungenfunktionsstörungen bei Erwachsenen mit Zerebralparese
(Osteopathic treatment of adults with cerebral palsy – Effects of an osteopathic treatment protocol compared with Vojta-therapy on impaired lung function in adults with cerebral palsy)
Walter, U.
Unpublished MSc thesis, 2021/02
366

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text
367

Palpation, Interraterreliabilität und Soft Skills
(Palpation, interrater reliability and soft skills)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
368

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01
369

Recognizing postoperative nutritional complications of bariatric surgery in the primary care patient: a narrative review
Chamberlain, C., Terry, R., Shtayyeh, T., Martinez, C.
Journal of Osteopathic Medicine, 2021/01
Free full text
370

Das osteopathische Labor: Erfahrung ermöglichen
(The osteopathic laboratory: Enabling experience)
Levin, P., Strebel, W.
Osteopathische Medizin, 2020/12
371

Psychosomatische Osteopathie bei Trauma am Beispiel der bifokalen Integration
(Psychosomatic osteopathy in trauma using the example of bifocal integration)
Liem, T., Neuhuber, W.
Osteopathische Medizin, 2020/12
372

Cranial Manipulation Affects Neuronal Gene Expression, Explaining the Improved Cognitive Ability in an Animal Model of Age-related Cognitive Decline
Anandakrishnan, R.
The Journal of the American Osteopathic Association, 2020/12
373

Acute Suppurative Thyroiditis
Desai, P., Mbachi, C., Singh, A.
The Journal of the American Osteopathic Association, 2020/11
Free full text
374

Serum Zinc Concentrations of Adults in an Outpatient Clinic and Risk Factors Associated With Zinc Deficiency
Gau, J. T., Ebersbacher, C., Kao, T. C.
The Journal of the American Osteopathic Association, 2020/11
Free full text
375

Neurophysiologische Aspekte der osteopathischen Palpation gemessen mit der Herzratenvariabilitätsmessung
(Neurophysiological aspects of osteopathic palpation measured with the heart rate variability measurement)
Strohmaier, B.
Unpublished MSc thesis, 2020/11
Free full text
376

Osteopathische Anwendung bei Aufmrksamkeits - Defizit - Syndrom
(Osteopathic application in case of lack of concentration)
Werth, B.
Unpublished MSc thesis, 2020/11
377

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text
378

Validität und Interrater-Reliabilität des Grynfeltt-Tests
(Validity and inter-rater reliability of the Grynfeltt-test)
Drobe, W.
Unpublished MSc thesis, 2020/10
379

Postoperative peritoneale Adhäsionen
(Postoperative peritoneal adhäsionen)
Liedler, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
380

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text
381

New investigator editorial: the osteopathic medical student perspective on research
Persand, D., Maddie, N.
American Journal of Physiology. Heart and Circulatory Physiology, 2020/10
Free full text
382

Wie reliabel ist die Identifikation der somatischen Dysfunktion in der Osteopathie?
(Is there a reliability in the identification of the somatic dysfunktion in osteopathy?)
Soika, S.
Unpublished MSc thesis, 2020/10
383

La fascia desde la medicina osteopática
(Fascia from the perspective of osteopathic medicine)
Stambulie Padilla, E. A.
Unpublished MSc thesis, 2020/10
Free full text
384

Intertester-Reliabilitätsstudie - ist das Ergebnis der Oszillationstestung der Brustwirbelsäule in Bauchlage abhängig von dem/der testenden Osteopathen/in
(Interexaminer reliability of the oscillation test in the thoracic spine in prone position)
Kössler, M.
Unpublished MSc thesis, 2020/10
Free full text
385

Die kranio-kaudale Bewegung im Articulatio tibiofibulare proximalis bei einer Dorsalextension und Plantarflexion im Articulatio talocruralis
(The cranial and caudal movement of the Art. Tibiofibularis proximalis during dorsalextension and plantarflexion)
Bernhardt, M.
Unpublished MSc thesis, 2020/09
Free full text
386

Effect of Hydration on Doppler Velocity of Renal Arteries
Lee, J., Gao, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text
387

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07
388

Eosinopenia and COVID-19
Tanni, F., Akker, E., Zaman, M. M., Figueroa, N., Tharian, B., Hupart, K. H.
The Journal of the American Osteopathic Association, 2020/07
Free full text
389

Auswirkungen osteopathischer Techniken an der Pleura parietalis auf das Atemvolumen: Eine Pilotstudie mit gesunden Erwachsenen
(Effects of osteopathic techniques applied to the Pleura parietalis on the respiratory volume: a pilot study with healthy adults)
Strnad, V.
Unpublished MSc thesis, 2020/07
Free full text
390

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text
391

OMT bei der Behandlung von Infektionskrankheiten zu Beginn des 20. Jahrhunderts: Mit Anmerkungen aus aktuellen Forschungen und Behandlungsmodalitäten
(OMT in the treatment of infectious diseases at the beginning of the 20th century: With comments from current research and treatment modalities)
Liem, T.
Osteopathische Medizin, 2020/06
392

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text
393

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06
394

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text
395

Influence of osteopathic correction on sports achievements of racing athletes
(Влияние остеопатической коррекции на спортивные достижения спортсменов-автогонщиков)
Azarenkova, A. M., Safin, R. F.
Russian Osteopathic Journal, 2020/06
Free full text
396

Daily Integrated Care Conferences to Reduce Length of Hospital Stay for Patients With Chronic Obstructive Pulmonary Disease
Shilian, R., Abraham, T., Wynbrandt, J., Jhaveri, D., Hostoffer, R. W., Peppers, B. P.
The Journal of the American Osteopathic Association, 2020/05
Free full text
397

Doctors Wanted: Women Encouraged to Apply. A Historical Analysis of Women in Osteopathic Medical Education
Karacay, K. C.
Unpublished PhD thesis, 2020/05
398

Making the Frontier’s Anatomical Engineers: Osteopathy, A. T. Still (1828–1917), His Acolytes and Patients
Reeves, M. A.
Unpublished PhD thesis, 2020/05
399

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05
400

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text
401

Relationship of Clinical Skills Performance in Medical School With COMLEX-USA Level 2-Performance Evaluation
Wang, S., Basehore, P.
The Journal of the American Osteopathic Association, 2020/04
Free full text
402

Effektivität osteopathischer Maßnahmen bei Dysgnathie-Patienten post operationem: Eine Pilotstudie
(Effectiveness of osteopathic measures in postoperative dysgnathia patients: A pilot study)
Rost, H., Makuch, A.
Osteopathische Medizin, 2020/03
403

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text
404

A duty of candour: Implications for Australian osteopaths
Moore, K.
International Journal of Osteopathic Medicine, 2020/03
405

Etude exploratoire de la sante musculo-squelettique du rachis d'etudiants en osteopathie.
[Exploratory study on spinal musculoskeletal health of osteopathy students]
Javerliat, P., Pizon, F., Gerbaud, L.
Revue d'epidemiologie et de sante publique, 2020/02
406

Evidence and recommendations for the use of segmental motion testing for patients with LBP – A systematic review
Stolz, M., von Piekartz, H., Hall, T., Schindler, A., Ballenberger, N.
Musculoskeletal Science and Practice, 2020/02
Free full text
407

Stretching exercises combined with ischemic compression in pectoralis minor muscle with latent trigger points: A single-blind, randomized, controlled pilot trial
Birinci, T., Mustafaoglu, R., Kaya Mutlu, E., Razak Ozdincler, A.
Complementary Therapies in Clinical Practice, 2020/02
Free full text
408

Das „Wo“ und „Wie“ der Wissensbeschaffung – die systematische Literaturrecherche
(The “where“ and “how“ of knowledge generation - the systematic literature search)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
409

The labor study: Labor length and birth outcomes osteopathic research
Martingano, D., Mitrofanova, A., Kim, A. F., Ulfers, A., Mersch, M., Stevenson, R., Singh, S.
American Journal of Obstetrics & Gynecology, 2020/01
410

Craniosacral system and primary respiration in Chinese medicine
(Краниосакральная система и первичное дыхание в китайской медицине)
Akhmetsafin, A. N.
Russian Osteopathic Journal, 2019/12
Free full text
411

Research on the effectiveness and safety of kinesiotaping in middle-aged and elderly military patients for reducing acute and chronic myofascial pain
(Исследование эффективности и безопасности кинезиотейпирования в коррекции острого и хронического миофасциального болевого синдрома у пациентов военного контингента средней и старшей возрастных групп)
Bunin, A. V.
Russian Osteopathic Journal, 2019/12
Free full text
412

Correlation between certain rhythms of the body in osteopathic patients
(Корреляционные связи между некоторыми ритмами организма у пациентов врача-остеопата)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/12
Free full text
413

The role of the musculoskeletal system in maintaining postural balance: literature review
(Роль опорно-двигательного аппарата в поддержании постурального баланса: обзор литературы)
Kurnikova, A. A., Potekhina, Y. P., Filatov, A. A., Kalinina, E. A., Pervushkin, E. S.
Russian Osteopathic Journal, 2019/12
Free full text
414

The Efficacy of Treating Thoracic Cage Counterstrain Tender Points With Varied Mobile Point Time Durations in a Classroom Setting
Smith, J. M., Docherty, J., Kooyman, P., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12
415

Efecto de la Osteopatía sobre el sistema nervioso autónomo mediante interpretación de la variabilidad
(Effect of osteopathy on the autonomic nervous system through interpretation of variability)
Llinás, A. S. J., Rausell, J. M. S., Escobio Prieto, I.
European Journal Osteopathy & Related Clinical Research, 2019/12
Free full text
416

Effect of Osteopathic Cranial Manipulative Medicine on an Aged Rat Model of Alzheimer Disease
Tobey, H., Lucas, T., Bledsoe, D., Mykins, M., Campbell, C., Berr, S. S., Sasser, T., Helm, R., Brolinson, P. G., Klein, B. G., Costa, B. M.
The Journal of the American Osteopathic Association, 2019/11
Free full text
417

Effectiveness of the muscle energy technique on respiratory muscle strength and endurance in patients with fibromyalgia
Uysal, S. C., Tuzun, E. H., Eker, L., Angin, E.
Journal of Back and Musculoskeletal Rehabilitation, 2019/11
Free full text
418

Osteopathic manipulative medicine to improve balance and quality of life in parkinson disease
Yao, S., Docherty, J., Mancini, J., Leder, A., DiFrancisco-Donoghue, J.
Movement Disorders, 2019/11
419

Auswirkung der Osteopathie bei Postcholezystektomiebeschwerden auf Schmerz und gesundheitsbezogener Lebensqualität
(The impact of osteopathy on post-cholecystectomy complaints assessed by the parameters of pain and the health-related quality of life)
Noppinger, M. E.
Unpublished MSc thesis, 2019/10
Free full text
420

Herzratenvariabilitätsanalyse in der Osteopathie und Manualmedizin
(Heart rate variability in manual medicine)
Klumpp, M.
Unpublished MSc thesis, 2019/10
Free full text
421

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10
422

Toward a Theory of the Mechanism of High-Velocity, Low-Amplitude Technique: A Literature Review
Hennenhoefer, K., Schmidt, D.
The Journal of the American Osteopathic Association, 2019/10
Free full text
423

Welches Gesundheitsmodell hat die Osteopathische Medizin? Teil 2: Eine osteopathische Sichtweise zur Gesundheit und zum Gesundsein
(What health model does osteopathic medicine have? Part 2)
Mayer, J.
Osteopathische Medizin, 2019/09
424

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09
425

Effects of muscle energy technique for quadratus lumborum on respiratory muscle strength in patients with breast cancer
Espinosa, L., Andrea, M., Daza, A., Jorge, E., Pinzón, S., Lina, M., Perdomo-Quiroga, Y., Ruiz, J., Jhoana, P.
Revista de la Facultad de Medicina, 2019/09
426

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text
427

Mecanismo mediante el cual la osteopatía libera las emociones
(The Mechanism by which osteopathy releases emotions)
Ospina Guisao, M. C.
Unpublished MSc thesis, 2019/08
Free full text
428

Dynamic touch reduces physiological arousal in preterm infants: A role for c-tactile afferents?
Manzotti, A., Cerritelli, F., Esteves, J. E., Lista, G., Lombardi, E., La Rocca, S., Gallace, A., McGlone, F. P., Walker, S. C.
Developmental Cognitive Neuroscience, 2019/08
Free full text
429

Understanding Myalgic Encephalomyelitis/Chronic Fatigue Syndrome and the Emerging Osteopathic Approach: A Narrative Review
Larrimore, C., Ramnot, A., Jaghab, A., Sarduy, S., Guerrero, G., Troccoli, P., Hilton, K., Bested, A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
430

Körperarbeit als Zugang zum ganzen Menschen
(Bodywork as access to the whole person)
Petzold, T. D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
431

Student academic performance factors affecting matching into first-choice residency and competitive specialties
Mitsouras, K., Dong, F., Safaoui, M. N., Helf, S. C.
BMC Medical Education, 2019/07
Free full text
432

The influence of osteopathic correction on the restoration of the functions of the ankle joint with partial damage of its ligaments
(Влияние остеопатической коррекции на восстановление функций голеностопного сустава при частичном повреждении его связок)
Alekseev, V. N., Naumenko, E. Y.
Russian Osteopathic Journal, 2019/07
433

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text
434

The influence of osteopathic correction on the rate of various rhythms of the body
(Влияние остеопатической коррекции на частоту различных ритмов организма)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
435

The influence of osteopathic correction on the viscoelastic characteristics of the lower leg muscles
(Влияние остеопатической коррекции на вязкоупругие характеристики мышц голени)
Timanin, E. M., Sydneva, N. S., Zakharova, A. A.
Russian Osteopathic Journal, 2019/07
436

Effect of Osteopathic Obstetrical Management on the Duration of Labor in the Inpatient Setting: A Prospective Study and Literature Review
Martingano, D., Ho, S., Rogoff, S., Chang, G., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2019/06
Free full text
437

Pilot randomized single-blind clinical trial, craniosacral therapy vs control on physiological reaction to math task in male athletes
Wójcik, M., Dziembowska, I., Izdebski, P., Żekanowska, E.
International Journal of Osteopathic Medicine, 2019/06
438

Welches Gesundheitsmodell hat die Osteopathische Medizin?
(What health model does osteopathic medicine have? Part 1: The topic of disease in the biomedical model of standard care)
Mayer, J.
Osteopathische Medizin, 2019/06
439

The inter-rater reliability of the mobility tests of the cranial bones as assessed through manual therapy
Demers, K., Morin, C., Collette, L., DeMont, M. R.
Advances in Integrative Medicine, 2019/06
440

Étude randomisée monocentrique évaluant l’efficacité de l’ostéopathie dans la prise en charge des douleurs chroniques après chirurgie mammaire en oncologie
(Osteopathy for chronic pain after breast cancer surgery: a monocentric randomised study)
Chvetzoff, G., Berthier, A., Blanc, E., Bourne Branchu, V., Millaret, A., Cropet, C., Pérol, D.
Bulletin du Cancer, 2019/06
441

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06
442

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05
443

Comprehensive Medical College Admission Test Preparatory Course as a Strategy to Encourage Premedical Students to Pursue Osteopathic Medicine in Rural Areas
Shipley, T. W., Phu, N., Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2019/04
Free full text
444

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text
445

Erratum: Assessment of the Efficacy of An Osteopathic Treatment in Infants with Biomechanical Impairments to Suckling
Herzhaft-LeRoy, J.
Journal of Visualized Experiments, 2019/03
446

Reliabilitätsstudie des Befunds nach dem Mechanical Link
(Reliability study of the findings according to the mechanical link: Methodological study on the assessment of findings of the bones and joints of the extremities by the mechanical link method)
Hafen, G. I.
Osteopathische Medizin, 2019/03
447

Nelson-Denny Reading Test Scores as a Predictor of Student Success in Osteopathic Medical Education
Linsenmeyer, M., Ridpath, L.
The Journal of the American Osteopathic Association, 2019/02
Free full text
448

Ultrasound Evaluation of Diaphragmatic Mobility and Contractility After Osteopathic Manipulative Techniques in Healthy Volunteers: A Prospective, Randomized, Double-Blinded Clinical Trial
Mancini, D., Cesari, M., Lunghi, C., Benigni, A. M., Antonelli Incalzi, R., Scarlata, S.
Journal of Manipulative and Physiological Therapeutics, 2019/01
449

The role of soft tissue mobilization in reducing orofacial and general complaints in a patient with Kimmerle anomaly and temporomandibular joint disorder: A case report
Kuc, J., Szarejko, K. D., Aleksandrowicz, K., Golebiewska, M.
Cranio - Journal of Craniomandibular Practice, 2019/01
450

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text
451

Fundamental study of a visceral pericardial osteopathic protocol on heart physiology
Fatisson, J., Mullie, Y., Oswald, V., Gauthier, M., Lalonde, F., Comtois, A. S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
452

Die Auswirkungen der Atmung auf die maximale aktive Mundöffnung
(The breathing effect on maximal active mouth opening)
Schober, K.
Unpublished MSc thesis, 2018/11
Free full text
453

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text
454

Kann die Schwangerschaftsrate nach technisch assistierter Reproduktion durch osteopathische Behandlungen erhöht werden?
(Can the pregnancy rate after assisted reproductive technology be increased through osteopathic treatments?)
Samouh, S.
Unpublished MSc thesis, 2018/10
Free full text
455

Outpatient satisfaction with osteopathic manipulative treatment in a hospital center: A survey
Tramontano, M., Cinnera, A. M., Petracca, M., Gaeta, A., Tamburella, F., Audouard, M., Caltagirone, C.
Alternative Therapies in Health and Medicine, 2018/10
456

An Osteopathic Approach to Rib Somatic Dysfunction in Respiratory Disorders
Pierce-Talsma, S., Talsma, J., Ferrill, H.
The Journal of the American Osteopathic Association, 2018/10
Free full text
457

The Immediate Effect of Therapeutic Touch and Deep Touch Pressure on Range of Motion, Interoceptive Accuracy and Heart Rate Variability: A Randomized Controlled Trial With Moderation Analysis
Edwards, D. J., Young, H., Johnston, R.
Frontiers in Integrative Neuroscience, 2018/09
Free full text
458

Effects of manual therapy on the diaphragm in asthmatic patients: A randomized pilot study
Leonés-Macías, E., Torres-Sánchez, I., Cabrera-Martos, I., Ortiz-Rubio, A., López-López, L., Valenza, Marie C.
International Journal of Osteopathic Medicine, 2018/09
459

Ernährungswissen: Integrativer Bestandteil der Osteopathie in Deutschland?
(Nutritional Knowledge: An integrative part of osteopathy in Germany?)
Nier, R.
Unpublished MSc thesis, 2018/09
Free full text
460

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07
461

Enablers and barriers to the development of interprofessional collaboration between physicians and osteopaths: A mixed methods study
Morin, C., Desrosiers, J., Gaboury, I.
Journal of Interprofessional Care, 2018/07
462

La disfunción somática: un concepto en evolución: estado del arte sobre la historia y evolución del concepto
(Somatic dysfunction: an evolving concept: state of the art on the history and evolution of the concept)
Carrillo Vaca, L. P.
Unpublished MSc thesis, 2018/07
Free full text
463

Osteopathic clinical reasoning: An ethnographic study of perceptual diagnostic judgments, and metacognition
McIntyre, C, Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/06
464

El nervio espinal y el trapecio superior en la cervicalgia
(The spinal nerve and upper trapezius in neck pain)
Muñoz Rodríguez, J., Burrel Botaya, A., Balaguer Solé, S.
European Journal Osteopathy & Related Clinical Research, 2018/06
Free full text
465

Evidence, alternative facts and narrative: A personal reflection on person-centred care and the role of stories in healthcare
Tyreman, S.
International Journal of Osteopathic Medicine, 2018/06
Free full text
466

A workforce survey of Australian osteopathy: analysis of a nationally-representative sample of osteopaths from the Osteopathy Research and Innovation Network (ORION) project
Adams, J., Sibbritt, D., Steel, A., Peng, W.
BMC Health Services Research, 2018/05
Free full text
467

Las cadenas fisiológicas en la medicina osteopática
(Physiological chains in osteopathic medicine)
Amado Suárez, M. C.
Unpublished MSc thesis, 2018/05
Free full text
468

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text
469

Die Zusammenarbeit von Hebamme und Osteopath
(The collaboration of midwife and osteopath)
Steinfurth, G., Böhringer, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
470

Interdisziplinäre Zusammenarbeit
(Interdisciplinary collaboration)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
471

Prevention and treatment of low back pain: evidence, challenges, and promising directions
Foster, N. E., Anema, J. R., Cherkin, D., Chou, R., Cohen, S. P., Gross, D. P., Ferreira, P. H., Fritz, J. M., Koes, B. W., Peul, W., Turner, J. A., Maher, C. G.
The Lancet, 2018/03
472

The development of a palpation-based clinical assessment of breathing motion: a nominal group technique approach
Petch, K. A.
Unpublished MSc thesis, 2018/03
Free full text
473

Pilotstudie über den Einfluss der osteopathischen Behandlung des Mesenteriums auf das Atemvolumen
(Pilot study on the influence of the treatment of the mesentery on the respiratory volume)
Muigg, E.
Unpublished MSc thesis, 2018/03
Free full text
474

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text
475

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01
476

Corrigendum to “Osteopathic manipulative treatment for post mastectomy lymphedema: A case report” [Int. J. Osteopath. Med. 26 (2017) 49–52]
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Arumugam, N.
International Journal of Osteopathic Medicine, 2018/01
Free full text
477

Gratitude: Reflections and Belonging in the Osteopathic Family
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text
478

When, why, and how osteopaths and physicians communicate: Lessons learned from the results of a mixed methods study
Morin, C., Desrosiers, J., Gaboury, I.
International Journal of Osteopathic Medicine, 2017/12
479

Descriptive study of interprofessional collaboration between physicians and osteopaths for the pediatric population in Quebec, Canada
Morin, C., Desrosiers, J., Gaboury, I.
BMC Health Services Research, 2017/11
Free full text
480

Correction: Does Visceral Osteopathic Treatment Accelerate Meconium Passage in Very Low Birth Weight Infants?- A Prospective Randomized Controlled Trial
Haiden, N., Pimpel, B., Kreissl, A., Jilma, B., Berger, A.
PLoS One, 2017/11
Free full text
481

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10
482

Die biodynamische Behandlung bei einem Patienten mit Makuladegeneration
(Biodynamic treatment of a patient suffering from macular degeneration)
Koop, J. P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
483

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
484

Corrigendum to “Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research“ [Musculoskelet. Sci. Pract. 27 165-175]
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/08
485

Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment
Licciardone, J. C.
Musculoskeletal Science and Practice, 2017/06
486

Reply to the letter to the editor: 'Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment'
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/06
487

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text
488

Validitäts- und Interrater-Reliabilitätsstudie des Auskultationstests der A. Carotis in der Osteopathie
(Validity and Inter-rater Reliability Study of the Auscultation Test of the Carotid Artery in Osteopathy)
Schaffhauser, S. M.
Unpublished MSc thesis, 2017/05
Free full text
489

Validitäts- und Interrater-Reliabilitätsstudie der Aortenaneurysma-Sicherheitstests
(Validity and Reliability Study regarding the safety test for an Aortic Aneurism)
Schöffmann, M.
Unpublished MSc thesis, 2017/05
Free full text
490

Clinical classification in low back pain: best-evidence diagnostic rules based on systematic reviews
Petersen, T., Laslett, M., Juhl, C.
BMC Musculoskeletal Disorders, 2017/05
Free full text
491

Falxverkalkungen- und verknöcherungen in der CT - Datenerhebung zur Häufigkeit, Größe und Position
(Falx cerebri Calcifications and Ossifications in CT Scans – A Data Collection on Frequency, Position and Size)
Schedler, A.
Unpublished MSc thesis, 2017/04
Free full text
492

Collaboration interprofessionnelle entre médecins et ostéopathes impliqués auprès de la clientèle pédiatrique au Québec
(Interprofessional collaboration between physicians and osteopaths involved with pediatric population in Quebec)
Morin, C.
Unpublished PhD thesis, 2017/03
Free full text
493

Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/02
494

Auswirkungen einer cranialen Technik auf die Herzratenvariabilität
(Effects of a cranial technique on the heart rate variability)
Hauser, B. D.
Unpublished MSc thesis, 2017/02
Free full text
495

Plataforma de osteopatia. Plataforma colaborativa e cooperativa de osteopatia
(Collaborative and cooperative osteopathy platform)
Martins, M. M. V. d. N.
Unpublished MSc thesis, 2017/01
Free full text
496

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text
497

Schilddrüse und Nebenschilddrüsen: Worauf Sie bei Ihren Patienten achten sollten
(Thyroid gland and parathyroid glands: To what you should pay particular attention in your patients)
Wicke, C., Trupka, A.
Osteopathische Medizin, 2016/12
498

Effects of osteopathic treatment on pulmonary function and chronic thoracic pain after coronary artery bypass graft surgery (OstinCaRe): study protocol for a randomised controlled trial
Roncada, G.
BMC Complementary and Alternative Medicine, 2016/11
Free full text
499

A model for radiating leg pain of endometriosis
Bove, G. M.
Journal of Bodywork and Movement Therapies, 2016/10
500

The osteopath, an indispensable collaborator in a combined case study of orthodontics and orthognathic surgery
Hue, I.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
501

Interrater-Reliabilitätsstudie am Os temporale
(Interrater Reliability Study on the Temporal Bone)
Pöschl, A.
Unpublished MSc thesis, 2016/10
Free full text
502

Development of trust between conventional and CAM practitioners: Insights from physicians and osteopaths in Quebec
Morin, C., Gaboury, I., Desrosiers, J.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
503

(Skin cancer: What you should watch out for in your patients)
Schnopp, C., Mempel, M., Baumstark, J.
Osteopathische Medizin, 2016/09
504

Manual evaluation of the diaphragm muscle
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Journal of Chronic Obstructive Pulmonary Disease, 2016/08
Free full text
505

Health literacy screening of patients attending a student-led osteopathy clinic: A pilot investigation
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Complementary Therapies in Clinical Practice, 2016/08
506

Confirmatory factor analysis of the Study Process Questionnaire in an Australian osteopathy student population
Vaughan, Brett
International Journal of Osteopathic Medicine, 2016/06
507

(The polyvagal theory in osteopathy)
Porges, S. W., Liem, T.
Osteopathische Medizin, 2016/06
508

Randomised controlled pilot trial on feasibility, safety and effectiveness of osteopathic MANipulative treatment following major abdominal surgery (OMANT pilot trial)
Probst, P., Büchler, E., Doerr-Harim, C., Knebel, P., Thiel, B., Ulrich, A., Diener, M. K.
International Journal of Osteopathic Medicine, 2016/06
509

The mini Clinical Evaluation Exercise (mini-CEX) in a pre-registration osteopathy program: Exploring aspects of its validity
Vaughan, B., Moore, K.
International Journal of Osteopathic Medicine, 2016/03
510

Biologische Rhythmen und ihre Bedeutung für die Osteopathie
(Biological rhythms and their importance for osteopathy)
Liem, T., Moser, M.
Osteopathische Medizin, 2016/03
511

Auswirkungen einer osteopathischen Technik an der Membrana bronchopericardiaca auf die Lungenfunktion, die Herzfrequenz, die arterielle Sauerstoffsättigung und den arteriellen Blutdruck
(Effects of an osteopathic technique on the bronchopericardial membrane on pulmonary function, heart rate, arterial oxygen saturation, and arterial blood pressure)
Seiringer, S.
Unpublished MSc thesis, 2016/03
Free full text
512

An osteopathic approach to the treatment of ovarian cancer
Martingano, D., Cannon, M., Williams, S., Stoner, A.
Osteopathic Family Physician, 2016/01
Free full text
513

A formação em osteopatia na Europa: unidade ou diversidade? Os casos da Bélgica, França, Inglaterra e Portugal.
(Osteopathic training in Europe: unity or diversity? The cases of Belgium, France, England and Portugal)
Raimundo, I. S. P.
Unpublished MSc thesis, 2016/01
514

Multicenter Osteopathic Pneumonia Study in the Elderly: Subgroup Analysis on Hospital Length of Stay, Ventilator-Dependent Respiratory Failure Rate, and In-hospital Mortality Rate
Noll, D. R., Degenhardt, B. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text
515

GME Graduate Retention Rates: A Single Institution Study
Frieswyk, T. J.
Unpublished PhD thesis, 2015/12
Free full text
516

Validität der Palpation des intraokularen Druckes durch Osteopathen
(Validity of the Palpation of the Intraocular Pressure by Osteopaths)
Frenzel, S.
Unpublished MSc thesis, 2015/11
Free full text
517

(Osteopathic treatment in patients with age-related macular degeneration. Pre-post study)
Ihlow, D.
Unpublished D.O. thesis, 2015/10
518

Interrater-Reliabilität von osteopathischen Befunden am Beispiel der Zwerchfelluntersuchung
(Interrater reliability of osteopathic findings using the example of diaphragmatic examination.)
Körner, J., Porthun, J., Woisetschläger, G.
Osteopathische Medizin, 2015/09
519

Testung der Interrater-Reliabilität osteopathischer Befundergebnisse bei Untersuchung des abdominalen Diaphragmas ohne Vorgabe der Testdurchführung.
(Testing the interrater reliability of osteopathic findings in the examination of the abdominal diaphragm without specification of test implementation)
Körner, J.
Unpublished MSc thesis, 2015/09
Free full text
520

Die osteopathische Behandlung akuter Atemwegserkrankungen im Krankenhaus von Haifa
(The osteopathic treatment of acute respiratory diseases in a hospital in Haifa, Israel)
Waldman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
521

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09
522

Effect of Table Trainer-to-Student Ratios on Outcome in Student Assessments of Cervical Muscle Energy Techniques
Snider, K. T., Dowling, D. J., Seffinger, M. A., Channell, M. K., Yao, S. C., Gustowski, S. M., Johnson, J. C., Pryor, M. J.
The Journal of the American Osteopathic Association, 2015/09
Free full text
523

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text
524

Die Bedeutung der Flüssigkeitsdynamik innerhalb des primären Atemmechanismus
(The importance of fluid dynamics within the primary respiratory mechanism)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
525

Einfluss zirkadianer Rhythmik auf den Kurzzeiteffekt eines myofaszialen Release des Zwerchfells hinsichtlich vagaler Modulation der Herzratenvariabilität
(Influence of circadian rhythmicity on the short-term effect of a myofascial release of the diaphragm with respect to vagal modulation of heart rate variability)
Hofer, U.
Unpublished MSc thesis, 2015/06
Free full text
526

The effect of the osteopathic thoracic lymphatic pump technique on salivary secretory immunoglobulin A levels in adults with recurrent upper respiratory tract complaints
Blut, D. P. F.
Unpublished MSc thesis, 2015/06
527

Neue Strategien zur persönlichen und beruflichen Weiterentwicklung für Osteopathen
(New strategies for the further personal and professional development of osteopaths)
Bradonic, B., Risch, A. J.
Osteopathische Medizin, 2015/06
528

Durchblick trotz Wolke: Verwaltung von osteopathischen Praxen per Software
(Perspective in spite of the cloud: Management of osteopathic practices per software)
Hartlep, M.
Osteopathische Medizin, 2015/06
529

Understanding why people do or do not engage in activities following total joint replacement: A longitudinal qualitative study
Hutchinson, J.
International Journal of Osteopathic Medicine, 2015/06
530

Impact of osteopathic manipulative therapy on quality of life of patients with deep infiltrating endometriosis with colorectal involvement: results of a pilot study
Darai, C., Deboute, O., Zacharopoulou, C., Laas, E., Canlorbe, G., Belghiti, J., Zilberman, S., Ballester, M., Darai, E.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2015/05
531

Lymphatic pump treatment as an adjunct to antibiotics for pneumonia in a rat model
Hodge, L. M., Creasy, C., Carter, K., Orlowski, A., Schander, A., King, H. H.
The Journal of the American Osteopathic Association, 2015/05
Free full text
532

The impact of MD and DO attitudes and beliefs on their willingness to collaborate clinically with chiropractors
McGregor, D. M.
Unpublished PhD thesis, 2015/05
533

Die Interrater Reliabilität der segmentalen passiven Mobilitätstestung der Lendenwirbelsäule im Sitz mit markierten Processus spinosi
(Interrater Reliability For Segmental Passive Motion Palpation Of The Lumbar Spine In Sitting Position With Marked Spinous Processes)
Maurer, S.
Unpublished MSc thesis, 2015/03
Free full text
534

Chronic inflammatory disease and osteopathy: a systematic review
Cicchitti, L., Martelli, M., Cerritelli, F.
PLoS One, 2015/03
Free full text
535

Effects of a diaphragm stretching technique on pulmonary function in healthy participants: A randomized-controlled trial
González-Álvarez, F. J., Valenza, M. C., Cabrera-Martos, I., Torres-Sánchez, I., Valenza-Demet, G.
International Journal of Osteopathic Medicine, 2015/03
536

Postoperative singultus: an osteopathic approach
Petree, K., Bruner, J.
The Journal of the American Osteopathic Association, 2015/03
Free full text
537

Research in the osteopathic medical profession: roadmap to recovery-conundrums in osteopathic research require consensus and collaboration
Walkowski, S. A., Eland, D. C., Hain, S., Byron, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text
538

Duration and magnitude of myofascial release in 3-dimensional bioengineered tendons: effects on wound healing
Cao, T. V., Hicks, M. R., Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/02
Free full text
539

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01
540

CV4 vs Meditation: Die Auswirkungen auf das vegetative Nervensystem verglichen anhand der Herzratenvariabilität
(The impact of CV4 vs meditation on the vegetative nervous system measured by analysis of heart-rate variability: a comparative study)
Buschatzky, B.
Unpublished MSc thesis, 2014/12
Free full text
541

Passive Bewegungstestung in Rotation und Seitneigung mit der Beurteilung des Endgefühls im Segment C0/C1 (Interrater- und Intrarater Reliabilitätsstudie)
(Passive movement testing in rotation and lateral flexion for the assessment of the end feel in segment C0/C1 (interrater and intrarater reliability study))
Neuwirth, B.
Unpublished MSc thesis, 2014/12
Free full text
542

Cardiovascular Response to Vertebral Osteopathic Manipulative Treatment (OMT), On Asymptomatic Human Subjects
Pedapati, C.
Unpublished MSc thesis, 2014/12
543

Intertester-Reliabilitätsprüfung einer visceralen Mobilitätsuntersuchung an der Leberzone
(Examination of the Intertester Reliability of a passive visceral mobility palpation on the hepatic area)
Zeller, U.
Unpublished MSc thesis, 2014/12
Free full text
544

(Passive movement testing in rotation and lateral flexion for the assessment of the end feel in segment C0/C1 (interrater and intrarater reliability study))
Passive Bewegungstestung in Rotation und Seitneigung mit der Beurteilung des Endgefühls im Segment C0/C1 (Interrater- und Intrarater Reliabilitätsstudie)
Neuwirth, B.
Unpublished MSc thesis, 2014/12
Free full text
545

Beeinflussung des autonomen Nervensystems durch eine osteopathische Recoiltechnik am Sternum
(Influencing the autonomic nervous system through the application of an osteopathic recoil technique on the sternum)
Mayrhofer, D.
Unpublished MSc thesis, 2014/11
Free full text
546

Use of beat-to-beat cardiovascular variability data to determine the validity of sham therapy as the placebo control in osteopathic manipulative medicine research
Henley, C. E., Wilson, T. E.
The Journal of the American Osteopathic Association, 2014/11
Free full text
547

Osteopathische Forschungsinstitutionen: eine Übersicht
(Osteopathic research institutions: an overview)
Newiger, C.
Osteopathische Medizin, 2014/11
548

Effect of myofascial techniques applied to the cranial region on autonomic Nervous System analyzed by Heart Rate Variability
Cantalino, J. L. R., Salgado, A. S. I., Santos, I. R., Oliveira, L. V. F., Oliveira, C. S., Ferreira, L. A. B., Da Silveira, N. J. F., Costa, M. S.
Manual Therapy, Posturology & Rehabilitation Journal, 2014/11
Free full text
549

Changes in rat spinal cord gene expression after inflammatory hyperalgesia of the joint and manual therapy
Ruhlen, R. L., Singh, V. K., Pazdernik, V. K., Towns, L. C., Snider, E. J., Sargentini, N. J., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/10
Free full text
550

Benchmarking the strategies for assessing clinical reasoning in osteopathic curricula
Moore, K., Grace, S., Orrock, P., Coutts, R., Blaich, R., Vaughan, B.
International Journal of Osteopathic Medicine, 2014/09
551

Osteopathic Primary Care of Patients With Inflammatory Bowel Disease: A Review
Bragg, J. D.
The Journal of the American Osteopathic Association, 2014/09
Free full text
552

Welche Bedeutung hatte das vaskuläre System in den Schriften von A. T. Still? – eine Literaturstudie
(What was the importance of the vascular system in the writings of A. T. Still? - a literature study)
Froger, P., Breton, J. L., Sarzeaud, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
553

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text
554

Application of OMT in a Pediatric Postoperative Ileus Case
Domalski, R. S., Nimkoff, L., Yao, S. C., Kooyman, P. S.
The AAO Journal, 2014/06
Free full text
555

Vibration und Gewebewiederherstellung
(Vibration and tissue repair)
Garoli, A.
Osteopathische Medizin, 2014/06
556

Osteopathic manipulative treatment for inpatients with pulmonary exacerbations of cystic fibrosis: effects on spirometry findings and patient assessments of breathing, anxiety, and pain
Swender, D. A., Thompson, G., Schneider, K., McCoy, K., Patel, A.
The Journal of the American Osteopathic Association, 2014/06
Free full text
557

Lymphatic pump treatment enhances the lymphatic and immune system and ameliorates disease severity in a rat model of respiratory infection
Schander, A.
Unpublished PhD thesis, 2014/05
558

Introducing an osteopathic approach into neonatology ward: the NE-O model
Cerritelli, F., Martelli, M., Renzetti, C., Pizzolorusso, G., Cozzolino, V., Barlafante, G.
Chiropractic & Manual Therapies, 2014/05
Free full text
559

Investigation into factors influencing roles, relationships, and referrals in integrative medicine
Gray, B., Orrock, P.
The Journal of Alternative and Complementary Medicine, 2014/05
Free full text
560

Honoring the Medicine: searching for the embodiment of spiritual commitment and philosophy for student physicians
Roseman, J. L.
Advances in Mind-Body Medicine, 2014/04
561

Envisioning a global role for osteopathic medicine in the 21st century: Using Blue Ocean Strategy to promote osteopathic health care as the World's leader in healthcare education and do it more efficiently, effectively and at the lowest cost
Slocum, P. C., Papa, F.
International Journal of Osteopathic Medicine, 2014/03
562

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01
563

Corrigendum to “Osteopathic Manipulative Treatment (OMT) for Lower Urinary Tract Symptoms (LUTS) in women” [J. Bodyw. Mov. Ther. 17 (2013) 11–18]
Franke, H., Hoesele, K.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text
564

Does the diaphragm fatigue more easily in patients with recurrent low back pain?
Walker, S.
International Journal of Osteopathic Medicine, 2013/12
565

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text
566

Emotional processing and its relationship to chronic low back pain: results from a case-control study
Esteves, J. E., Wheatley, L., Mayall, C., Abbey, H.
Manual Therapy, 2013/12
567

Fiabilitat Inter i Intraexaminador del Test Soto Hall en Persones Sanes.
(The inter and intra-examiner reliability of Soto hall test in healthy people)
Cònsol Urgellés, N, Nin Dalmau, M.
, 2013/11
568

Sind Grundzüge des biodynamischen Gedankenguts schon bei Still zu finden?
(Are basic features of biodynamic thinking already to be found in Still?)
Roth, R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
569

The effects of osteopathic treatment on common femoral artery blood flow and skin temperature in spinal cord injured and able-bodied individuals
Murray, D.
Unpublished MSc thesis, 2013/10
Free full text
570

Klinische Forschung in der Osteopathie – Teil 2: neuronale und organische Störungen
(Clinical research in osteopathy - Part 2: Neuronal and organic disorders)
Rauch, A.
Osteopathische Medizin, 2013/09
571

Neurologische Betrachtung der Osteopathie
(Neurological consideration of osteopathy)
Eckardt, P.
Osteopathische Medizin, 2013/09
572

Neurologische Integration nach Allan Phillips
(Neurological integration by Allan Phillips)
Eckardt, P.
Osteopathische Medizin, 2013/09
573

Thoracic and abdominal lymphatic pump techniques inhibit the growth of S. pneumoniae bacteria in the lungs of rats
Creasy, C., Schander, A., Orlowski, A., Hodge, L. M.
Lymphatic Research and Biology, 2013/09
Free full text
574

The effect of OMT on postoperative medical and functional recovery of coronary artery bypass graft patients
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/08
Free full text
575

Mathematical analysis of the flow of hyaluronic acid around fascia during manual therapy motions
Roman, M., Chaudhry, H., Bukiet, B., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2013/08
Free full text
576

Demonstration of Increased Vascular Characteristics Using Bilateral, Multiparameter Sensors After Controlled Vertebral Osteopathic Manipulative Treatment
Heath, D. M., Makin, I. R. S., Pedapati, C., Mast, T. D.
The Journal of the American Osteopathic Association, 2013/08
577

Visceral Manipulation Is Shown to Reduce Postoperative Ileus in an Animal Model
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
578

Osteopathic intervention for chronic pain, remaining thoracic stiffness and breathing impairment after thoracoabdominal oesophagus resection: A single subject design study
Bjerså, K., Sachs, C., Hyltander, A., Fagevik Olsén, M.
International Journal of Osteopathic Medicine, 2013/06
579

Palpatory phenomena in the limbs: A proposed mechanism
Scarr, G.
International Journal of Osteopathic Medicine, 2013/06
580

Does lumbar spinal movement differ between patients who are healthy, those with simple low back pain and those with degenerative or pre-operative spinal conditions?
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2013/06
581

Klinische Forschung in der Osteopathie – Teil 1: muskuloskelettale Störungen
(Clinical research in osteopathy - Part 1: Musculoskeletal disorders)
Rauch, A.
Osteopathische Medizin, 2013/06
582

Osteopathie und Unfruchtbarkeit
(Osteopathy and infertility)
Kermorgant, G.
Osteopathische Medizin, 2013/06
583

The liquorodynamic model of the primary respiratory mechanism
Moskalenko, Y. E., Kravchenko, T. I., Weinstein, G. B., Vardy, T. C.
The AAO Journal, 2013/06
Free full text
584

The effect of osteopathic manipulative treatment on postoperative medical and functional recovery of coronary artery bypass graft patients
Wieting, J. M., Beal, C., Roth, G. L., Gorbis, S., Dillard, L., Gilliland, D., Rowan, J.
The Journal of the American Osteopathic Association, 2013/05
Free full text
585

Effect of osteopathic manipulative treatment on incidence of postoperative ileus and hospital length of stay in general surgical patients
Baltazar, G. A., Betler, M. P., Akella, K., Khatri, R., Asaro, R., Chendrasekhar, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text
586

Sensory integration syndrome or developmental coordination disorder: A case report
Crow, T.
The AAO Journal, 2013/03
Free full text
587

Reliabilität der Testung der abdominalen Diaphragmaspannung im Seitenvergleich (Interrater-Test Retest Studie)
(The Test of the Abdominal Diaphragm Tension and its Reliability concerning the Right and Left Body (Interrater-Test Retest Study))
Gruber, S.
Unpublished MSc thesis, 2013/03
Free full text
588

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
589

Abdominal Visceral Manipulation Prevents and Reduces Peritoneal Adhesions
Seffinger, M. A., Martin, A. J.
The Journal of the American Osteopathic Association, 2013/01
Free full text
590

Evidencia científica del movimiento respiratorio primario y su aceptación en las diferentes escuelas de osteopatía del mundo
(Scientific evidence of the primary respiratory movement and its acceptance in the different osteopathic schools of the world)
Caicedo Ocampo, M. d. P.
Unpublished MSc thesis, 2013/01
Free full text
591

Visceral massage reduces postoperative ileus in a rat model
Chapelle, S. L., Bove, G. M.
Journal of Bodywork and Movement Therapies, 2013/01
592

Manual therapy for childhood respiratory disease: a systematic review
Pepino, V. C., Ribeiro, J. D., Ribeiro, M. A., de Noronha, M., Mezzacappa, M. A., Schivinski, C. I.
Journal of Manipulative and Physiological Therapeutics, 2013/01
593

Thermographic Skin Measurement and Osteopathic Palpation of Tibial Interosseous Strains in Adults A Comparative Pilot Study.
Muntinga, E.
Unpublished D.O. thesis, 2013
594

Investigation into the role subject foot position has on the assessment of the Seated Flexion Test and a test of inter-rater reliability
Silva, M. J., Boudakian, C., Hruby, R.
The AAO Journal, 2012/12
Free full text
595

Evaluation der Interindividuellen Reliabilität eines osteopathischen Gewebetests (Gesamtgewebe-Restriktions-Tests/All Tissue Tension Test). Eine diagnostische Studie.
(The All Tissue Tension Test (A Triple T): Evaluation of Interrater Reliability. Diagnostic Study)
Krieger, A., Roggendorf, M.
Unpublished D.O. thesis, 2012/10
596

Die Beweglichkeit des Dünndarms bei In- und Exspiration
(The mobility of the small intestine during inspiration and expiration)
Schröter, F.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
597

Three-Dimensional Analysis of OMT in the Post–Total Arthroplasty Knee
Simela, A.
The Journal of the American Osteopathic Association, 2012/08
598

Increase of lower esophageal sphincter pressure after osteopathic intervention on the diaphragm in patients with gastroesophageal reflux
da Silva, R. C., de Sa, C. C., Pascual-Vaca, A. O., de Souza Fontes, L. H., Herbella Fernandes, F. A., Dib, R. A., Blanco, C. R., Queiroz, R. A., Navarro-Rodriguez, T.
Diseases of the Esophagus, 2012/07
Free full text
599

The White-Coat Dilemma: Are Collaborative Practices the Answer to the Primary Care Shortage?
Murthy, K. K.
Unpublished MSc thesis, 2012/05
Free full text
600

Efficacy of osteopathic manipulative treatment for low back pain in euhydrated and hypohydrated conditions: a randomized crossover trial
Parker, J., Heinking, K. P., Kappler, R. E.
The Journal of the American Osteopathic Association, 2012/05
Free full text
601

Kopfschmerzbehandlung – Gedanken aus dem Praxisalltag
(Practice and technique: Treatment of headache - Thoughts from the practical daily routine)
Unverricht, R.
Osteopathische Medizin, 2012/03
602

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text
603

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03
604

A pilot study to compare the views of traditionally trained and CAM-trained therapists using the clinical exemplar of the management of neck/upper limb pain to assess barriers to effective integration of approaches
Denyer, K., Smith, H., Davies, K., Horne, R., Hankins, M., Walker-Bone, K.
Complementary Therapies in Medicine, 2012/02-04
605

Osteopathic manipulative treatment effectiveness in severe chronic obstructive pulmonary disease: a pilot study
Zanotti, E., Berardinelli, P., Bizzarri, C., Civardi, A., Manstretta, A., Rossetti, S., Fracchia, C.
Complementary Therapies in Medicine, 2012/02-04
Free full text
606

Oral health awareness for osteopathic medical students--a medical and dental collaborative effort
Rosenheck, A. H., Scott, G. J., Dombrowski, H. T., Cohen, H. V., York, J. A., Kleiman, A., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/02
Free full text
607

Osteopathie und ihre Wirkung auf lumbale, diskogene Radikulopathien bei CT -gezielt periradikulär infiltrierten Patienten
(Osteopathy and its effect on lumbar radicular pain related to patients with CT-guided nerve root infiltrations)
Rachinger, J.
Unpublished MSc thesis, 2012/01
Free full text
608

Beeinflusst die CV4 - Technik die Anpassungsfähigkeit für große und extreme Höhen?
(Does the CV4 technique influence adaptability to great and extreme heights)
Pichler, M.
Unpublished MSc thesis, 2012/01
Free full text
609

The immediate effect of osteopathic ‘rib raising’ technique on heart rate variability: a randomised sham controlled experiment
White, N.
Unpublished MSc thesis, 2012/01
Free full text
610

Effect of OMT on Heart Rate in Normotensive and Prehypertensive Individuals
Siu, V. N., Cooper, A., Rezk, M., Terzella, M., Yao, S. C., Gilliar, W.
The Journal of the American Osteopathic Association, 2012/01
611

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12
612

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text
613

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12
614

Palpation des kraniosakralen Rhythmus
(Palpation of the craniosacral rhythm)
Liem, T.
Osteopathische Medizin, 2011/12
615

Kranialer rhythmischer Impuls: Ist die palpierte Frequenz abhängig von der Berufserfahrung der Untersucher?
(Cranial rhythmic impulse: Is the palpation frequency dependent on the professional experience of the examiner?)
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
Osteopathische Medizin, 2011/12
616

The role of spinal manipulation, soft-tissue therapy, and exercise in chronic obstructive pulmonary disease: a review of the literature and proposal of an anatomical explanation
Engel, R., Vemulpad, S.
The Journal of Alternative and Complementary Medicine, 2011/09
Free full text
617

Interrater-Reliabilität bei der Beurteilung der Körpersprache nach dem Fasziendistorsionsmodell (FDM)
(Interrater reliability in evaluating the body language based on the Fascial Distortion Model (FDM))
Anker, S.
Unpublished MSc thesis, 2011/09
Free full text
618

A Possible Contribution of Osteopathic Medicine in the Management of Children Affected by ADD/ADHD
Accorsi, A., Chiara, L., Di Mattia, L., Granchelli, C., Cozzolino, V., Cerritelli, F., Pizzolorusso, G., Barlafante, G.
The Journal of the American Osteopathic Association, 2011/08
619

Effects of Osteopathic Cranial Manipulation on Biogenic Amine Levels, Heart Rate, and Blood Pressure in Adult Humans
Semeniken, K. R., Miller, P. A., Fuhrer, J. M., Farris, D.A., Parry, M. J., Petros, V., Corso, T.
The Journal of the American Osteopathic Association, 2011/08
620

Der Einfluss von Rudolf Virchow auf Andrew Taylor Still – eine kulturwissenschaftliche Untersuchung
(The influence of Rudolf Virchow on Andrew Taylor Still - A cultural scientific investigation)
Nagel, M., Bahr, C., Ciranna-Raab, C.
Osteopathische Medizin, 2011/06
621

Entwicklung eines Scores zur Untersuchung der Kopfgelenke von Säuglingen und Bestimmung der Interraterreliabilität
(Development of a score for the examination of the atlantoaxial joint of infants and for the diagnose of interrate reliabilities)
Jakubczyk, M.
Unpublished MSc thesis, 2011/06
Free full text
622

Interprofessional education: cooperation among osteopathic medicine, pharmacy, and physician assistant students to recognize medical errors
Meszaros, K., Lopes, I. C., Goldsmith, P. C., Knapp, K. K.
The Journal of the American Osteopathic Association, 2011/04
Free full text
623

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03
624

Erratum to “Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways” [International Journal of Osteopathic Medicine 13 (2010) 133–142]
Watson, L. A., Pizzari, T., Balster, S.
International Journal of Osteopathic Medicine, 2011/03
625

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
626

A randomized controlled trial investigating the effects of craniosacral therapy on pain and heart rate variability in fibromyalgia patients
Castro-Sánchez, A. M., Matarán-Peñarrocha, G. A., Sánchez-Labraca, N., Quesada-Rubio, J. M., Granero-Molina, J., Moreno-Lorenzo, C.
Clinical Rehabilitation, 2011/01
627

Desarrollo de un sistema multimedia como herramienta educativa para osteopatía estructural de la articulación sacroiliaca
(Development of a multimedia system as an educational tool for structural osteopathy of the sacroiliac joint)
Mahecha Orjuela, D. M.
Unpublished MSc thesis, 2011/01
Free full text
628

A preliminary investigation into the attitudes and practices of New Zealand osteopaths in relation to the health care system: Does the future hold a greater degree of integration into the biomedical system?
Rose, L.
Unpublished MSc thesis, 2011/01
Free full text
629

Reliability of bony anatomic landmark asymmetry assessment in the lumbopelvic region: application to osteopathic medical education
Stovall, B. A., Kumar, S.
The Journal of the American Osteopathic Association, 2010/11
Free full text
630

Hat die osteopathische Behandlung Einfluss auf Immunparameter bei Patienten mit chronischen Rückenschmerzen? Prä-Post Pilotstudie
(Does osteopathic treatment influence immune parameters in patients with chronic low back pain? A pre-post pilot trial)
Conrady, A., Döring, R.
Unpublished D.O. thesis, 2010/10
631

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests over a 4-month period
Degenhardt, B. F., Johnson, J. C., Snider, K. T., Snider, E. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text
632

Intertester Reliabilität von Palpationsbefunden von Dysfunktionen der Synchondrosis Sphenobasilaris
(Intertester reliability of palpation findings concerning synchondrosis sphenobasilaris dysfunctions)
Mitterlehner, T.
Unpublished MSc thesis, 2010/09
Free full text
633

Lymphatic pump treatment reduces pulmonary tumors in the rat
Pedrueza, M., Zhang, X., Jones, H. P., Hodge, L. M.
International Journal of Osteopathic Medicine, 2010/09
634

Hamo-Study 3, Phase 1: Effects of sternotomy on the mobility of the heart under influence of respiration at 3-months postoperative
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2010/09
635

Osteopathic management of an adult patient suffering from trigeminal neuralgia after a post-operative Arnold Chiari type 1 decompression: Case report
Zegarra-Parodi, R., Allamand, P.
International Journal of Osteopathic Medicine, 2010/09
636

Differential Effects of Suboccipital Inhibition and Fourth Ventricle Compression On Heart Rate Variability: Evidence For Bi-Directional Modulation Of Autonomic Tone
Snider, E. J., Snider, K. T., Halma, K. D., Fossum, C., Fryer, G., Yang, Q., Mueller, G., Bluml, E. M., Purcell, E.
The Journal of the American Osteopathic Association, 2010/08
637

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text
638

Wie gut funktioniert die Zusammenarbeit zwischen Zahnärzten und Osteopathen im Raum Steiermark?
(How efficient is the cooperation between dentists and osteopaths in Styria?)
Kaltenböck, M.
Unpublished MSc thesis, 2010/05
Free full text
639

Fe de errores de “El efecto en el umbral del dolor en un miotoma tras la manipulación vertebral del nivel correspondiente, ¿es infl uenciable por las expectativas del sujeto?”
(Erratum to “The effect on the pain threshold in a myotome after a spinal manipulation… is it influenced by the subject's expectations?“)
Manso, M. G., Rodríguez Díaz, J.
Osteopatía Científica, 2010/05
640

Diagnosis and management of primary pulmonary leiomyosarcoma
Arnold III., L. M., Burman, S. D., H., O-Yurvati A.
The Journal of the American Osteopathic Association, 2010/04
Free full text
641

Case Study: Exhalation Somatic Dysfunction after Multiple Rib Fractures and Pneumothorax
Calman, J.
The AAO Journal, 2010/03
Free full text
642

Efficacy of osteopathic manipulation as an adjunctive treatment for hospitalized patients with pneumonia: a randomized controlled trial
Noll, D. R., Degenhardt, B. F., Morley, T. F., Blais, F. X., Hortos, K. A., Hensel, K., Johnson, J. C., Pasta, D. J., Stoll, S. T.
Osteopathic Medicine and Primary Care, 2010/03
Free full text
643

Effectiveness of muscle energy technique on quadratus lumborum in acute low back pain-randomized controlled trial
Patil, P. N., Chandu, B., Metgud, S., Khatri, S.
Indian Journal of Physiotherapy & Occupational Therapy, 2010/01
Free full text
644

Inter-Intrareabilitätsstudie zur Testung cranialer Strukturen im Konzept der ''Mechanischen Vernetzung'' (Lien Mechanik Osteopathy-LMO)
(Inter-examiner Study for cranial Structures in the examination record of Lien Mechanique Osteopatique (LMO))
Richter-Schultz, K.
Unpublished MSc thesis, 2010/01
Free full text
645

Inter-Intrareabilitätsstudie zur Testung cranialer Strukturen im Konzept der ''Mechanischen Vernetzung'' (Lien Mechanik Osteopathy-LMO)
(Inter-examiner Study for cranial Structures in the examination record of Lien Mechanique Osteopatique (LMO))
Richter-Schultz, K.
Unpublished MSc thesis, 2010/01
Free full text
646

Diseño de un modelo de atención en osteopatía desde el componente de la prestación de servicios, orientado hacia el manejo de pacientes con lumbalgia de tipo mecánico, para instituciones prestadoras de servicios de salud de mediana complejidad en Colombia
(Design of an osteopathic care model from the service delivery component, oriented towards the management of patients with mechanical low back pain, for medium complexity health care institutions in Colombia)
Mejía Arango, A.
Unpublished MSc thesis, 2010/01
Free full text
647

Der Einfluss der osteopathischen Behandlung auf die respiratorische Leistung bei Kindern mit Asthma bronchiale
(The influence of osteopathic treatment on the respiratory capabilities of children suffering from asthma)
Schäfer, E.M.
Unpublished MSc thesis, 2009/12
Free full text
648

Reliabilitätsstudie über die Befunderhebung der Wirbelsäule nach der Methode der Lien Mécanique Ostéopathique
(A reliability study on spine findings according to the LMO method)
Hafen-Bardella, C.
Unpublished MSc thesis, 2009/11
Free full text
649

Hat eine entstauende osteopathische Leberbehandlung einen messbaren Einfluss auf den Durchfluss der Lebervenen?
(Do osteopathic liver-decongestion techniques influence the flow rate of the hepathic veins measurably?)
Haermeyer, C., Pott, S.
Unpublished D.O. thesis, 2009/10
650

Die Darstellung der fascialen Verbindungen der Flexura duodenojejunalis in der anatomischen Präparation und ihre Beschreibung in der Literatur
(Description of fascial connections of the duodenojejunal junction in anatomical preparations and its representation in literature)
Wagner-Koch, M.
Unpublished D.O. thesis, 2009/10
651

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
652

Trager® Psychophysische Integration
(Trager® Psychophysical Integration)
Heigl, M.
Osteopathische Medizin, 2009/09
653

Análisis de la fiabilidad palpatoria del pulso en la arteria radial mediante sonografía Doppler
(Analysis of the reliability of radial artery pulse palpation through Doppler sonography)
Cortés Vega, M. D., Rodríguez Blanco, C., González García, P., Ribelles Mayo, J., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09
654

The Changing Face of Medical Education: The Role of Religion, Integrative Medicine and Osteopathy
Grossoehme, D. H., Ragsdale, J., Dixon, C., Berz, K., Zimmer, M.
The Open Medical Education Journal, 2009/05
Free full text
655

The Influence of Emotion on the Risk Perception and Situation Awareness of Clinicians
Lee, W.
Unpublished PhD thesis, 2009/03
Free full text
656

Einfluss der Osteopathie auf Uroflowmetrie, Miktionsbeschwerden und Lebensqualität bei Männern mit einer symptomatischen benignen Prostatahyperplasie
(Influence of Osteopathy on Uroflowmetry, Lower Urinary Tract Symptoms and Quality of Life in Men with Symptomatic Benign Prostatic Hyperplasia)
Gadringer, K.H.
Unpublished MSc thesis, 2009/02
Free full text
657

The Influence of the Application of a Sternal Recoil Technique on Spirometric Parameters in Smokers
Weiler, J.
Unpublished MSc thesis, 2009/02
Free full text
658

The effect of osteopathic manipulative techniques on diaphragm movement and respiratory function in asymptomatic subjects
Hosking, S.
Unpublished MSc thesis, 2009/01
Free full text
659

The effects of segmental vibration on hamstring range of motion
Clamp, M. L.
Unpublished MSc thesis, 2009/01
Free full text
660

Comparing Changes in Serum Nitric Oxide Levels and Heart Rate After Osteopathic Manipulative Treatment (OMT) Using the Dalrymple Pedal Pump to Changes Measured After Active Exercise
Overberger, R., Hoyt, J. A., Daghigh, F., Bell, M., Schoenfeldt, B., Bailey, J. W., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2009/01
661

Osteopathie bei Frühgeborenen
(Osteopathy with Premature Infants)
Lamberts, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
662

Hamo-study ii: effects of sternotomy on the mobility of the heart under influence of respiration
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2008/12
663

The standing flexion test is reproducible but fails to reveal sacroiliac joint ankylosis
Mandara, A., Sosio, S., Di Mattia, C.
International Journal of Osteopathic Medicine, 2008/12
664

Three pathways to a physician career: applicants to U.S. MD and DO schools and U.S. Citizen applicants to international medical schools
Jolly, P., Garrison, G., Boulet, J. R., Levitan, T., Cooper, R. A.
Academic Medicine, 2008/12
665

The living matrix: a model for the primary respiratory mechanism
Lee, R. P.
Explore (NY), 2008/11
666

Framingham–Studie
(Framingham Study)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
667

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques: a pilot crossover trial
Rivers, W. E., Treffer, K. D., Glaros, A. G., Williams, C. L.
The Journal of the American Osteopathic Association, 2008/11
Free full text
668

Supporting and promoting osteopathic medicine through community-based family practice preceptorships: a survey-based study
Aguwa, M. I., Monson, C. L., Liechty, D. K., Fowler, L. V., Kost, M. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
669

Clinical and research protocol for osteopathic manipulative treatment of elderly patients with pneumonia
Noll, D. R., Degenhardt, B. F., Fossum, C., Hensel, K.
The Journal of the American Osteopathic Association, 2008/09
Free full text
670

Einschneidende Rituale
(Drastic Rituals)
Knöppler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
671

Osteopathic Manipulative Treatment for Postoperative Nausea and Vomiting
Schrick-Senasac, S. L., King, H. H.
The Journal of the American Osteopathic Association, 2008/08
672

Sistema estomatognático, osteopatía y postura
(The stomatognathic system, osteopathy and posture)
Oliva Pascual-Vaca, Á., Rodríguez Blanco, C.
Osteopatía Científica, 2008/08
673

A Comparison of Swedenborg’s and Sutherland’s Descriptions of Brain, Dural Membrane and Cranial Bone Motion
Fuller, D. B.
The AAO Journal, 2008/06
Free full text
674

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text
675

Immediate effects of osteopathic manipulative treatment in elderly patients with chronic obstructive pulmonary disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text
676

Características de los movimientos intervertebrales y los cambios de presión intradiscal durante la manipulación de la columna lumbar: estudio de viabilidad
(Highlighting of intervertebral movements and variations of intradiskal pressure during lumbar spine manipulation: a feasibility study)
Maigne, J.Y., Guillon, F.
Osteopatía Científica, 2008/04
677

Communication Concept for the Austrian Osteopathic Association and the Individual Osteopath
Rüscher, M.
Unpublished MSc thesis, 2008/02
Free full text
678

Die visuelle Analogskala
(The visual analog scale)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
679

Inter-examiner reliability of four static palpation tests used for assessing pelvic dysfunction
Holmgren, U., Waling, K.
Manual Therapy, 2008/02
680

Doctors’ knowledge of osteopathy in the district of Bregenz
Seewald, S.
Unpublished MSc thesis, 2008/02
Free full text
681

Intertester reliability and validity of motion assessments during lumbar spine accessory motion testing
Landel, R., Kulig, K., Fredericson, M., Li, B., Powers, C. M.
Physical Therapy & Rehabilitation Journal, 2008/01
Free full text
682

Evidence-informed management of chronic low back pain with prolotherapy
Dagenais, S., Mayer, J., Haldeman, S., Borg-Stein, J.
The Spine Journal, 2008/01
683

Psychological response in spinal manipulation (PRISM): a systematic review of psychological outcomes in randomised controlled trials
Williams, N. H., Hendry, M., Lewis, R., Russell, I., Westmoreland, A., Wilkinson, C.
Complementary Therapies in Medicine, 2007/12
Free full text
684

Is operative delivery associated with postnatal back pain at eight weeks and eight months? A cohort study
Patel, R. R., Peters, T. J., Murphy, D. J.
Acta obstetricia et gynecologica Scandinavica, 2007/11
685

The influence of an Osteopathic treatment on the performance of a high - performance athlete
Böhmüller, E.
Unpublished MSc thesis, 2007/10
Free full text
686

Zum Verständnis grundlegender Konzepte bei A.T. Still: form, function, generation, degeneration
(Understanding basic concepts in A.T. Still: form, function, generation, degeneration)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
687

Examining the Somatic Dysfunction: Lessons Learned in Practice
Danto, J. B., Danto, D. Z., Burns, A. T.
The AAO Journal, 2007/09
Free full text
688

Role of osteopathic manipulative treatment in altering pain biomarkers: a pilot study
Degenhardt, B. F., Darmani, N. A., Johnson, J. C., Towns, L. C., Rhodes, D. C., Trinh, C., McClanahan, B., DiMarzo, V.
The Journal of the American Osteopathic Association, 2007/09
Free full text
689

The influence of the osteopathic treatment on the vegetative neural system.The technique “Compression of the 4th ventricle“ influences brain activity, bloodpressure, heart rate and respiration rate
Brandstötter, L., Winkler, W.
Unpublished MSc thesis, 2007/09
Free full text
690

Comparing the Effects of Cranial Manipulation on Heart Rate Variability and Traube-Hering-Mayer Waves
Pexton, T., Nelson, K., Glonek, T., Heinking, K., Kappler, R., Sergueef, N.
The Journal of the American Osteopathic Association, 2007/08
691

The effect of cranial-sacral membrane and fluid balance technique on the autonomic nervous system using pulse rate, breathing frequency and blood pressure as indicators
Schneider, R.
Unpublished MSc thesis, 2007/03
Free full text
692

The Influence of osteopathy on the vegetative nervous system in chronic pain patients
Fürpaß, E.
Unpublished MSc thesis, 2007/03
Free full text
693

Effects of Osteopathic Work to Mother and Child Regarding Foetal Heart Rate, Uterine contractions, Lumbosacral Mobility, and Objective Parameters of Delivery
Hampel, E.
Unpublished MSc thesis, 2007/03
Free full text
694

Erratum to “The effectiveness of non-invasive treatments for active myofascial trigger point pain: A systematic review of the literature” [International Journal of Osteopathic Medicine 9 (2006) 120–136]
Rickards, L. D.
International Journal of Osteopathic Medicine, 2007/03
695

Mechanical Link. Ein osteopathisches Diagnose- und Behandlungskonzept
(The mechanical link: An osteopathic diagnosis and treatment concept)
Somody-Neplaz, I., Chauffour, P., Prat, E.
Osteopathische Medizin, 2007/02
696

Comparison between CV4 and EV4 via Biofeedback-measurement
Grill, M.
Unpublished MSc thesis, 2007/01
Free full text
697

Touching Reliability
Sommerfeld, P.
Unpublished MSc thesis, 2007/01
Free full text
698

Osteopathy. Sensing and Philosophy
Weber, K.H.
Unpublished MSc thesis, 2007/01
Free full text
699

Das Mediastinum und Intrathorakales Fasziales Release
(The mediastinum and intrathoracal fascial release)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
700

Erratum to “Patient perception of practitioner intention in osteopathy in the cranial field – A preliminary investigation” [International Journal of Osteopathic Medicine 2006;9(1):46]
McFarlane, S., Standen, C., Roy, D., McPartland, J. M.
International Journal of Osteopathic Medicine, 2006/12
701

Non-Operative Management of Spinal Stenosis
Greenman, P. E.
The AAO Journal, 2006/12
Free full text
702

Topographische Untersuchung der Anhaftungen des Pericards (im Mediastinum) zu seinen kaudalen, dorsalen, anterioren und lateralen Nachbarstrukturen. Grundlage zur weiteren Optimierung von osteopathischen Techniken
(Topographic examination to the connections of the pericardium to its neighboring organs from cranial to caudal, anterior to posterior and medial to lateral. To create a basis for the optimization of osteopathic methods)
Bartmer-Leitl, E., Kaufer, C.
Unpublished D.O. thesis, 2006/10
703

Fascia renalis: Die Beschreibung des faszialen Situs in der anatomischen Literatur und seine Darstellung im Präparat
Renal fascia: Literature review and cadaver dissections
Schwerdtner, H.P, Watzl, H.
Unpublished D.O. thesis, 2006/10
704

AOA needs to reach out more
Tatum, W. O.
The Journal of the American Osteopathic Association, 2006/08
Free full text
705

Osteopathic physicians in the United States: antibiotic prescribing practices for patients with nonspecific upper respiratory tract infections
Sun, C., Jew, S., Dasta, S. L.
The Journal of the American Osteopathic Association, 2006/08
Free full text
706

Neuropsychiatric symptoms and medical illness in patients with dementia: an exploratory study
Tran, P., Schmidt, K., Gallo, J., Tuppo, E., Scheinthal, S., Chopra, A., Libon, D. J.
The Journal of the American Osteopathic Association, 2006/07
Free full text
707

Benötige ich ein Kunstgelenk?
(Do I need an artificial joint?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
708

Post Operative Osteopathic Manipulative Protocol for Delivery by Students in an Allopathic Environment
Clark, R. C., McCombs, T. M.
The AAO Journal, 2006/06
Free full text
709

Was ist der „kraniosakrale Rhythmus“?
(What is the craniosacral rhythm? An article on employing craniosacral osteopathy (CSO))
von Heymann, W., Kohrs, C.
Manuelle Medizin, 2006/06
710

Osteopathic manipulative treatment of a 27-year-old man after anterior cruciate ligament reconstruction
Gugel, M. R., Johnston, W. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text
711

Factors affecting the intra-examiner and inter-examiner reliability of palpation for supine medial malleoli asymmetry
Fryer, G.
International Journal of Osteopathic Medicine, 2006/06
712

Nonobstetric lacerations of the vagina
Sloin, M. M., Karimian, M., Ilbeigi, P.
The Journal of the American Osteopathic Association, 2006/05
Free full text
713

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05
714

Calling all osteopathic physicians in New England!
Rossignol, M. E.
The Journal of the American Osteopathic Association, 2006/04
715

Reliability of visual assessment for lumbar curves in standing: Does clinical experience matter?
Moran, R. W., Ljubotenski, E.
International Journal of Osteopathic Medicine, 2006/03
716

Patient perception of practitioner intention in osteopathy in the cranial field – A preliminary investigation
McFarlane, S., Standen, C., Roy, D.
International Journal of Osteopathic Medicine, 2006/03
717

The correction of vertebral joint dysfunctions changes cerebrovascular and cerebrospinal fluid functional parameters improving some Primary Respiratory Mechanism parameters
Mandara, A., Moskalenko, Y., Musicco, M.
International Journal of Osteopathic Medicine, 2006/03
718

The effect of different rates of application of a rib raising technique on cardiovascular and respiratory measures in asymptomatic individuals
Farthing, R., Gosling, C., Williams, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2006/03
719

Matrix-Rhythmus-Therapie und osteopathischer Ansatz
(Matrix rhythm therapy and osteopathic approach)
Randoll, U. G., McCutcheon, R., Hennig, F. F.
Osteopathische Medizin, 2006/02
720

Computer animation and improved student comprehension of basic science concepts
Thatcher, J. D.
The Journal of the American Osteopathic Association, 2006/01
Free full text
721

Hüft-Operation und Demenz
(Hip surgery and dementia)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
722

Cranial State of Mind - Does cranial osteopathy influence the patient's state of consciousness?
Engel, R.
Unpublished MSc thesis, 2006/01
Free full text
723

The utility of exploratory data analysis techniques in analyzing outcome measures used in osteopathic manipulative medicine research
Whitesell, R.
Unpublished MSc thesis, 2005/12
724

The effect of training on the inter-examiner and intra-examiner reliability of the seated flexion test and assessment of pelvic anatomical landmarks with palpation
Fryer, G., McPherson, H. C., O'Keefe, P.
International Journal of Osteopathic Medicine, 2005/12
725

Increased lymphatic flow in the thoracic duct during manipulative intervention
Knott, E. M., Tune, J. D., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2005/10
Free full text
726

Hemodynamic effects of osteopathic manipulative treatment immediately after coronary artery bypass graft surgery
Olivencia-Yurvati, A. H., Carnes, M. S., Clearfield, M. B., Stoll, S. T., McConathy, W. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
727

Das Hüftgelenk
(The hip joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
728

Antwort auf: Crow TW: “Letter to the editor“ zu: Osteopath. Med. 5(4): 4-10, 2004: Sommerfeld P, Kaider A, Klein P: Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Answer to the letter to the editor: “Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept“ )
Sommerfeld, P.
Osteopathische Medizin, 2005/07
729

Osteopathische Narbenbehandlung
(Osteopathic cicatrice treatment)
Mayer, J.
Osteopathische Medizin, 2005/07
730

Antwort auf: Crow TW: “Letter to the editor“ zu: Osteopath. Med. 5(4): 4-10, 2004: Sommerfeld P, Kaider A, Klein P: Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Answer to the letter to the editor: “Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept“ )
Sommerfeld, P.
Osteopathische Medizin, 2005/07
731

Preoperative intravenous morphine sulfate with postoperative osteopathic manipulative treatment reduces patient analgesic use after total abdominal hysterectomy
Goldstein, F. J., Jeck, S., Nicholas, A. S., Berman, M. J., Lerario, M.
The Journal of the American Osteopathic Association, 2005/06
Free full text
732

Inter- und Intratester-Reliabilität der Palpation des “ Primären Respiratorischen Mechanismus“ innerhalb des “ Cranialen Konzeptes“
(Intertester and intratester reliability of population of the “ primary respiratory mechanism“ within the “cranial concept“)
Crow, T.
Osteopathische Medizin, 2005/03
733

Inter- und Intratester-Reliabilität der Palpation des “ Primären Respiratorischen Mechanismus“ innerhalb des “ Cranialen Konzeptes“
(Intertester and intratester reliability of population of the “ primary respiratory mechanism“ within the “cranial concept“)
Crow, T.
Osteopathische Medizin, 2005/03
734

The effects of slow rib raising on heart rate, blood pressure, respiration rate and pain pressure threshold
Farthing, R.
Unpublished MSc thesis, 2005/01
Free full text
735

The effect of rapid rib raising technique on heart rate, respiratory rate, pain pressure threshold and systolic and diastolic blood pressure in asymptomatic participants
Williams, K.
Unpublished MSc thesis, 2005/01
Free full text
736

Effects of osteopathic manipulative treatment on pediatric patients with asthma: a randomized controlled trial
Guiney, P. A., Chou, R., Vianna, A., Lovenheim, J.
The Journal of the American Osteopathic Association, 2005/01
Free full text
737

Spondylodiszitis
(Spondylodiscitis)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
738

Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept)
Sommerfeld, P., Kaider, A., Klein, P.
Osteopathische Medizin, 2004/11
Free full text
739

Gibt es eine kranielle Osteopathie?
(Is there such a thing as cranial osteopathy?)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
740

Osteopathie in der kraniellen Sphäre
(Osteopathy in the cranial sphere)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
741

Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept)
Sommerfeld, P., Kaider, A., Klein, P.
Osteopathische Medizin, 2004/11
742

Erratum: Verkettungen in der muskuloskelettalen Medizin
(Erratum: Concatenations in musculoskeletal medicine)
Lewit, K.
Osteopathische Medizin, 2004/11
743

More about the use of OMT during influenza epidemics
Magoun, H. I.
The Journal of the American Osteopathic Association, 2004/10
Free full text
744

Outpatient Osteopathic Single Organ System Musculoskeletal Exam Form series: validation of the Outpatient Osteopathic SOS Musculoskeletal Exam Form, a new standardized medical record
Sleszynski, S. L., Glonek, T., Kuchera, W. A.
The Journal of the American Osteopathic Association, 2004/10
Free full text
745

Cranial Manipulation Induces Sequential Changes in Blood Flow Velocity on Demand
Nelson, K. E., Sergueef, N., Glonek, T.
The AAO Journal, 2004/09
Free full text
746

A review of King HH and Lay EM, “Osteopathy in the Cranial Field,“ in Foundations for Osteopathic Medicine, 2nd ed
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2004/09
747

Russische Forschungsstudien im Bereich der kranialen Osteopathie
(Russian research in cranial osteopathy)
Kravchenko, T. I., Moskalenko, Y. E., Vartanyan, I. A.
Osteopathische Medizin, 2004/08
748

Literaturrecherche mithilfe des Internets
(Literature search on the internet)
Müller, T. M.
Osteopathische Medizin, 2004/08
749

Ultra Marathon Performance Improves Following OMT
Weibel, J., Lovy, A., Nelson, K. E., Kappler, R., Glonek, T.
The Journal of the American Osteopathic Association, 2004/08
750

Erratum: Suturen – Wachstumszentren des Schädels
(Erratum: Sutures - cranial growth centers)
Fanghänel, J., Preuße, U.
Osteopathische Medizin, 2004/08
751

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text
752

Pseudokrupp
(Pseudo Croup)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
753

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
754

DO relates positive experience with use of integrated neuromusculoskeletal release
Connolly, T. P.
The Journal of the American Osteopathic Association, 2004/04
Free full text
755

The effect of osteopathic manipulative medicine on pulmonary function and lung volumes in healthy adults
Bradbury, J. A.
Unpublished MSc thesis, 2004/04
756

Breathing pattern disorders, motor control, and low back pain
Chaitow, L.
Journal of Osteopathic Medicine, 2004/04
757

Inter- and intraexaminer reliability in palpation of the “primary respiratory mechanism” within the “cranial concept”
Sommerfeld, P., Kaider, A., Klein, P.
Manual Therapy, 2004/02
758

Let's learn from the influenza epidemic
Richardson, M. E.
The Journal of the American Osteopathic Association, 2004/02
Free full text
759

The effect of thoracic muscle energy technique on FVC and FEV measurements
McKenzie, C., Gosling, C.
Unpublished MSc thesis, 2004/01
Free full text
760

Discussion and literature review of primary respiration
Mahal, J.
The Journal of the American Osteopathic Association, 2004/01
Free full text
761

The effect of high velocity low amplitude manipulation on the amelioration of cervical spine rotation asymmetries: is the cavitation important?
Strachan, D.
Unpublished MSc thesis, 2004/01
Free full text
762

Review of integrated neuromusculoskeletal release and the novel application of a segmental anterior/posterior approach in the thoracic, lumbar, and sacral regions
Danto, J. B.
The Journal of the American Osteopathic Association, 2003/12
Free full text
763

“I Don't Know“
Chila, A. G.
The AAO Journal, 2003/12
Free full text
764

Presence of Chapman reflex points in hospitalized patients with pneumonia
Washington, K., Mosiello, R., Venditto, M., Simelaro, J., Coughlin, P., Crow, W. T., Nicholas, A.
The Journal of the American Osteopathic Association, 2003/10
Free full text
765

Die osteopathische Behandlung als Prävention von Geburtskomplikationen.
(Osteopathic treatment as a prevention of complications during child birth)
Lenz, D.
Unpublished D.O. thesis, 2003/10
766

Benefits of Osteopathic Manipulative Treatment After Abdominal Hysterectomy: A Retrospective Cohort Study
Ludwig, K., Hortos, K., Gupte, C.
The Journal of the American Osteopathic Association, 2003/08
767

Hemodynamic Effects of Osteopathic Manipulative Treatment (OMT) Immediately Following Coronary Artery Bypass Graft (CABG) Surgery
O-Yurvati, A. H., Carnes, M., Clearfield, M., Stoll, S. T., McConathy, W.
The Journal of the American Osteopathic Association, 2003/08
768

Osteopathic Manipulative Treatment and Congestive Heart Failure
Scheunemen, G. M., Mnabhi, A. K. S., Papp, M. A., Nelson, K. E., Glonek, T.
The Journal of the American Osteopathic Association, 2003/08
769

From the Archives: A Manual of Cranial Technique
Lippincott, R. C., Lippincott, H. A.
The AAO Journal, 2003/06
Free full text
770

Physiological Background of the Cranial Rhythmic Impulse and The Primary Respiratory Mechanism
Moskalenko, Y., Frymann, V., Kravchenko, T., Weinstein, G.
The AAO Journal, 2003/06
Free full text
771

Praktische osteopathische Überlegungen zu den Nasennebenhöhlen
(Practical osteopathic considerations for the paranasal sinuses)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
772

Bibliotherapy: the therapeutic use of didactic and literary texts in treatment, diagnosis, prevention, and training
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2003/03
Free full text
773

Alternative treatments for neck sprain
Hogg, K., Morton, R.
Emergency Medicine Journal, 2003/01
774

The effect of lymphatic pump techniques on the FEV and FVC measurements in people with asthma: a pilot study
Falzon, M.
Unpublished MSc thesis, 2003/01
Free full text
775

Etiology of lumbar pain in pregnancy
Rodriguez, W.
Unpublished MSc thesis, 2003/01
Free full text
776

An investigation of the lasting effects of thoracic manipulation and rib raising on spirometric measurements of asymptomatic participants
Williams, K.
Unpublished MSc thesis, 2003/01
Free full text
777

Das posttraumatische Kniegelenk
(The post-traumatic knee joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
778

The Primary Respiratory Mechanism
Nelson, K. E.
The AAO Journal, 2002/12
Free full text
779

Parameters of asthma and manipulation study questioned
Cali, G. E.
The Journal of the American Osteopathic Association, 2002/11
Free full text
780

Developing research at The British School of Osteopathy
Nash, K., Vogel, S.
Journal of Osteopathic Medicine, 2002/10
781

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text
782

Quantifiable effects of osteopathic manipulative techniques on patients with chronic asthma
Bockenhauer, S. E., Julliard, K. N., Lo, K. S., Huang, E., Sheth, A. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
783

Osteopathy in the cranial field: uncovering challenges and potential applications
King, H. H.
The Journal of the American Osteopathic Association, 2002/07
Free full text
784

Interexaminer reliability and cranial osteopathy
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2002/01
785

Measurement challenges in physical diagnosis: refining inter-rater palpation, perception and communication
Comeaux, Z., Eland, D., Chila, A. G., Pheley, A., Tate, M.
Journal of Osteopathic Medicine, 2001/10
786

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09
787

Effect of Pre-Emptive Morphine and Postoperative Osteopathic Manipulative Technique on Pain Following Total Abdominal Hysterectomy: A Pilot Study
Goldstein, F., Jeck, S., Nicholas, A., Berman, M., Lerario, M.
The Journal of the American Osteopathic Association, 2001/08
788

The DO May issue bridges medical philosophies
Steigman, C. K.
The Journal of the American Osteopathic Association, 2001/08
Free full text
789

Cold-induced urticaria
Mahmoudi, M.
The Journal of the American Osteopathic Association, 2001/05
Free full text
790

Highlighting of intervertebral movements and variations of intradiskal pressure during lumbar spine manipulation: A feasibility study
Maigne, J.Y., Guillon, F.
Journal of Osteopathic Medicine, 2001/04
791

The primary respiratory mechanism beyond the craniospinal axis
Lee, R. P.
The AAO Journal, 2001/03
Free full text
792

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text
793

Shortness of breath and hypoxia following exploratory laparotomy
Ettlinger, H. M.
The AAO Journal, 2000/12
Free full text
794

Re-expansion pulmonary edema following puncture of a giant bulla
McCoskey, E. H., McKinney, L. M., Byrd, R. P., Jr., Roy
The Journal of the American Osteopathic Association, 2000/12
Free full text
795

Benefits of osteopathic manipulative treatment for hospitalized elderly patients with pneumonia
Noll, D. R., Shores, J. H., Gamber, R. G., Herron, K. M., Swift, J.
The Journal of the American Osteopathic Association, 2000/12
Free full text
796

Collaboration between pharmacy and osteopathic medicine to teach via the Internet
Sweeney, M. A., Schuster, M. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text
797

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text
798

An examination of the status of osteopathic medicine from 1960 to 2000
Steinberg, S. H.
Unpublished PhD thesis, 2000/10
799

The Role of Vibration or Oscillation in the Development of Osteopathic Thought
Comeaux, Z. J.
The AAO Journal, 2000/09
Free full text
800

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09
801

Small bowel perforation: an unusual presentation for child abuse
Beckmann, K. R., Nozicka, C. A.
The Journal of the American Osteopathic Association, 2000/08
Free full text
802

Sleep and breathing disorders: the genesis of obstructive sleep apnea
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
803

A Randomized Controlled Trial of Osteopathic Manipulation Following Knee or Hip Arthroplasty
Licciardone, J. C., Stoll, S. T., Herron, K. M., Gamber, R. G., Swift, J., Winn, W.
The Journal of the American Osteopathic Association, 2000/08
804

Efficacy of a steroid nasal spray compared with an antihistamine nasal spray in the treatment of perennial allergic rhinitis
Berlin, J. M., Golden, S. J., Teets, S., Lehman, E. B., Lucas, T., Craig, T. J.
The Journal of the American Osteopathic Association, 2000/07
Free full text
805

Inhaled corticosteroid-induced bone loss and preventive strategies
Singh, R. F., Muskelly, C. C.
The Journal of the American Osteopathic Association, 2000/07
Free full text
806

Letters to the Editor
Cummings, C. H., Norton, J. M., Nelson, K. E.
The AAO Journal, 2000/06
Free full text
807

Osteoporosis issue needs addition of extension exercise findings
Juhl, J. H.
The Journal of the American Osteopathic Association, 2000/05
Free full text
808

Opportunities for the osteopathic medical profession to pursue worldwide acclaim and recognition
Smith, D. A.
The Journal of the American Osteopathic Association, 2000/05
Free full text
809

A systematic review of craniosacral therapy: Biological plausibility, assessment reliability and clinical effectiveness
Green, C., Martin, C. W., Bassett, K., Kazanjian, A.
Complementary Therapies in Medicine, 1999/12/01/
810

Osteopathic treatment of asthma: A literature review and call for research
Jackson, K. M., Steele, K. M.
The AAO Journal, 1999/12
Free full text
811

Interrater Zuverlässigkeit des Beinlängentests und des Downing Test
(Inter rater reliability of the Downing test regarding leg length discrepancy)
Hösele, K.
Unpublished D.O. thesis, 1999/10
812

(Inter rater reliability of the Downing test regarding leg length discrepancy)
Interrater Zuverlässigkeit des Beinlängentests und des Downing Test
Hösele, K.
Unpublished D.O. thesis, 1999/10
813

OMT and urinary incontinence
Farley, J. E.
The AAO Journal, 1999/06
Free full text
814

Simultaneous palpation of the craniosacral rate at the head and feet: intrarater and interrater reliability and rate comparisons
Rogers, J. S., Witt, P. L., Gross, M. T., Hacke, J. D., Genova, P. A.
Physical Therapy, 1998/11
815

Evaluierung und kritische Bewertung von Studien der Osteopathie im klinischen Bereich und im Bereich der Grundlagenforschung in der europäischen Literatur
(Evaluation and Critical Review of Clinical and Fundamental Research Studies on Osteopathy Published in the European Literature)
Schwerla, B., Hass-Degg, F., Schwerla, F.
Unpublished D.O. thesis, 1998/10
816

Application of osteopathic principles to a viral upper respiratory infection
Cavanaugh, S. P.
The AAO Journal, 1998/03
Free full text
817

Craniosacral rhythm: reliability and relationships with cardiac and respiratory rates
Hanten, W. P., Dawson, D. D., Iwata, M., Seiden, M., Whitten, F. G., Zink, T.
Journal of Orthopaedic & Sports Physical Therapy, 1998/03
Free full text
818

Cycle-to-cycle variability attributed to the primary respiratory mechanism
Lockwood, M. D., Degenhardt, B. F.
Journal of Osteopathic Medicine, 1998/01
819

Using heart variability to measure the effects of manual medicine on autonomic activity
Zullow, M.
Unpublished MSc thesis, 1997/10
820

The effect of osteopathic manipulative treatment (OMT) on heart rate and blood pressure in female athletes
Paul, F. A., Norton, J. M., Cross, N. A., Buser, B. R.
The AAO Journal, 1997/09
Free full text
821

Efficacy of osteopathic manipulative treatment in improving clinical outcomes in patients with orthopedic diagnoses admitted to a hospital-based rehabilitation unit
Brittain, P. D.
Unpublished MSc thesis, 1997/06
822

Establishment of behavioral parameters for the evaluation of osteopathic treatment principles in a rat model of arthritis
Hallas, B., Lehman, S., Bosak, A., Tierney, S., Galler, R., Jacovina, P., Scandalis, T. A., Wells, M.
Journal of Osteopathic Medicine, 1997/04
Free full text
823

Pilot study to establish whether osteopathy reduces general practice consultation rate of musculoskeletal problems based on patient perception of effectiveness of the osteopathic treatment – Part II
Banihasem, M.
The AAO Journal, 1996/12
Free full text
824

A challenge to the concept of craniosacral interaction
Norton, J. M.
The AAO Journal, 1996/12
Free full text
825

Pilot study to establish whether osteopathy reduces general practice consultation rate of musculoskeletal problems based on patient perception of effectiveness of the osteopathic treatment – Part I
Banihasem, M.
The AAO Journal, 1996/09
Free full text
826

The safety of manipulative treatment: review of the literature from 1925 to 1993
Vick, D. A., McKay, C., Zengerle, C. R.
The Journal of the American Osteopathic Association, 1996/02
Free full text
827

The Effect of Osteopathic Manipulative Treatment in the Post Abdominal Surgical Patient (A Preliminary Study)
Pratt-Harrington, D., Neptune-Ceran, R.
The AAO Journal, 1995/09
Free full text
828

Support of collaborative practice
Kuehn, A. F.
The Missouri Nurse, 1993/04
829

Primary & Secondary Respiration – Part II
Lee, R. P.
The AAO Journal, 1993/03
Free full text
830

Primary & Secondary Respiration – Part I
Lee, R. P.
The AAO Journal, 1992/12
Free full text
831

Erratum: Physiologist views osteopathic medicine from different angle (JAOA (October) (1218))
Hultgren, P. B.
The Journal of the American Osteopathic Association, 1992/11
Free full text
832

Abdominal wound closure using a running, looped monofilament polybutester suture: comparison to Smead-Jones closure in historic controls
Sutton, G., Morgan, S.
Obstetrics & Gynecology, 1992/10
833

The osteopathic cranial concept: fact or fiction?
Ferré, J. C., Barbin, J. Y.
Surgical and Radiologic Anatomy, 1991/09
834

Erratum: An open controlled assessment of osteopathic manipulation in nonspecific low-back pain (Spine (15) 5 (364-370))
MacDonald, R. S., Bell, C. M. J.
Spine (Phila Pa 1976.), 1991/01
Free full text
835

A radiological technique for measurement of the height of the trapezial cavity: Applications in pre- and post-operative assessment in osteoarthritis of the base of the thumb
Goffin, D., Saffar, P.
Annales de Chirurgie de la Main et du Membre Supérieur, 1990/12
836

Towards a conceptual framework for the continuum of clinical competence development in an undergraduate osteopathic medical education program: An exploratory study
Weaver, S. A.
Unpublished PhD thesis, 1984/01
837

The legal creation of osteopathic medicine
Helminski, F. J.
Unpublished MSc thesis, 1981/01
838

The D. O. 's: A social history of osteopathic medicine
Gevitz, N.
Unpublished PhD thesis, 1980/01
 
 
 






  • Impressum • Legal notice • Datenschutz •


ostlib.de/advanced



Supported by

OSTLIB recommends