Advanced search

   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal hemodynamic maneuverabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabdominopelvic regionabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic detailingacademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectacromioclavicular jointactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive listening testactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive rehabilitationactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute careacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute generalized exanthematous pustulosisacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadherenceadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadversityadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpha-1 constrictionalpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimers diseaseAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangiogramangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior scaleneanterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic enlargementaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplicationsapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial hypertensionarterial occlusive diseasesarterial oxygenationarterial pressurearterial rulearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrographyarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial lung ventilationartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical diabetesatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta blockerbeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybicuspid aortic valvebifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanical responsebiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipartate patellabipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblackblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringblistersbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood oxygen saturationblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasebone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone metastasisbone mineral densitybone painbone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel dysfunctionbowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachiocephalic vesselsbrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous emphysemabullous lesionsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-fiber painC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcar accidentcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac apex anglecardiac arrestcardiac cirrhosiscardiac controlcardiac electrophysiologycardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac physiologycardiac rehabiliationcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCBTCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectionCECScecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular accidentcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachial paincervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchest wall painchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild abuse: neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic exertional compartment syndromechronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic orchialgiachronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcircuit interval trainingcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical encountersclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical informaticsclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecocainecoccidioidomycosiscoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive latencycognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecold therapycold water exposurecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscolorectal screeningcolostomycomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconference registrationconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital heart diseasecongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniocervical musclescraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreative kinasecreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantscryotherapyCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademodex folliculitisdemographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentoalveolar systemdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdermoscopydescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic ketoacidosisdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic reliabilitydiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary habitsdietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscolorationdiscontinued trialsdiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisembarkment syndromedisengagement-techniquedisinfectiondisinfection protocoldisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal kyphosisdorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug approvaldrug combinationdrug industrydrug legislationdrug prescriptionsdrug reactiondrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydual-degree programsdually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenal perforationduodenojejunal junctionduodenumdupilumabduplex scanningDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadysrhythmiadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaeczema herpeticumedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational opportunitieseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRejection fractionelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiogramselectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTembarrassmentEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityempowermentemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendoscopyendothelial dysfunctionendothelial functionendovascular retrievalenduranceendurance sportsenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophiliaeosinophilic fasciitiseosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercise-induced muscle damageexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal auditory canal exostosisexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubationextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyelidseyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfaceface masksfacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial neuropathyfacial painfacial paralysisfacial structurefacial swellingfacial tapingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfall preventionfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfebrile neutrophilic dermatosisfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoral neuropathyfemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilmsfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow rateflu testingfluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood attitudesfood aversionfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenforamen magnumFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgardeninggas exchangegas gangrenegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal comorbiditiesgastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender representationgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiant cell arteritisgiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonadal veingonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgoutgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegritgroingroin injurygroin paingroove signgross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth failuregrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH. SzurmantH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaglund deformityhair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhand surgeryhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth assessmenthealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth motivationhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionalhealth professionalshealth professionshealth promotionhealth sciences librarieshealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemochromatosishemodialysishemodynamichemodynamic controlhemodynamicshemoglobinhemoglobinshemorrhagehepatic areahepatic pathologyhepatic pumping techniquehepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehereditary spherocytosisHermansky-Pudlak syndromehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanicHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghorseshospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxemiahypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPICUideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumil-1?il-1?ileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimposter syndromeimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincident painincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinduction testinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury recoveryinjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinstrumentationinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintersubjectivityintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview cycleinterview partnerinterview selectioninterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintimate partner violenceintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischemic strokeischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseisotretinoinITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. BockJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournal policyjournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansaskaposi varicelliform eruptionKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney diseasekidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage disorderslanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngeal cancerlaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTlead exposureleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukodermaleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelichen planus pigmentosus inversuslidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelifestyle modificationlift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimited functionlimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung cancerlung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniquelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. masseterm. piriformism. rectus capitis posterior minorm. temporalisM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmaltreatmentmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular mobilitymandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmaskmask mandatemasksMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch gapmatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial areamaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMay-Thurner syndromeMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie exerciseMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedical writingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmember satisfactionmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetatarsophalangeal jointmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrosurgerymicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle scalenemiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal change diseaseminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymitral valve prolapsemix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile phonesmobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsMongolian medicinemongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonoclonal antibodiesmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal healthcaremusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sphincter Oddimusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine responseneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular inhibition techniqueneuromuscular junctionneuromuscular latencyneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnevus spilusnevus unius lateralisnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusOADobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive airway diseaseobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOFTOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluonchocerciasisoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisonyxopen arteryopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen oval windowopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid usageopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral mucosaoral stageoral submucous fibrosisoral surgeryorbitorbitaorbitopathyORC-NZOregonorgan donationorgan mobilityorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational behaviororganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic exerciseosteopathic family physiciansosteopathic fascial treatmentosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatient clinicsoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen supplyoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain sensitivitypain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletsPanamapancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillary fibroelastomapapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepatent ductus arteriosuspatent foramen ovalepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatient-reported outcomespatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPBMPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer instructionpeer physical examinationpeer recoverypeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic scarspelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceived weightperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferencepercutaneous coronary interventionperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericarditispericardiumperichondritisperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperioperative outcomeperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languageperson-first languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphoniatryphonoticsphosphatidylinositol 3-kinasephotobiomodulationphotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepolitical advocacypoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagesPonseti methodpoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepositivismpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cortical atrophyposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostprandial hypotensionpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostural-perceptual dizzinesspostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-surgical carepre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprehabilitationprehypertensionprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature epiphyseal closurepremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbycusispresbyopiapresbyvestibulopathypreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm birthpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivacyprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional sportsprofessional staff committeesprofessional statusprofessional titlesprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotective sensitivityprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurigo nodularispruritic rashprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric distresspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoactive medicationpsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTHSPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary abscesspulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSpyelonephritispyoderma gangrenosumQ angleq-testQEEGqi gongqigongQLQ-C30qtc intervalquackeryquadratus lumborumquadrilateral spacequalification requirementsqualitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesracismradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrashrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreaction timereactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreadershipreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundrealismreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecord keepingrecordingrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared blood cellsred flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefractive errorsrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulationsregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch outputresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory healthcarerespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityresponsivenessrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of liferiverboardingRL1-803rlq painRLSRobert Fulfordrobotic surgeryroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff intervalrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic AssociationRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsscent detectionscent dogsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerodermasclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescrambler therapyscreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch interestsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-harmself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsseroprevalenceserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice dogsservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36SGLT2 inhibitorsshadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort term effectsshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortageshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromeShulman syndromeSibson fasciasick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin rashskin temperatureskin testsskin toneskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTSNAP technicsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialtyspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentSpecific back exercisesspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatic cordspermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphincter of Oddisphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manipulative treatmentspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervespinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinesports therapyspotted fever rickettsiosissprains and strainsspringing techniquesprintsprintingSQOR-V questionnainnairesquamous cell carcinomasquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystates of mindstaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysterilizationsternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain injurystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategic developmentstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorStroop effectstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial painsubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous emphysemasubcutaneous hemorrhagesubjective cognitive declinesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital decompressionsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital muscle inhibition techniquesuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden cardiac deathsudden infant death syndromeSudeck syndromeSufismsugarsuicidal ideationsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial heatsuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperior vena cava syndromesuperoxide anion radicalssupervised exercisesupervised injection sitessupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesuprapleural membranesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical necksurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgSweets syndromeswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandswollen earsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic hyperactivitysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynchronysynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic inertiatherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal asymmetrythermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermodiagnosticsthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic biomechanicsthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic surgerythoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthromboembolismthrombolytic therapythrombosisthrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocilizumabtocilizumab therapytocolysistoetoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatracheobronchial casttrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse diaphragmtransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment algorithmstreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment tacticstreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrial qualitytrialstriamcinolone acetonidetriathletestribal healthcaretrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUgandaUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract diseaseurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaurticarial bullous pemphigoidUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine flexionuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterine retroversionuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccination statusvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginismusvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvalvular heart diseasevancomycinvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular physiologyvascular surgeryvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena cava filtervena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexvestibuloplastyveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral pumping techniquevisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitamin deficienciesvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noisewhitewater kayakingWHOwhole body-vibrationwhole person approachwhole-body cryotherapywholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework hourswork schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysxeroderma pigmentosumyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
 
 80.4% of the records
 
 19.6 % of the records
 
 57.8 % of the records
 
 
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

6229 results (please see below)  Sort:    
1

Strategies to prevent and manage running-related knee injuries: A systematic review of randomised controlled trials
Alexander, J., Johnston, R., Ezzat, A., Culvenor, A., Barton, C.
Journal of Science and Medicine in Sport, Nov 2022 2022-11-02


3

Interexaminer reliability studies: spanning a gap in medical research--Louisa Burns Memorial Lecture
Johnston, W. L.
The Journal of the American Osteopathic Association, Aug

4

Proposal for Manual Osteopathic Treatment of the Phrenic Nerve
Bordoni, B., Escher, A. R., Duczyński, M.
Cureus, Apr


6

Delivering a student osteopath placement in a community NHS musculoskeletal outpatient clinic: a service evaluation
Chan, Y. C. E., Grogut, R., Talebnejad, M., Clarke, O., Kreutzfeldt, S., Alderton, H.
Physiotherapy, 2026/10

7

Effects of osteopathic manipulative treatment on protective sensitivity in patients with type 2 diabetes: A randomized clinical trial
de Mendonça, A. I., Pivetta, R. O. P., de Souza, H. M., Ribeiro, D. C., de Araújo, F. M. R.
Journal of Bodywork and Movement Therapies, 2026/10


9

Person-centred care in osteopathic practice in Australia: Results from a national health service use survey
Draper-Rodi, J., Vaughan, B., Fleischmann, M., Sinderholm Sposato, N.
Advances in Integrative Medicine, 2026/09

10

Cultivating calm: Gardening as a nature-based intervention to reduce anxiety symptoms in osteopathic medical students
Barrueta-Alvarez, B., Singer, M. S., Bishayee, A., Syed, M.
Advances in Integrative Medicine, 2026/09


12

Osteopathic manipulation treatment to improve glenohumeral and thoracic spine range of motion in collegiate swimmers: A pilot study
Kleis, R. R., Hora, N. J., Rich, J. R., Gady, A., Hansen, C., Furlano, A. J.
International Journal of Osteopathic Medicine, 2026/09



15

Treatment with osteopathic techniques for Meralgia Paresthetica: two case reports
Nunes, A., Campos, B.
Journal of Bodywork and Movement Therapies, 2026/07

16

The importance of osteopathic mentorship during medical school, residency, and beyond for surgical subspecialties: review of literature
Agollari, K., Modica, A., Bitterman, A.
Journal of Osteopathic Medicine, 2026/07
Free full text

17

Beyond Immersion: A Stage-Based Framework for Cross-Modal Immersive Technologies in Medical Education
Ahmad, C. M., Ngo, A. L. T., Kastle, R.A., Rufino, L., Amin, S., Evan, B., Zolnierz, M.
Cureus, 2026/07
Free full text

18

Osteopathic manipulative treatment in pediatric care: from the inception of osteopathic medicine to 1950, a historical literature review
Baroni, F., Corisio, A., Lunghi, C., Liem, T.
Journal of Osteopathic Medicine, 2026/07
Free full text

19

Differences in Residency Advising and Mentorship for Osteopathic and Allopathic Emergency Medicine Applicants
Kelner, R. H., Fix, M., Hughes, P., Stephen, R., Merritt, B., Ruggieri, J., Beaulieu, A. M.
Cureus, 2026/07
Free full text

20

The efficacy of osteopathic manipulative medicine in the treatment of low back pain: a scoping review and meta-analysis of patient-reported outcomes
Putnam, K., Harrington, K., Zapata, I., Fisher, J., Cruz, M., Tuttle, V.
Journal of Osteopathic Medicine, 2026/07
Free full text



23

Development of the training system in the field of osteopathy
(Развитие системы подготовки кадров в области остеопатии)
Ilyina, L. A., Tregubova, E. S., Mokhov, D. E., Postnikov, M. A., Kolsanov, A. V.
Russian Osteopathic Journal, 2026/07





28

Support in Singing-A Pilot Prospective Randomized Crossover Study of Osteopathy and Singing Technique in 15 Amateur Singers
Bie, J. M., Tempesta, M., Sadolin, C., Aaen, M.
Journal of Voice, 2026/07
Free full text

29

A hands-on approach to personalizing palliative care: the role of osteopathic manipulative treatment
Bryant, M., Dennison, M., Kim, S.
Frontiers in Medicine, 2026/07
Free full text


31

Board exam preparation resource trends in academic health sciences libraries serving colleges of osteopathic medicine programs
Muellenbach, J., Robinson, K., Chen, H. L., Bright, H. S. IV., Fitterling, L.
Journal of the Medical Library Association, 2026/07

32

Non-Pharmacologic Manual Therapies for Postoperative Bowel Dysfunction: A Systematic Review and Meta-Analysis
Ponce, A., Stack, E. R., Perrine, O., Hawes, C.
Journal of Clinical Medicine, 2026/07
Free full text

33

Imaging predictors of short term clinical response to osteopathic manipulative treatment in patients with knee osteoarthritis
Zhang, B., Pang, Y., Bai, Y., Yin, S., Yan, Y., Li, X., Wang, X., Zhang, Y., Wang, C., Tian, X., Du, S.
Scientific Reports, 2026/07

34

Therapeutic efficacy of individual head orthoses in infants with positional plagiocephaly
Chhatwani, S., Degener, C., Rako, L., Kirschneck, C., Möhlhenrich, S. C., Danesh, G., Kelker, M.
Journal of Orofacial Orthopedics, 2026/07
Free full text

35

A national survey of clinical informatics educational opportunities in United States medical schools
Lee, G. Y., Li, K., Patil, A., Jiang, S., Zheng, C., Baral, J., You, J., Kim, E.
Journal of the American Medical Informatics Association, 2026/06

36

Combined effects of photobiomodulation and osteopathic manipulation on the physical performance of young adults subjected to exercise-induced muscle damage: a randomized placebo-controlled trial
Freitas, J. C., Bocchi, M., Rodrigues Junior, B. A., Machado, M. R. F., Rezende, H. H. A., de Oliveira, D. M., Fernandes, E. V.
Lasers in Medical Science, 2026/06
Free full text

37

A quantitative analysis comparing pre-clinical volunteering hours with third-year medical students' preceptor evaluations
Ranta, E. K., Ranta, J. C., Redden, D., Stoner, A. M.
Journal of Osteopathic Medicine, 2026/06
Free full text

38

Artificial Intelligence in Osteopathy Education: A Critical Analysis of Educators' and Researchers' Perspectives
Suherman, U., Ulfah., Krinanda, V. D., Suhardita, K., Saputra, R., Putra
International Journal of Osteopathic Medicine, 2026/06

39

Role of osteopathic manipulative treatment in the management of persistent post-COVID-19 symptoms and functional outcomes: study protocol of a prospective pilot study
Degenhardt, B. F., Rehman, Y., Luebbering, C., Divine, W. H., Jackson, M.
Journal of Osteopathic Medicine, 2026/06
Free full text

40

Long-term chronic pain outcomes among patients treated by osteopathic physicians: per-protocol analysis of a retrospective cohort study
Licciardone, J. C., Raphi, R., McKnight, K. N., Warnesuriye, R. N., Kim, J., Black, J., Aryal, S.
Journal of Osteopathic Medicine, 2026/06
Free full text

41

Osteopathic manipulative treatment among long-term opioid prescribed patients
Yorkgitis, B. K., Harmon, I., Khan, A., Webb, F., Brat, G.
Journal of Osteopathic Medicine, 2026/06

42

Fellowship Training Trends Among Spine Neurosurgeons in Florida: A Cross-Sectional Analysis
Fioletova, M., Gill, U., Lugo, A., Echevarria Cruz, E. C., Sees, J. P.
Cureus, 2026/06
Free full text

43

Emerging treatment options for vaginismus: a comprehensive review of current evidence and future directions
Lauver, A., Addison, D., Anderson, J., Boyle, B., McDonald, H., Rizzo, D., Schraml, A., Jedynak-Bell, C., Mansour, T., Ashurst, J.
Journal of Osteopathic Medicine, 2026/06
Free full text

44

Effects of Osteopathic Manipulative Treatment in a 3-Year-Old With Pitt-Hopkins Syndrome
Duggal, V., Radigan, R., Finkelstein, A., Yao, S.
Case Reports in Pediatrics, 2026/06
Free full text

45

Responsiveness of Outcome Measures in Chronic Non-Specific Low Back Pain: A Secondary Analysis of a Randomized Controlled Trial
Fonseca, C. L., Ribeiro, P. A. S., de Carvalho, K. C. N., Andraus, R. A. C., de Moura, R. C. F., da Trindade, A. M. V., Dumont, A. J. L., Fernandes, T. V., Marconi, D. G., Pasin Neto, H., Armbrust, D., Oliveira, C. S.
Journal of Personalized Medicine, 2026/06
Free full text

46

Osteopathic Manipulative Treatment as a Complementary and Integrative Approach for Cancer Supportive Care: A Systematic Review
Patel, S., Thimons, C. J., Steele, H., Mathur, M., Boesler, D., Bishayee, A.
Cancers, 2026/06
Free full text

47

Osteopathic manipulative treatment for refractory chronic traumatic pain and mobility restrictions at a level 1 trauma center
Baltazar, G. A., Cao, M., Van Vleet, J., Hart, S., Jakubowski, A., Suree, N., Petrone, P., Islam, S., Machado, F., Rubano, J.
Journal of Osteopathic Medicine, 2026/06
Free full text

48

Predictability of cranial base strains as related to birth presentation: a review of literature
McElwain, S. K., Schmidt, D.
Journal of Osteopathic Medicine, 2026/06
Free full text

49

The role of osteopathic manipulative medicine in cerebral palsy: bridging treatment gaps and enhancing care
Ngo, A. L., Gharavi Alkhansari, N., Tadakamalla, R., Hess, M., Nguyen, U. T., Yazji, J., Rogers, R. S.
Journal of Osteopathic Medicine, 2026/06
Free full text

50

Effects of osteopathic approach in infants with deformational plagiocephaly: an outcome research study
Gasperini, M., Vanacore, N., Massimi, L., Consolo, S., Haass, C., Scapillati, M. E., Petracca, M.
Minerva Pediatrics, 2026/06

51

Fatigue in long COVID: An exploratory pragmatic randomized trial of osteopathic care plus physical therapy versus physical therapy alone
Curi, A. C. C., Antunes Ferreira, A. P., Nogueira, L. A. C., Meziat Filho, N., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2026/06
Free full text



54

Impact of Osteopathic Manipulative Technique and Circuit Interval Training on Sympathetic Hyperactivity in Pcos Women
Palanisamy, S., Janakiraman, B., Balasubramaniam, A., Kandasamy, M., Velliyangiri, S., Venkatachalam, M.
International Journal of Drug Delivery Technology, 2026/06
Free full text

55

Response to “Thoracic biomechanics or autonomic modulation? Reframing the respiratory effects of osteopathic manipulative therapy”
Zago, J., Rondinel, T., Urueña, B., Amatuzzi, F., Queiroz, R., Nascimento, L., Pivetta, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2026/06


57

Exploring the utility of ChatGPT as a learning tool in osteopathic medical education
Martin, P., Pate, N., Benmerzouga, I.
International Journal of Osteopathic Medicine, 2026/06

58

Methodological considerations for evaluating ChatGPT as a learning tool in osteopathic medical education
Saripudin, M., Hamdan, A. H., Asiah, N.
International Journal of Osteopathic Medicine, 2026/06

59

Journal Club 2026 – 2
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2026/06




63

Revolutionizing Osteopathic Education: Integrating ChatGPT and Virtual Reality for Immersive Learning
Wahyudin, H., Oktasari, M., Megawati, M., Mufarida, H., Elviana, E., Kuswandi, A.
International Journal of Osteopathic Medicine, 2026/06



66

Effect of osteopathic technique on respiratory parameters and pain in thoracic outlet syndrome
Elshinnawy, A. M., Eraky, Z. S., Abdallah, E. A., Elmasry, H. M., El-Samouly, H. M.
Journal of Bodywork and Movement Therapies, 2026/06



69

Osteopathie in Österreich
(Osteopathy in Austria)
Newiger, C.
Osteopathische Medizin, 2026/06

70

Osteopathie in Österreich
(Osteopathy in Austria)
Newiger, C.
Osteopathische Medizin, 2026/06


72

Tinnitus Tone Change Following OMT and Implementation of a Heel Lift: A Case Study
Ring, A., Kurian, A., Llanio, L., Rundquist, L., Shih, S., Schneider, N., Qureshi, Y.
The AAO Journal, 2026/06

73

Health profession students' anxiety, depression, and imposter syndrome in a rural versus urban setting
Sperling, E. L., Kennedy, K., Mehrazar, T., Takahashi, M., Rezayee, S., Zitek, C., Gresner, E., Hudson, M. G.
BMC Medical Education, 2026/05
Free full text


75

Predicting COMLEX-USA Level 2-CE using medical school performance and use for student advising
Wang, S., Basehore, P.
Journal of Osteopathic Medicine, 2026/05
Free full text

76

Osteopathic manipulative treatment in the management of headaches associated with musculoskeletal dysfunction: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Ying-Fang Wang, M., Johnston, R., Will, M., Gibson, E., Spencer, D., Garcia, C., Snider, K. T.
Journal of Osteopathic Medicine, 2026/05
Free full text

77

Osteopathic manipulative treatment for stress, anxiety, and depression: Toward mechanism-informed evidence
Ariyadi, S., Syarifah, E. F., Hermawatie, N. A., Lakilaki, E., Adha, A., Putri, R. D., Ilahi, A.
Explore (NY), 2026/05

78

Untangling the Osteopathic Gordian Knot: Reconceptualized Principles for Sustainable and Contemporary Clinical Practice-A Conceptual Perspective
Lunghi, C., Baroni, F., D'Alessandro, G., Longobardi, M., Consorti, G., Vanacore, N., Tramontano, M.
Healthcare, 2026/05
Free full text

79

Effectiveness of Manual Therapy in Patients with Obstructive Airway Disorders: A Scoping Review
Mankad, D. A., Chokshi, T. R., Satani, K.
Journal of Clinical and Diagnostic Research, 2026/05
Free full text

80

The definition of an osteopathic physician trained in the United States
Fleming, R. K., Giusti, R. E., Snider, K. T., Gebhardt, G. P., Seals, R., Zajdel, B., Heinking, K.
Journal of Osteopathic Medicine, 2026/05
Free full text

81

Correlation Between Screen Time, Sleep Duration, and Stroop Effect Among First-Year Osteopathic Medical Students: A Cross-Sectional Study
Panta, R., Del Corral, P., Hales, S., Fernandez, P., Ahearn, E., Parsamian, M.
Cureus, 2026/05
Free full text


83

Short-term benefits of osteopathic manipulative treatment for chronic low back pain: systematic review and meta-analysis
Sheppard, M., Blades, K., Kabbara, J., Bui, A., Hendryx, J.
Journal of Osteopathic Medicine, 2026/05
Free full text



86

Efficacy of treatment for subacromial pain in older adults: a systematic review and meta-analysis with GRADE recommendations
de Castro Mariz, G., Xavier, D. M., Ferreira Barroso, M. M., de Carvalho Bastone, A., Arrieiro, A. N., de Oliveira, V. C., de Oliveira, M. X.
European Geriatric Medicine, 2026/05
Free full text

87

Crowdsourcing Medical School Admissions Data: Development and Analysis of the CycleTrack Platform
Amusin, D. B., Hua, I., Kozhumam, A. S.
Journal of Medical Internet Research, 2026/05
Free full text

88

Why don't more physicians use osteopathic manipulative medicine? A cross-sectional study of utilization and referral barriers
Stacey, S. K., Furlano, A., Genewick, J., Westfall, E., Gordon, B., Toor, J.
Journal of Osteopathic Medicine, 2026/04
Free full text

89

A proven template for providing streamlined, scalable, cost-effective clinical research opportunities in osteopathic medical schools
Greek, J. N., Greek, A. P., Hopper, M., Arnce, R.
Journal of Osteopathic Medicine, 2026/04
Free full text

90

Evaluating the acute effect of osteopathic manipulative treatment on sprint performance in young adults
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., McKinlay, K. J., Roush, A. J., Cosgrave, C.
Journal of Osteopathic Medicine, 2026/04
Free full text

91

Dermatology match disparities: analyzing osteopathic vs. allopathic student outcomes post-ACGME/AOA single accreditation system (2020-2024)
Wan, L., Bawa, K., Park, A., Kadri, H., Cusick, A., Trotter, S. C.
Journal of Osteopathic Medicine, 2026/04
Free full text

92

Teaching the next generation of physicians: Evaluating addiction medicine curriculum interventions across two U.S. Medical schools
Walsh, M., Greenberg, I. S., Reilly, J. M., Poland, C.
Journal of Addictive Diseases, 2026/04
Free full text

93

Osteopathic manipulative medicine lymphatic drainage techniques for venous insufficiency and peripheral arterial disease: a review
Agha, I., Susla, L., Ryder, E., Udhwani, G. N., Yao, S. C.
Journal of Osteopathic Medicine, 2026/04
Free full text

94

Investigating the efficacy of osteopathic manipulative treatment for intractable hiccups: a pilot study
Bowman, D. E., Jamo, E. C., Bloch, R. R., Tepper, Z., Poland, E. M., Kempa, M., O&rsquo, Brien, C., Fong, K., Shahbain, A., Kamm, M. A., O&rsquo, Hara, J. R., Lee, A. S., Lippert, J.A.
Journal of Osteopathic Medicine, 2026/04
Free full text

95

21st century osteopathic medicine: a modern perspective
Dery, M.A.
Journal of Osteopathic Medicine, 2026/04
Free full text

96

Evaluating median nerve stiffness in patients with mild to moderate-severe idiopathic carpal tunnel syndrome receiving OMT and conservative therapy: a pilot study
Gazaille, R., Knox, C., Pershing, M., Pugar, K. D., Bamberger, H. B., Schoen, J., Hess, N., Nickolson, C., Vickery, T., Flowers, D., Marati, A., LaCombe, K., Mall, S.
Journal of Osteopathic Medicine, 2026/04
Free full text

97

Demographics of physicians in family medicine residencies during the transition to single GME accreditation
Ginoza, J. A., Weaver, J. M., Meyer, D. L., Maier, R. G.
Journal of Osteopathic Medicine, 2026/04
Free full text

98

A Nationwide Survey of the Spine Education of Medical Students
Henn, M. C., Rae, A., Fecker, A. L., McIntyre, M., Larsen, A., Wright, J.
Cureus, 2026/04
Free full text

99

Osteopathic manipulative treatment and cervicogenic headache: a randomized controlled trial
Klemm, S. T., Klemm, W., Semmler-Ludwig, R., Witt, M.
Journal of Osteopathic Medicine, 2026/04
Free full text

100

Potential Adjunctive Role of Osteopathic Manipulative Medicine in the Management of Cancer-Related Bone Pain: A Narrative Review
Ngo, A. L. T., Gharavi Alkhansari, N., Pham, C., Nguyen, H., Rubi, M., Tanner, D.
Cureus, 2026/04
Free full text


102

Manual therapy modalities and depression: a systematic review
Schulz, P., Huzij, T.
Journal of Osteopathic Medicine, 2026/04
Free full text


104

Osteopathic Manipulative Treatment for the Breastfeeding Dyad: A Scoping Review
Chen, A. I., Mercer, A., Conaway, E., Heskett, K. M., Tobey, A. H., Campbell, M., Panza, M., Wolf, K.
Journal of Human Lactation, 2026/04

105

Integrating Osteopathic Care Into Treatment of the Breastfeeding Dyad: Anatomic and Physiologic Considerations
Conaway, E., Tobey, A. H., Chen, A. I., Mercer, A., Wolf, K.
Journal of Human Lactation, 2026/04

106

Multidisciplinary Care Models for Managing Fibromyalgia
Reynolds, C., Nair, S., Agnello, R.
Osteopathic Family Physician, 2026/04

107

A mechanistic hypothesis: osteopathic manipulative therapy may modulate immune cell function in chronic low back pain
Tehrani, L., Gamer, J., Ballarin, S., Arango, S., Widboom, N., Barry, P., Sandhouse, M., Wallace-Ross, J., Qureshi, Y., Nathanson, L.
Frontiers in Pain Research, 2026/04
Free full text

108

Medical and Non-Surgical Strategies for Mild Traumatic Brain Injury
Kim, M. S.
Korean Journal of Neurotrauma, 2026/04
Free full text

109

An Osteopathic Perspective on the Mastitis Spectrum
Oshay, R. R., Loveless, B. J.
Osteopathic Family Physician, 2026/04

110

Pain: a century-old approach to treatment with objective documentation
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2026/04
Free full text

111

Correlational analysis of COMAT FBS and COMLEX-USA Level 1 scores
Liu, J., Barnum, S., Dukat, R., Liang, M.
Journal of Osteopathic Medicine, 2026/04
Free full text

112

The State of Osteopathic Physicians in Orthopaedic Training and Academic Practice
Cohn, R. M., Bitterman, A. D.
Journal of the American Academy of Orthopaedic Surgeons, 2026/04

113

Technology use and satisfaction among colleges/schools of osteopathic medical education
Linsenmeyer, M., Ridpath, L.
Journal of Osteopathic Medicine, 2026/03
Free full text

114

Why is identification with osteopathy decreasing in medical students?
Kauffman, Z. S., Harper, T., Augustyniak, R. A., Ruff, C.
Journal of Osteopathic Medicine, 2026/03
Free full text


116

Umsetzung osteopathischer Prinzipien in der Ausbildung
Weyland, K.
DO - Deutsche Zeitschrift für Osteopathie, 2026/03





121

Journal Club 2026 – 1
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2026/03







128


129

Physiological changes of cortisol and oxytocin following manual therapy: a scoping review
Cao, A. T., Alanazi, M. S., Billings, R., Reed, W. R.
Frontiers in Rehabilitation Sciences, 2026/03
Free full text


131

Osteopathic Manipulation to Increase Lactation Quantity: The OMILQ Study Protocol
Conaway, E. M., O'Donnell, A. E.
The AAO Journal, 2026/03

132

Dual-degree programs in undergraduate medical education: a scoping review
Landau, R., Caplan, C., Hale, E., Harris, J., Albuquerque, E., Agarwal, G. G., Taldone, S.
Academic Medicine, 2026/03

133

An Osteopathic Approach to Hereditary Angioedema Attacks with Predominant Gastrointestinal Features and Concomitant Back Pain: A Case Report
Rowane, M. J., Petro, J., Shilian, R., Rajan, J., Rowane, M. P, Hostoffer, R. W.
The AAO Journal, 2026/03


135

Osteopathic manipulative treatment for mental health: Methodological considerations and the potential integration of reality therapy principles
Sona, D., Habsy, B. A., Purwoko, B., Pratiwi, T. I., Nursalim, M., Irawan, A. W.
Explore (NY), 2026/03

136

Effects of osteopathic manipulative treatment on cardiovascular function: a systematic review and meta-analysis
Johnston, K., Chow, R., Rubinstein, M., Burtner, M., Hollander, S., Humm, A., Chen, L., DeArmond, M., Koshy-Chenthittayil, S., Hightower, C.
International Journal of Osteopathic Medicine, 2026/03

137

Assessing the use of cardiac ultrasound as an adjunct to physiology education at the medical school level
Sudler, S. R., Vroegop, S. A., McDonald, H. M., Weiss, E., Dennard, D., Irwin, C., Finch, C., Al-Nakkash, L.
Advances in Physiology Education, 2026/03
Free full text

138

Immediate Effects of Osteopathic Manipulative Therapy on Thoracoabdominal Mobility, Respiratory Muscle Strength and Pulmonary Function in Healthy Men: Preliminary Crossover Trial
Zago, J., Rondinel, T., Urueña, B., Amatuzzi, F., Queiroz, R., Nascimento, L., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2026/03

139

Integrative medicine for pain among adolescent and young adult patients with cancer: a scoping review
Wu, H. V., Lam, C. S., Chimonas, S., Tap, W. D., Bender, J. G., Mao, J. J.
Journal of Cancer Survivorship, 2026/03

140

Effect of osteopathic vs sham treatment and test-retest improvements on smooth pursuit eye movements
Wogue, R., Paire, A., Cornille, C., Pillevesse, I., Demoury, L., Gharmaoui, M., Paeye, C.
Complementary Therapies in Medicine, 2026/03

141

Interprofessional Education at Colleges of Osteopathic Medicine Improve Confidence in Interprofessional Teamwork and Patient Handoffs
Driesenga, S. J., Burrington, R. G., Jain, A., Selinsky, S., Waseem, R. A., Divito, C. B.
Cureus, 2026/03
Free full text

142

Role of Osteopathic Manipulative Treatment in Perioperative Pain Management: A Systematic Review With Exploratory Meta-Analysis
Ghotra, K., Iyer, A., Uberti, J., Armstrong, N., Lai, S., Whittaker, A., Scherer, T., Iyer, K.
Cureus, 2026/03
Free full text

143

Gender and Osteopathic Representation in U.S. General Surgery Residency, 2024-2025: Divergent Patterns Across Postgraduate Training
Mehdiyar, D., Baule, S. M., Nguyen, J., Panlilio, M. A., Flume, H., Hanna, A., Cordero, A., Shepherd, J. K., Sees, J. P.
Cureus, 2026/03
Free full text

144

Incorporation of virtual reality into medical physiology
Benmerzouga, I., Oviawe, E.
Advances in Physiology Education, 2026/03
Free full text

145

Perspectives of Anatomy Education Among Osteopathic Medical Students: A Cross-Sectional Survey
Heins, R. J., Mindrup, M., Hemaya, J., Sloan, S. S.
Cureus, 2026/03
Free full text

146

Improvement of Chronic Lateral Knee Pain Through Osteopathic Manipulative Treatment Targeting Anterior Fibular Head Somatic Dysfunction: A Case Report
Libman, A. E., Volokitin, M., Speiser, J., Rocchio, L., Benyaminov, T., Tai, N., Naseer, S.
Cureus, 2026/03
Free full text

147



149

Osteopathic Manipulative Treatment (OMT) After Vestibular Schwannoma Resection: Methods and Framework From a Recent Retrospective Study
Chen, A. I., Mercer, A., Loader, T., Friedman, R. A., Schwartz, M. S.
Journal of Neurological Surgery, Part B: Skull Base, 2026/03

150

Regarding “Where are the Black men in osteopathic medical schools?”
Bohler, F., Garden, A. R.
Journal of Osteopathic Medicine, 2026/03
Free full text

151

Addressing physician shortage in medically underserved rural and tribal communities through residency program collaboration
Bray, N. N., Raischel, M., McGuire, D., Newhardt, R., Nolan, D., Snyder, T., Som, M., VanVolkinburg, L., Landgraf, C., Wheeler, D.
Journal of Osteopathic Medicine, 2026/03
Free full text

152

Conceptualizing osteopathic medical professionalism: an institutional self-assessment rubric for colleges of osteopathic medicine
Fleming, R. K., Jones, A. C., Shelnutt, M., Slieman, T. A., White, S., Williams, B. R.
Journal of Osteopathic Medicine, 2026/03
Free full text

153

Response to: Regarding “Where are the Black men in osteopathic medical schools?”
Megafu, M.
Journal of Osteopathic Medicine, 2026/03
Free full text

154

Medical Student Perspectives on Abortion Education in US Osteopathic Medical School Curricula
Steffes, R., Thakur, P., Cox, S., Adams, C., Creamer, B. A., Dennis, J. F.
Perspectives on Sex and Reproductive Health, 2026/03

155

Resolution of Chemotherapy-Induced Intractable Hiccups Following Osteopathic Manipulative Treatment: A Case Report
Aluri, P. S. C., Ansari, A. Z., Jorden, J. L., Ahmed, F., Hafeez, S.
Cureus, 2026/02
Free full text

156

Different letters, same results: a comparison of milestones among US allopathic and osteopathic residents
Langhan, M. L., Ngo, T. L., Yamazaki, K., Nesiama, J.A. O., Pence, L., Hogan, S. O.
Journal of Osteopathic Medicine, 2026/02
Free full text

157

The effectiveness of osteopathic treatment in cervical whiplash: a randomized controlled trial
Larios-Ortega, J., Díaz-Acuña, A. M., Colón-Fraile, M. T., Rivera-Sequeiros, A., Albornoz-Cabello, M., Ruiz-Romero, M. V.
Journal of Osteopathic Medicine, 2026/02
Free full text

158

Evaluating Laparoscopic Simulation Training for Preclinical Osteopathic Medical Students
Muchard, R. D., Jacobsen, N. D., Sypula, T., Longley, S., Hurrinus, N., Barefield, N. S., Patel, P. G.
Cureus, 2026/02
Free full text

159

Impact of the Council of State Neurosurgical Societies (CSNS) Fellowship on the Development of Neurosurgical Careers: A Retrospective Study
Rawson, C., Tenhoeve, S., Oladipo, O., Carter, A., Bauer, S., Lucke-Wold, B., Benzil, D., Adogwa, O., Sharma, A., Karsy, M.
Cureus, 2026/02
Free full text


161

Challenging hierarchies and fostering collaboration: a critical discourse analysis of interprofessional education in healthcare training
Zorda, E. M., Sargent, M. A., Gose, C. E., Becker, M. T., Garber, S. S., DePrimo, A., Batteson, T.
Journal of Osteopathic Medicine, 2026/02
Free full text


163

Chronic Pelvic Pain in Females. A Multisystem Perspective for the Osteopathic Physician
Chacko, N., Abu-Sbaih, R., Ventimiglia, M., Yao, S. C.
Osteopathic Family Physician, 2026/02

164

Osteopathic Manipulative Treatment in 564 Children with Congenital Heart Disease: A Project Report
Petracca, M., Turinetto, M., Sciomachen, P., Baroni, F., Lunghi, C., Accorsi, A., Longobardi, M., Pandey, R., Pozzi, M.
Children, 2026/02
Free full text

165

Students' Research Experiences at DO-Granting and MD-Granting US Medical Schools
Shapiro, D., Franz, B., Long-Mills, E., Linares, J. I., Eldridge, D. L., Tumin, D.
Medical Science Educator, 2026/02

166

Musculoskeletal Treatments: Physical Modalities
Kobayashi, L., Carter, K. M.
FP Essentials, 2026/02

167

The impact of a summer research internship program on research engagement of osteopathic medical students
Bishayee, A., Wallace, M. A., Bobak, A. K., Sasher, T. L., Alvarez, L. A., Flink, T. S.
Journal of Osteopathic Medicine, 2026/02
Free full text

168

The effectiveness of training student physicians in culturally sensitive patient care using an interprofessional culturally competent curriculum
Aminpour, A., Gelvin, M., Smurzynski, A., Gardner, F., Gardere, J.
Journal of Osteopathic Medicine, 2026/02
Free full text

169

Identifying risk factors for burnout and self-harm thoughts among medical students: a multi-institutional survey study
Eddy, A. J., Bray, N. N., Place, A. J.
Journal of Osteopathic Medicine, 2026/02
Free full text

170

Osteopathic manipulative treatment vs. standard therapy in the management of acute neck and low back pain in the emergency department
Hochman, S. M., Vlasica, K., LaPietra, A., Patel, B. K., Ju, C., Mota, N. J., Wilder, S.
Journal of Osteopathic Medicine, 2026/02
Free full text

171

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2026/01


173

Chronic pain outcomes among patients treated by osteopathic vs. allopathic physicians: a 36-month follow-up study
Licciardone, J. C., Lewis, H., Dahl, K., Adams, B., Aryal, S.
Journal of Osteopathic Medicine, 2026/01
Free full text

174

Effects of the allopathic and osteopathic graduate medical education merger on U.S. specialty training: a review
Ibrahim, S., Abdelhady, M., Venckus, J., North, C., Bohler, F.
Medical Education Online, 2026/01
Free full text

175

Osteopathic Manipulative Treatment for Chronic Obstructive Pulmonary Disease: A Systematic Review
Ponce, A., Paek, K. H., Heintzelman, K.
Cureus, 2026/01
Free full text


177

Race, ethnicity, and gender discrepancies between allopathic and osteopathic otolaryngology trainees from 2015 to 2023
Minutello, K. M., Nicks, S. L., Gillette, B. T., Hasan, S., Shermetaro, C. B.
Journal of Osteopathic Medicine, 2026/01
Free full text

178

Early osteopathic treatment delivered to patients with an acute lateral ankle sprain improves recovery: an investigative study
Bournon, C., Prin-Conti, D., Douay, J., Montfajon, P.A., Kanagaratnam, L., Gennai, S.
Journal of Osteopathic Medicine, 2026/01
Free full text

179

Osteopathic manipulative medicine among injured emergency department patients: a nationwide study
Harris, H., DiStefano, A., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2026/01
Free full text

180

Effect of COMLEX-USA Level 1 pass/fail score reporting on student stress, test preparation, and performance
Jin, R., Sandella, J. M., Gross, G. A., Dawley, M., Boulet, J., Mao, X., Wang, Y.
Journal of Osteopathic Medicine, 2026/01
Free full text

181

Touch-based treatments and infantile colic - Parental perceptions of treatment outcomes related to infants' crying and sleeping
Hannula, L., Rinne, S., Väänänen, T., Aarva, P., Suvilehto, J., Kemppainen, T.
Journal of Pediatric Nursing, 2026/01
Free full text

182

Allopathic resident prevalence in orthopedic residency programs formerly accredited by the American Osteopathic Association during single accreditation
Murray, J. B., Balazs, G. C., Speicher, M. R., Olsen, A. A.
Journal of Osteopathic Medicine, 2026/01
Free full text

183

Osteopathic manipulative treatment for enhanced pitch performance in collegiate baseball players: a feasibility study on shoulder and hip interventions
Rosten, C., Brown, S., Nandedkar, T., Pearson, A., Worthington, E., Fastring, D.
Journal of Osteopathic Medicine, 2026/01
Free full text

184

Development, implementation, and evaluation of interprofessional events on climate change in health professions curricula
Ly, K., Cariddi, A., Cote, M., Hall, K.
Frontiers in Medicine, 2026/01
Free full text

185

Graduate Degree Holders in the U.S. Residency Match: Trends and Outcomes (2016-2024)
Barron, D. W., Yu, H., Pendse, R. S., Barzee, B. M., Rappaport, D. E.
Journal of Medical Education and Curricular Development, 2026/01
Free full text



188

Osteopathic Manipulative Treatment for Pain With Medication and Opioid-Sparing Effects: A Narrative Review
Buroker, A. J., Savallo, M. A., Relyea, R., Eximond, M., Besong, D.
HCA Healthcare Summerville Hospital, 2026
Free full text




192

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/12
Free full text

193

Effect of osteopathic manipulative treatment on primary pelvic pain - A systematic review with meta-analysis
Parada, J. G., da Silva, E. B., Fernandes, A. P., Portugal, G. B.
International Journal of Osteopathic Medicine, 2025/12

194

Palpation and its learning: A professionalization approach to acquiring a complex skill
Rosenzweig, F., Feruglio, R., Marin, T.
International Journal of Osteopathic Medicine, 2025/12

195

Osteopathic manipulative treatment for management of feeding dysfunction in breastfed newborns
Fons, D., Watts, K. B., Vannitamby, H., Rainey, S., Ford-Davis, J., Wang, Y., Van Heukelom, S., Wright, A.
Journal of Osteopathic Medicine, 2025/12
Free full text

196

Analysis of hepatitis B immunity in vaccinated medical students
Gentile, N., Aghera, C., Smith, H., Mazzoleni, S., Redden, D., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2025/12
Free full text


198

A Cross-Sectional Study of Biopsychosocial Factors Associated with Utilization of Osteopathic Manipulative Treatment Among US Adults
Agostini, K., Manzaro, A., Helms, M., Bringhurst, M., Gish, E., Motyka, T.
Journal of Osteopathic Medicine, 2025/12

199

Is Research Fun? A Survey of Osteopathic Medical Students
Amendolara, A., Homan, M., Thorpe, L., Payne, A., Stacey, S. K., Small, C.
Journal of Osteopathic Medicine, 2025/12


201

Osteopathic Manipulative Treatment for Trauma as Adjunct for Pain and Mobility Limitations after Chest Wall Injury
Baltazar, G. A., Lopez, N., Beaulieu, D., Arrillaga, A., Ripley, D., Ippolito, M., Machado, F., Rubano, J.
Journal of Osteopathic Medicine, 2025/12

202

Utilizing Osteopathic Manipulative Technique to Alleviate Restriction at the Hip from the Tibio-Fibular Joint
Barros, M., Fotopoulos, T. J., Kochno, T., Bennett, A., Salehi, J., Tehrani, N.
Journal of Osteopathic Medicine, 2025/12


204

Analyzing Medical Student Knowledge Regarding Nutrition
Barros, M., Weir, S.B., Bennett, A.
Journal of Osteopathic Medicine, 2025/12







211

Enhancing Transitional Support for First-Year Medical Students: An Osteopathic, Student-Centered Perspective
Hartman, T., Pookkattu, M., Dearden, S., Venkataraman, V.
Journal of Osteopathic Medicine, 2025/12


213

Bridging Communication Gaps: Exploring Medical Students’ Understanding and Experiences in Caring for Patients with Hearing Impairments and Language Barriers
Kim, A., Nolin, J. R., Bracy, H., Berko, H., Mazzorana, A., Leiber, K., Hernandez, E.
Journal of Osteopathic Medicine, 2025/12

214


215

Evaluating Student Mental Health Resource Utilization and Self-Perceived Mental Health
Muppala, M. S., Sanapala, C., Shields, E., Kemp, E., Goldsteen, R., Tano, S., Grewal, P.
Journal of Osteopathic Medicine, 2025/12

216

Bridging the Gap: A Tri-campus Survey on Student Confidence in Applying OMT in Neurological Conditions
Nallanukala, G. S., Noto-Bell, L., Nallanukala, V.
Journal of Osteopathic Medicine, 2025/12


218

Pushing into the Barrier: Investigating the Use of OMM Among 3rd and 4th Year Medical Students
Pirzadeh, N., Dona, C. G., Valencia, R., Anche, G., Liang, W. M., Chen, D., Para, R., Volokitin, M.
Journal of Osteopathic Medicine, 2025/12


220

Zink’s Fascial Patterns Among First- and Second-Year Medical Students
Rutt, G., Graham, M., Boesler, D.
Journal of Osteopathic Medicine, 2025/12

221

Common Childhood Sleep Disorders and the Role of Osteopathic Manipulative Treatment
Elford, H., Ball, S., Reuter, M., Powers, B., Sahhar, H. S.
Osteopathic Family Physician, 2025/12

222

Hands-On Relief: A Pilot Study on the Use of Osteopathic Manipulative Treatment for Tension-Type Headaches
Santos, S. G., Lee, W., Doan, E., Rabiei, Y., Redding, D.
Journal of Osteopathic Medicine, 2025/12


224

D.O. Podcast Increases Pre-Medical Student Knowledge and Attitudes Toward Osteopathic Medicine
Sullivan, V. E., D'Amelio, M. P., Storch, I. M., van Rooyen, D. R., Storch, N. C., Callaway, C. A., Pierce-Talsma, S. L., Hauler, J. J.
Journal of Osteopathic Medicine, 2025/12

225

Osteopathic Manipulative Treatment of Chronic Pain and Emotional Trauma. A Case Report
Wajid, A., Volokitin, M.
Osteopathic Family Physician, 2025/12

226

Osteopathic Medical Education and Treatment: Changes in Perspective Through the Lens of Standardized Patients
Thompson, T. R., Craun, W. D., Strickland Creech, T., Parks, J. M., Nolin, J. R.
Journal of Osteopathic Medicine, 2025/12


228

Perceptions of Campus Climate and Inclusivity Among LGBTQIA+ Osteopathic Medical Students: A Cross-Sectional Study
Varin, P., Temucin, S., Reese, A., Florescu, N., Grace, C., Bettiker, R., Sonneville, K., Fiscus, V., Tanaka, L.A.
Journal of Osteopathic Medicine, 2025/12

229

Factors Affecting Medical Student Participation in Student Evaluations of Teaching: A Retrospective Study
Walker, R., Tucker, S., Smith, M. L.
Journal of Osteopathic Medicine, 2025/12

230

Safety and Feasibility of Osteopathic Manipulative Treatment (OMT) in Addressing Plagiocephaly
Wolf, K. J., Martone, J., Varrasso, E., Belsky, J. A.
Journal of Osteopathic Medicine, 2025/12

231

Fascial Counterstrain: A methodological advancement in indirect osteopathic manipulation
Tuckey, B.
International Journal of Osteopathic Medicine, 2025/12


233

Ultrasound shear wave elastography to assess neck somatic dysfunction and OMT effects
Gao, J., Lynch, E., Coleman, M., Moore, J., Park, D., Wilde, B.
Journal of Osteopathic Medicine, 2025/12
Free full text

234

Geographical distribution and match trends of osteopathic residents in otolaryngology residency programs: a cross-sectional analysis
Reardon, L., Stucki, B., Akella, D., Carr, M. M.
Journal of Osteopathic Medicine, 2025/12
Free full text



237

NextGenDO: A Pre-medical Outreach Program to Promote Early Exposure to Osteopathic Medicine
Quezada, K. A., Gjunkshi, L., Persaud, N. A., Hasty, R.
Cureus, 2025/12
Free full text


239

Effect of positional asymmetry palpatory models on improvement and retention of accuracy during pelvic asymmetry assessments
Hajicek, J. M., Huhn, M. B., Thurgood, A., Isemann, E. N., Barnwell, C. B., Starks, Z., Ying-Fang Wang, M., Degenhardt, B. F.
Journal of Osteopathic Medicine, 2025/12
Free full text

240

Breathing retraining and manual therapy for long COVID – A literature review
Courtney, R., Steele, Z., Collyer, I.
International Journal of Osteopathic Medicine, 2025/12
Free full text

241

The outcome of a short course of osteopathy for older adults with chronic musculoskeletal (MSK) pain. A single-arm, prospective feasibility study
Orchard, D., Bolt, D., Pinna, T., Antoni-Pineda, G.
International Journal of Osteopathic Medicine, 2025/12

242

A Retrospective Comparative Analysis of MD and DO Applicants' Acceptance to Plastic Surgery Residency
Yacoub, S. G., Guyler, M., Zak, A., Marlar, R., Obeid, R., Leavitt, W. III., Bernard, S., Isakov, R., Rampazzo, A., Gharb, B. B.
Annals of Plastic Surgery, 2025/12

243

Gut-Brain Axis in Inflammatory Bowel Disease: Pathogenesis and Therapeutics
Perry, S., Pillarisetti, L., Gelfman, T., Agrawal, D. K.
Archives of Internal Medicine Research, 2025/12
Free full text

244

Assessing the Efficacy of Osteopathic Manipulative Therapy (OMT) in Managing Chronic Back Pain: A Narrative Review
Tu Zahra, H., Farheen, A., Farooq Bacha, Z., Anas Patni, M.
Dubai Medical Journal, 2025/12

245

Prolotherapy in the Academy: A Mixed Methods Survey Study
Dubey, J., Jones, N. R., Evered, J. A., Grob, R., Andrie, J., Rabago, D.
Journal of Integrative and Complementary Medicine, 2025/12
Free full text


247

De-stress pain management: Assessing pain management care amongst primary care providers
Browder, B. H., Reynolds, C., Agnello, R.
Postgraduate Medicine, 2025/12

248

Association of neurovascular events with cervical manual therapy: A cohort study
Fraser, J. J., Lonnemann, E.
International Journal of Osteopathic Medicine, 2025/12

249

Osteopathic Acceptance in General Surgery Residency: A Five-Year Review of Resident Outcomes
Baule, S. M., Nguyen, J., Mehdiyar, D., Panlilio, M. A., Flume, H., Hanna, A., Cordero, A., Shepherd, J., Johnson, R., Sees, J. P.
Cureus, 2025/12
Free full text

250

Evaluating Research Preparedness and Skill Gaps Among Osteopathic Medical Students Pursuing Surgical Specialties
Beerman, S. A., Stucki, B., Wong, R., Alexander, V. S., Vogel, A., Heard, M. A., Wallen, T. J.
Cureus, 2025/12
Free full text

251

Osteopathic Manipulative Treatment Protocol for Postoperative Care Following Abdominal Surgery: A Quality Improvement Project
Genewick, J., Amendolara, A., Robinson, S., McDonough, M., Loera, M., Stacey, S. K.
Cureus, 2025/12
Free full text

252

Specific osteopathic diagnosis of unilateral knee pain in an elite sprinter: a case report
Mattatia, J., Leplat, A., Saiz, S.
International Journal of Osteopathic Medicine, 2025/12

253

Integrating Cranio-Cervical Neuromyofascial Continuity With Body-Wide Function in Kimmerle Anomaly: An Osteopathic Case Report
Pizzolorusso, G., Borraccia, V., Quaranta, C., D'Alessandro, G., Lunghi, C.
Cureus, 2025/12
Free full text

254

Osteopathic Manipulative Treatment Plus Phototherapy in the Management of Neonatal Hyperbilirubinemia: A Case Report
Zylinski, B. L., Stephenson, C. M., Rajala, J. W., Miller, D. J.
The AAO Journal, 2025/12
Free full text

255

Enhancing the Awareness of Osteopathic Learning Opportunities Through a Newsletter
Eilerman, A., Benton, A., Shneker, N., Abdo, M., Mar, D., Faherty, M., Reynolds, R.
The AAO Journal, 2025/12

256

Treatment of Temporomandibular Joint Pain and Dysfunction After a Motor Vehicle Accident Using an Osteopathic Approach: A Case Study
Schneider, N., Schneider, D., Sinnott, M., Kurian, A., Widboom, N., Qureshi, Y.
The AAO Journal, 2025/12





261

Geographical distribution of osteopathic urology residents and match trends in the United States
Wong, R., Eke, B., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/11
Free full text







268

Clerkship Rotations Are a Key Driver of Family Medicine Choice: Insights from the 2024 National Resident Survey
Barr, W., Peterson, L. E., Fleischer, S., Bazemore, A.
Journal of the American Board of Family Medicine, 2025/11
Free full text




272

Osteopathic manipulation to increase lactation quantity: a prospective case series
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2025/11
Free full text


274

Use of osteopathic manipulation techniques for management of acute otitis media in pediatric patients: a scoping review
Kim, C. H.S., McCray, L. R., Nguyen, S. A., Shermetaro, C., Robbins, W. K.
European Archives of Oto-Rhino-Laryngology, 2025/11
Free full text


276

Scholar 12 longitudinal outcomes: osteopathic research development application to facilitate scholarly activity during the pandemic and beyond
Rowane, M. J., Thomas, K. A., Smith, T. M., Terrel, M. A., Rowane, M. P., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2025/11
Free full text

277

Osteopathic Medicine Applicants in Urology: Evolving Pathways and Persistent Gaps After the Merger
Toumazos, K., Svendsen, C., Spencer, K. A., Cranford, W., McLouth, C., Buchanan, A. F.
Urology Practice, 2025/11



280

Assessing eating disorder education in U.S. medical schools: a qualitative content analysis of lecture slides
Laboe, A. A., Pictor, L. E., Gavuji, M., Temucin, S., Kreynin, A., Sheil, E., Jourdan, B., Schaumberg, K., Davis, H., Harrop, E. N.
Eating and Weight Disorders, 2025/11
Free full text

281

Assessing fundamental clinical skills of osteopathic medical students
Boulet, J. R., Sandella, J. M., Gimpel, J., LaBaere, R.
Journal of Osteopathic Medicine, 2025/10
Free full text

282

Swelling and skin changes: an osteopathic approach to pediatric lymphedema management
Jackson, S., Hussaini, A., Galan, J., Chung, T. C., Javed, B.
Journal of Osteopathic Medicine, 2025/10
Free full text

283

Effectiveness of osteopathic manual treatment in the elderly population: a scoping review of clinical evidence
Molinari, L., Mingrone, L., Novelli, E.
Journal of Osteopathic Medicine, 2025/10
Free full text

284

Diaphragm’s Role as a Systems-Connector Muscle: A Narrative Review
Bordoni, B., Morabito, B., Escher, A. R.
Cureus, 2025/10
Free full text

285

Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Bethea, J., Sharma, H., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
Cureus, 2025/10
Free full text

286

Exploring the use of manual therapy in the management of traumatic brain injury: a scoping review
Delion, T., Noyer, A., Gonzalès-Bandrès, M., Treffel, L., Farrell, G., Cassoudesalle, H., Ménard, M.
Chiropractic & Manual Therapies, 2025/10
Free full text

287

Affirmative Action Repeal and Racial and Ethnic Diversity in US Medical School Admissions
Florescu, N., Lin, A., Temucin, S., Rae, L.
JAMA Network Open, 2025/10
Free full text

288

From Simulation to Surgery: Gauging Surgical Interest in Osteopathic Medical Students Through Cadaveric Simulation: A Pilot Study
Paladichuk, S., Chase, T., Downs, A., Heck, C., Cortner, M., Cornwell, H., Shang, T., Brennan, Z., Walser, R. F., Kerber, K., Wallen, T.
Journal of Medical Education and Curricular Development, 2025/10
Free full text

289

Enhancing Embryology Education Through Virtual Reality: A Pilot Study
Quiñones-Rodríguez, J., Rice, R., Mayer, W., Marchelli, G., Bouchoukian, M., Davis, P.
Anatomical Record, 2025/10

290

Impact of touch interventions on brain activity in moderately preterm infants: study protocol for a pilot randomised controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., Tansini, L., Pisanu, D., Di Leo, D., Vergani, E., Righini, A., Arrigoni, F., Fanos, V., Rescigno, M., Veggiotti, P., Lista, G., Gazzolo, D.
BMJ Open, 2025/10
Free full text

291

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10

292

Incorporating the Certified Professional in Patient Safety credential into undergraduate medical curriculum: assessment and lessons learned
Gelinas, L., Hassan, A. K., Lieto, J., Yurvati, A. H.
Journal of Osteopathic Medicine, 2025/10
Free full text

293

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10

294

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10

295

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/10
Free full text


297

Preceptor-Ranked Competencies in Osteopathic Medical Students: A Comparison of General Surgery and Surgical Subspecialties
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Garg, R., Thacker, R. R., Roach, S. L.
Cureus, 2025/10
Free full text



300

Top 100 cited articles in osteopathic medical education: A bibliometric analysis
Bright, H. S. IV., Robinson, K., Fitterling, L., Kelley, S., Wang, M. Y.F., Lipke, L.
Medical Reference Services Quarterly, 2025/10

301

Osteopathic Approaches in the Diagnosis and Treatment of Temporomandibular Joint Dysfunction: An Interdisciplinary Review
Makichyan, T., Frolov, V., Habadze, Z., Starodubtseva, E., Dolzhikov, N., Avetisian, G., Rasulova, D.
Georgian Medical News, 2025/10
Free full text

302

Virtual Escape Rooms in Anatomy Education: Case Studies from Two Institutions
Beger, A. W., Hannan, S., Patel, R., Sweeney, E. M.
Advances in Physiology Education, 2025/09
Free full text


304

Corrigendum to: The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T.H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/09
Free full text

305

Why don't more physicians use osteopathic manipulative medicine? A cross-sectional study of utilization and referral barriers
Stacey, S. K., Furlano, A., Genewick, J., Westfall, E., Gordon, B., Toor, J.
Journal of Osteopathic Medicine, 2025/09
Free full text


307

Medical student perceptions of psychiatric conditions and the impact of stigmatizing language
Monahan, Z., Stevens, V., Hartwell, M., Ford, A. I.
Journal of Osteopathic Medicine, 2025/09
Free full text

308


309

A review of osteopathic and related manipulative treatments for improving symptoms of gastrointestinal distress in neurological disorders
Peters, J., Runnels, G., Lauinger, A., Murphy, T., Griffith, A., Slicho, T.
International Journal of Osteopathic Medicine, 2025/09

310

Effect of the Spencer Technique on Glenohumeral Joint Range of Motion: A Comparative Analysis of Athletes Versus Non-athletes
Oar, D. P., Zarilla, A., DiSilvestro, D., Buchman, Z. J., Abouafech, A., Boesler, D.
Cureus, 2025/09
Free full text


312

Retrospective Study of Osteopathic Manipulative Treatment on Length of Stay and Opioid Use After Vestibular Schwannoma Resection
Chen, A. I., Golshan, S., Schwartz, M. S., Friedman, R. A.
Otology & Neurotology Open, 2025/09

313

The epidemiology of osteopathic diagnoses and treatments in United States emergency departments from 2018 to 2021
Distefano, A., Harris, H., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2025/09
Free full text

314

Osteopathic intervention for inflammatory conditions of the lactating breast: a case series
Engel, R., Willy, K., Fuller, E.
International Journal of Osteopathic Medicine, 2025/09

315

Potential impact of an osteopathic intervention for internationally adopted children with fetal alcohol spectrum disorder (FASD); a prospective case series
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., Aldecoa-Bilbao, V., García-Algar, Ó.
International Journal of Osteopathic Medicine, 2025/09
Free full text

316

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/09

317

Abstracts From the Third Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 13, 2025
Akenami, F. O., Ismail, R., Obando Solano, C. P., Amalfitano, A.
Spartan Medical Research Journal, 2025/09
Free full text



320

A Pediatrician’s Newest Tool: Osteopathic Manipulative Treatment in the Inpatient Setting
Khanafer, R., Holub-Ward, R., Wong, M., Hart, C., Pitman-Hunt, C.
Spartan Medical Research Journal, 2025/09


322

The Use of OMT in the Emergency Department: A Scoping Review
Nemes, P.
Spartan Medical Research Journal, 2025/09


324

Osteopathic Manipulative Treatment in Cervical Dystonia Patients Treated with IncobotulinumtoxinA
Décarie, P., Chouinard, S., Venne, G.
International Journal of Osteopathic Medicine, 2025/09

325

Osteopathy Educators’ and Researchers’ Perspectives on Artificial Intelligence in Academia: A Cross-Sectional Study
Mhadhbi, H., Draper-Rodi, J., Consorti, G., Antunes Ferreira, A. P., Horta, L. M., Rinne, S., Vaucher, P., Ménard, M.
International Journal of Osteopathic Medicine, 2025/09

326

Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/09


328

Understanding the Ranking and Matching Behaviors During the 2023 and 2024 General Surgery Match Cycles: A Program Signaling Approach
Pakdaman, S., LaFemina, J., Byrd, K. S., Dunleavy, D. M., Balestrieri, S. G., Jurich, D. P., Dowden, A. J., Lamb, D. L.
Journal of Surgical Education, 2025/09

329

A novel simulation enhanced education for osteopathic manipulation of hospitalized patients
Eilerman, A. P., Libonate, G., Pothen, S., Rudie, M., Zardoost, S., Donaldson, B., Gable, B.
Journal of Osteopathic Medicine, 2025/09
Free full text

330

COVID-19 mRNA vaccine immune response to the addition of osteopathic manipulative treatment with lymphatic pumps: a randomized controlled trial
Martinez, E. S., Fuchs, S., Szurmant, H., Chen, X., Comer, A., Lee, E., Hruby, R., Giusti, R., Loveless, B., Sees, J. P., Crone, P., Peek, L. J., Pestano, G., Xie, B., Zammuto, J., Hostoffer Jr., R., Sanchez Jr., J.
Virus Research, 2025/09
Free full text










340

Tipping the scale: Enhancing Neurological Recovery in TBI through Osteopathic Principles
Khanna, N., Ettlinger, H., Shugar, J. D.
The AAO Journal, 2025/09


342

Osteopathic Manipulative Treatment (OMT) as an Adjunctive Treatment in Major Depressive Disorder (MDD)
Moreno, P., Mather, M., Kinney, L., Pichot, R., Torres, R.
The AAO Journal, 2025/09

343

Osteopathic Manipulative Treatment (OMT) Protocol on Sleep Quality in Medical Students as Measured by the Fitbit Smart Watch: A Pilot Study
Radigan, R., Finkelstein, A., Lee, B., George, E., Bhushan, P., Sousa, A., Yao, S. C.
The AAO Journal, 2025/09


345

OMT as an Adjunct Therapy to Clubbed Feet: A Case Study
Tucker, A., Dorsa, I., Patel, J., Seemann, J., Hicks, K., Leggoe, S.
The AAO Journal, 2025/09









354

The Need for Telehealth Education in the Medical School Curriculum
Carney, M., Thornton, M. E., Avancha, K., Nolin, J. R., Alexander, J.
Cureus, 2025/08
Free full text

355

Corrigendum to: Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/08
Free full text

356

The effect of osteopathic manipulative treatment on length of stay and pain relief in pediatric appendectomy: a pilot non-randomized time-controlled clinical trial
Lo Piccolo, R., Cantagalli, M. M., Ferroni, T., Fracchiolla, F., Morabito, A.
Frontiers in Pediatrics, 2025/08
Free full text

357

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text

358

Feasibility of Osteopathic Manipulative Treatment for Low Back Pain in Rural Chimaltenango, Guatemala: A Pilot Study
Aspra Rubi, M., Ngo, A. L. T., Cooper, G., Nichols, J.
Cureus, 2025/08
Free full text


360

Osteopathic diagnosis and treatment of the spine in patients with chronic back pain through the lens of medical infrared thermography: A randomized controlled pilot study
Bohlen, L., Biester, A., Rapp, O., Wentzel, J., Liem, T., Cerritelli, F., Schmidt, T.
Complementary Therapies in Clinical Practice, 2025/08


362

Rezul'taty primeneniya manual'noi terapii pri degenerativnykh zabolevaniyakh pozvonochnika s radikulopatiei i bez nee (Obzor literatury)
(Results of manual therapy in degenerative spine diseases with and without radiculopathy (Literature review))
Gameeva, E. V., Miryutova, N. F., Badalov, N. G., Novikov, Y. O., Stepanova, A. M., Tonkoshkurova, A. V.
Problems of Balneology, Physiotherapy and Exercise Therapy, 2025/08


364

Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/08
Free full text

365

Understanding COMLEX-USA Level-1 as a Pass/Fail examination: impact and opportunities
Gerhardson, A., Efurd, M., Sexton, P., Sefcik, D.
Journal of Osteopathic Medicine, 2025/08
Free full text

366

Effect of osteopathic manipulation on neck kinematics using X-Sens motion capture in non-specific neck pain: a protocol for randomised controlled trial
Hullumani, S., Qureshi, I., Raghumahanti, R.
BMJ Open Sport and Exercise Medicine, 2025/08
Free full text

367

Effectiveness of Different Teaching Modalities in Human Gross Anatomy Education
Mooney, A., Thompson, N. E., Hoffmann, S.
Clinical Anatomy, 2025/07

368

Investigating the trustworthiness of randomized controlled trials in osteopathic research: a systematic review with meta-analysis
Sénéquier, A., Draper-Rodi, J., Alvarez Bustins, G., Braithwaite, F. A., Brown, J., Corcoran, D., Forrest, L., Godsi, E., MacMillan, A., Menard, M., Roura Carvajal, S., Scocca, C., Treffel, L., Vaucher, P., Wagner, A., Soliman, N., Abbey, H., Hohenschurz-Schmidt, D.
Journal of Clinical Epidemiology, 2025/07
Free full text


370

Wurzel mit Riechfunktion
(Root with olfactory function)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07

371

Find it, find it, find it …
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07

372

A multimodal intervention of manual therapy, exercise, and psychological management for painful diabetic neuropathy: intervention development and feasibility trial protocol
Hohenschurz-Schmidt, D., Smith, S., Schmid, A. B., Bright, P., Draper-Rodi, J., Evans, M. C., Kemp, H., Esteves, N. K., Pigott, E., Scott, W., Vollert, J., Williamson, E., Pogatzki-Zahn, E. M., Vogel, S.
Pain Management, 2025/07
Free full text

373

Exploring the Characteristics and Competencies of Successful Osteopathic Medical Students on General Surgery Clerkship
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Thacker, R. R., Roach, S. L.
Cureus, 2025/07
Free full text

374

Patience in Practice: A Nonoperative Approach to Osteochondritis Dissecans
Rodas, A. W., Gupta, P., Pan, K., Rule, R., Goddard, M.
Cureus, 2025/07
Free full text

375

Changes in Electromagnetic Activity Following Osteopathic Manipulative Treatment: A Novel Assessment Using Induction Sensors
Savla, P., Brazdzionis, J., Marino, M., Siddiqi, I., Sweiss, R., King, C., Miulli, D. E.
Cureus, 2025/07
Free full text

376

A Pilot Study of Orthopedic Applicants Regarding Sub-internship Number, Cost, and Preferences
Schultz, M. J., Riebesell, S., Lutz, R. W., McCahon, J., Suarez, J. D., Purtill, J., Daniel, J.
Cureus, 2025/07
Free full text

377

Predicting First-Semester Performance of First-Year Medical Students in a Changing Landscape
Walker, M., George, A., Mohsin, S., Nichani, R., Garg, R., Chosie, K., Kennedy, C.
Cureus, 2025/07

378

Effects of a single osteopathic manipulative treatment on intraocular pressure reduction: a pilot study
King, H. H., Weinreb, R. N., Walker, E., Zangwill, L. M.
Journal of Osteopathic Medicine, 2025/07
Free full text

379

Enabling Exploration: Examining the Availability and Adequacy of Conference Funding for Medical Students
Allison, S. G., Soltani, H., Chwa, E. S., Shuaibi, D. W., Allison, K. R., Gosain, A. K.
Plastic and Reconstructive Surgery-Global Open, 2025/07
Free full text

380

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text

381

Effect of osteopathic manipulative treatment on comorbid depressive symptoms in patients with chronic low back pain: study protocol for a randomised controlled trial
Bohlen, L., Eggart, M., Müller-Oerlinghausen, B., Lorenz, J., Schleip, R., Liem, T., Cerritelli, F., Esteves, J. E., Shedden-Mora, M., Schmidt, T.
BMJ Open, 2025/07
Free full text

382

Building Community With Community: Collaborative Reflections on the Rural and Urban Community Orienting Experience (RUCOE)
Casapulla, S., Kropf, K., Kalout, S., Lingerak, S.
Teaching and Learning in Medicine, 2025/07

383

A survey of sexual harassment and assault in osteopathic medical schools
Chiriboga, K., Zeller, M., LaPlante, M., Prasad, C.
BMC Medical Education, 2025/07
Free full text

384

A cross-sectional analysis of pathology exposure across COCA-accredited osteopathic medical schools: Gaps and opportunities in pathology undergraduate medical education
Preston, P., Herman, M., Berry, A., Robinson, M., Schukow, C. P., Kowalski, P.
Academic Pathology, 2025/07
Free full text

385

Pioneering the future: incorporating lifestyle medicine tools in osteopathic medical education
Bansal, S., Shubrook, J. H.
Journal of Osteopathic Medicine, 2025/07
Free full text

386

A Holistic Approach to Treatment of Rosacea During Pregnancy: A Systematic Review
Garelick, E., Hurley, M., Bell, L. N., Cubelli, S.
SKIN: Journal of Cutaneous Medicine, 2025/07
Free full text

387

Pilot study on the influence of osteopathic manual therapy on cortisol and testosterone concentrations in horses
Vokietytė-Vilėniškė, G., Babarskaitė, G., Poškienė, I., Anskienė, L., Žilaitis, V.
Acta Veterinaria Brno, 2025/07

388

Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial
Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., Arnal-Gómez, A.
International Journal of Osteopathic Medicine, 2025/06
Free full text

389

Effects of osteopathic treatments in a patient who underwent two cardiac surgeries - A case report
Aubin, A., Bekhazi, J., Fortin, A., Paradis, A., Morin, C.
International Journal of Osteopathic Medicine, 2025/06


391

An overview of systematic reviews on the efficacy and safety of osteopathic techniques
Zipp, C. R., Semlitsch, T., Tögel, G., Krenn, C., Loder, C., Jeitler, K., Siebenhofer, A.
Journal of Bodywork and Movement Therapies, 2025/06






397

Development of Standardized Osteopathic Manipulative Treatment Tracking Forms Recording Pain and Functional Outcomes to Facilitate Osteopathic Research
Joseph, C., Mintle, L. S., Hoegerl, C., Asher, D., Adams, K., Fugler, P., McKinney, J.
International Journal of Osteopathic Medicine, 2025/06

398

Osteopathic approach to injuries of the overhead thrower’s shoulder
De Luigi, A. J., Raum, G. M., King, B. W., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/06
Free full text

399

Shaft femoral fracture secondary to osteopathic manipulation: case report and medico-legal implication
Prevot, L. B., Bolcato, V., Fozzato, S., Tronconi, L. P., Basile, G.
International Journal of Osteopathic Medicine, 2025/06

400

Acute changes in functional connectivity associated with first osteopathic manual treatment in chronic low back pain spatially overlap with opioid receptor expression
Tomaiuolo, F., Cerritelli, F., Sestieri, C., Keys, J., Paolucci, T., Sensi, S. L., Ferretti, A., Delli Pizzi, S.
Brain Research Bulletin, 2025/06
Free full text


402





406

Functional Improvement without the Surgery Referral, A Case Presentation
Candelori, W. J., Gailius, G. C.
The AAO Journal, 2025/06

407

When the Framework Fails: The Cost of Overlooking the Basics in Chest Pain
Collingsworth, M., Schaefer, M., Emmons, A.
The AAO Journal, 2025/06


409

Optimization of Abdominal Surgery and Controlling Intractable Neuropathic Pain with Peri-operative OMT
Cruz, C., Ural, E., Gailius, G. C., Neuer, K.
The AAO Journal, 2025/06

410

Resolving Deep Gluteal Syndrome with OMT
Dirusso, E., Shugar, J.
The AAO Journal, 2025/06

411

Rhabdo Resuscitation and Recovery Using Osteopathic Manipulative Treatment
Fadenrecht, H., Thorsvik, N.
The AAO Journal, 2025/06


413

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma—Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text




417

OMT for acute on chronic pain in systemic scleroderma
White, M., Furlano, A.
The AAO Journal, 2025/06





422

The use of OMT in Myalgic Encephalomyelitis/Chronic Fatigue Syndrome
Brancale, D., Cooley, D.
The AAO Journal, 2025/06

423

Hand & Helmet: A Crown-to-Coccyx Approach for Positional Plagiocephaly
Enniss, A., Neuer, K., Whitaker, Z., Ural, E.
The AAO Journal, 2025/06

424

From Fatigue to Function: A Case Report of The Use of OMT in Chronic Fatigue Syndrome
Finkelstein, A., Petrillo, G., Keys, J.
The AAO Journal, 2025/06


426

Management of Chemotherapy Induced Strains in a Breast Cancer Survivor with OMT
Johnson, R., White, E., Yu, X., Aldridge, A. F., Bardowell, A.
The AAO Journal, 2025/06

427

Turning the Tie: The Impact of OMT on infant torticollis and tongue tie
Lee, D. W., Katyal, J., Faillace, R.
The AAO Journal, 2025/06


429

Clavicular Dysfunctions: An Osteopathic Approach to Neck, Shoulder, and Chest Pain
Machado Douaihi, S. J., Waters, H.
The AAO Journal, 2025/06

430

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06


432

A Viscerosomatic Discovery: Unveiling a Case of Gastroparesis Disguised as Shoulder Pain
McKenna, T., Pfeifer, K., Wallace-Ross, J.
The AAO Journal, 2025/06


434

Evaluating the Efficacy of AI Note-Taking Software in Documenting Osteopathic Manipulative Medicine Treatment Encounters
Milius, M., Jurges, T., Pentlarge, J., Gabriel, D., Yang, N., Yadalla, S., Siddiqui, S., Bills, K., Barnhurst, N.
The AAO Journal, 2025/06


436

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06

437

Evaluation of Osteopathic Manipulative Treatment Strategies in Adults with Chronic Neck Pain
Moljo, M., Sreenivasa, S., Neupane, R., Harris, Z., Potter, A.
The AAO Journal, 2025/06






443

Evaluating the Acute Effects of Osteopathic Manipulative Treatment on Sprint Times
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., Jo, K., Roush, J., Cosgrave, C.
The AAO Journal, 2025/06

444

The Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Sharma, H., Bethea, J., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
The AAO Journal, 2025/06

445

Short-Lever Assessment of Spinal Side-Bending
Sudweeks, K., McClendon, M., Khalil, F., Kania, A.
The AAO Journal, 2025/06

446

Gender Sensitivity in Osteopathy: The Challenge of Diagnosing Pubic Symphysis Somatic Dysfunctions
Velasquez, L., Walker-Elders, A., Feygin, H., Hahn, D., Lee, D., Volokitin, M.
The AAO Journal, 2025/06

447

Impact of Osteopathic Manipulative Treatment in Delivering Comprehensive Care in Populations with Disabilities
Villarosa, M., Bae, P., Yeam, J., Hoang, V., White, G., Blumer, J.
The AAO Journal, 2025/06

448

Management of Chronic Migraine in a 34-year-Old Obese Female
White, E., Johnson, R., Yu, X., Bardowell, A.
The AAO Journal, 2025/06

449

Osteopaths’ perspective and experiences of elite track and field athletes osteopathic treatments: A descriptive phenomenological study
Consorti, G., Fard, R., Odorisio, L., Cella, M.
Journal of Bodywork and Movement Therapies, 2025/06

450

Significant Improvement of Fibromyalgia Symptoms With Osteopathic Manipulative Treatment: A Case Report
Ansari, A. Z., Mokodanski, N. A., Ahmed, F., Fairooz, A., Hafeez, S.
Cureus, 2025/06
Free full text




454

The effect of osteopathic manipulative treatment on chronic rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kalkat, A., Hammes, C., Kohli, E., Callahan, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2025/06
Free full text


456

Osteoevidence: A User-Centric Database for Advancing Osteopathic Manipulative Medicine
Pollesel, A., Pollesel, G., Petrulaityte, A.
Medical Reference Services Quarterly, 2025/06


458

Osteopathic practitioner´s considerations on infertility treatment
Triay Salamanca, S.
Unpublished MSc thesis, 2025/06
Free full text









467

Efficacy and safety of musculoskeletal manipulations in elderly population with musculoskeletal disorders: a systematic review
Bagagiolo, D., Persiani, M., Cicchitti, L., Vismara, L., Bruini, I., Mauro, A., Buffone, F.
BMJ Open, 2025/06



470

Effectiveness of osteopathic treatment in women with primary dysmenorrhea: A randomised controlled trial
Plathner, M., Wolf, L.
Journal of Bodywork and Movement Therapies, 2025/06

471

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/06

472

Osteopathic Manipulative Treatment of the Ankle-Foot Complex in Individuals with Limited Dorsiflexion: Study Protocol for a Randomized Crossover Clinical Trial
Loures de Paula, A., Castro, R. Q., Souza, H. C., de Castro Moreira, B., Moreira Baião, I. C., Schmitz Correa, C. P., Felício, D. C., Fonseca, D. S.
International Journal of Osteopathic Medicine, 2025/06

473

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma-Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text

474

Trends in osteopathic medical education: a scoping review
Hoskins, K., Montgomery, M., Griffith, A., Pollard, H., Orr-Roderick, D., Schmick, D., Strausman, J., Wade, S., Robertson, M., DeArmond, M.
Journal of Osteopathic Medicine, 2025/06
Free full text

475

Efficiency of physical therapy and osteopathic techniques in the treatment of operated and recurrent lumbar disc herniation - a case report
Antohe, B.A., Rață, M., Rață, B., Rață, G.
Journal of Bodywork and Movement Therapies, 2025/06


477

Providing Palliative Care for Two: Managing Cancer-Related Pain During Pregnancy
Okonta, V., Kirkire, L., Schoen, M., Mesarwi, P., Skavinski, K.
Journal of Pain and Symptom Management, 2025/05




481

A Retrospective Multicenter Analysis of Osteopathic Manipulation in Academic and Community Settings
Stacey, S. K., Harmelink, B., Gordon, B., Toor, J., Furlano, A., Genewick, J., Westfall, E.
Cureus, 2025/05
Free full text

482

Breath of Relief: Osteopathic Manipulative Treatment of Chronic Postoperative Pain in a Bilateral Lung Transplant Patient
Duggal, V., Finkelstein, A., Radigan, R., Bhushan, P.
Cureus, 2025/05
Free full text


484

Author Correction: Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., Perpetuini, D., Keys, J., Merla, A., Cardone, D.
Scientific Reports, 2025/05
Free full text


486

Recent and future trends in osteopathic orthopedic surgery residency match rates following the transition to a single accreditation system
Turnow, M., Nemani, M. G., Gupta, N., Hartman, H., Manes, T., Williamson, T., Gianakos, A.
Journal of Osteopathic Medicine, 2025/05
Free full text

487

Exploring manual therapy in the management of irritable bowel syndrome in adults: A scoping review
Płóciennik-Korycka, N., Pani, S. M., Bruc, B., Contu, P., Wrzesińska, M.
Complementary Therapies in Medicine, 2025/05
Free full text

488

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2025/05
Free full text

489

Elbow injuries in overhead throwing athletes: clinical evaluation, treatment, and osteopathic considerations
King, B. W., Raum, G. M., De Luigi, A. J., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/05
Free full text

490

Osteopathic, logopedic and psychological assessment to improve outcome in patients undergoing cardiac surgery: A randomized clinical trial (TITANIC trial)
Volpato, E., Stilo, L., Tavanelli, M., Bordoni, B., Oreni, L., Toccafondi, A., Moraschi, A., Morici, N.
European Journal of Preventive Cardiology, 2025/05

491

International medical graduate orthopaedic residents show higher research productivity than United States graduate peers before and during residency
MacLeod, J. S., Jacome, F., Mansour, H., Lee, M. S., Akwuole, F., Cho, S., Lee, J., Lema, O., Chopra, A., Bakaes, Y., Painter, S., Baker, H., Mejia, A.
International Orthopaedics, 2025/05

492

Efforts in Undergraduate Medical Education to Improve Socioeconomic Status Diversity
Velasquez, D. E., Shrestha, A., Matias, W. R.
Academic Medicine, 2025/05
Free full text


494

Residency Program Characteristics Associated With Osteopathic Resident Representation
Nikolla, D. A., Sachdeva, V., Distefano, A., Bryan, A., Mudrakola, V., Milliron, M. L., Bowers, K. M.
Cureus, 2025/04
Free full text

495

“Transition to Clinical Years“ Podcast Series: A Pilot Project to Support Rising Third-Year Students
Price, K. W., Bhagtani, H., Abraham-Hardee, S., Yeager, D., Anandakrishnan, R.
Cureus, 2025/04
Free full text

496

Does Malpractice Risk Deter Medical Students From Pursuing Obstetrics and Gynecology?
Thai, A., Huynh, K., Pickering, T., Maron, A., Wang, L., Stohl, H.
Cureus, 2025/04
Free full text

497

Patient-Practitioner-Environment Synchronization: Four-Step Process for Integrating Interprofessional and Distinctive Competencies in Osteopathic Practice-A Scoping Review with Integrative Hypothesis
Lunghi, C., Baroni, F., D'Alessandro, G., Consorti, G., Tramontano, M., Stubbe, L., Conte, J., Liem, T., Zegarra-Parodi, R.
Healthcare, 2025/04
Free full text

498

An Expert Consensus of Acceptable Scholarly Activities in Emergency Medicine Residency Training Programs
Garg, N., Totten, V. Y., Greenberg, M. R., Wilkerson, G., Finnell, J. T., Lau, W. B., Miner, J. R., d'Etienne, J. P., Brenner, J. D., Kumar, P., Camargo, C. A.
The Journal of Emergency Medicine, 2025/04

499

A cross-sectional study of newly established medical schools in the United States: student body diversity remains an unmet challenge
Oyoun Alsoud, L., West, K., Sorrell, S., Andolsek, K. M., Al Hageh, C., Ibrahim, H.
Medical Education Online, 2025/04
Free full text




503

Modeling the importance of physician training in practice location for Ohio otolaryngologists
Borgemenke, S., Newsom, D., Scheatzle, P., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/04
Free full text

504

Effectiveness of a program director for osteopathic medical education to support osteopathic recognition at a training site with multiple programs
Eilerman, A., Porter, C., Faherty, M., Zmuda, E.
Journal of Osteopathic Medicine, 2025/04
Free full text

505

An Investigation of Second-Year Medical Students' Use of Outside Resources at Two Institutions
Berry, A., Campbell, A., Li, D., Bay, C., Ikonne, U.
Medical Science Educator, 2025/04
Free full text

506

Lecture Capture, Transcripts, and Captioning in US Colleges of Osteopathic Medicine: Descriptive Cross-Sectional Survey
Khong, P., Holmes, D., Masoudian, B., Lund, G. C., Garwood, S.
Medical Science Educator, 2025/04
Free full text

507

A comprehensive review of clinical experiences and extracurricular activities for US premedical students applying to osteopathic medical schools
Kadavakollu, S., Dang, T., Bains, J., Ham-Ying, J., Boyanovsky, B., Qureshi, M., Graneto, J., Richards, S.
Journal of Osteopathic Medicine, 2025/04
Free full text


509

The role of osteopathic manipulative treatment for dystonia: a literature review
Phrathep, D. D., Abdo, Z., Tadros, M., Lewandowski, E., Evans, J.
Journal of Osteopathic Medicine, 2025/04
Free full text


511

The Effectiveness of Osteopathic Correction in the Complex Rehabilitation of Patients with Temporomandibular Joint Dysfunction
Makichyan, T., Gusakova, E., Khabadze, Z., Sarkisian, A.
Georgian Medical News, 2025/04
Free full text

512


513

Clinical effectiveness of the osteopathic management of non-specific neck pain
Fleischmann, M.
Unpublished PhD thesis, 2025/04
Free full text

514

Eficacia de la osteopatía en la enfermedad del asma bronquial
(Effectiveness of osteopathy in bronchial asthma)
Peramo Ruíz, J. M.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text

515

Tradition-Dismissive vs. Tradition Reconceptualization Approaches in Musculoskeletal Care: The Example of Osteopathic Care
DAlessandro, G., Lunghi, C., Consorti, G., Zanon, S., Berti, F., Turinetto, M., Di Pietrantonio, L., Longobardi, M., Zegarra-Parodi, R., Baroni, F.
Applied Sciences, 2025/03
Free full text

516

A call for improving the internal validity and the reporting of manual therapy trials self-labelled as pragmatic: A methodological review
Roura, S., Alvarez, G., Hohenschurz-Schmidt, D., Solà, I., Núñez-Cortés, R., Bracchiglione, J., Fernández-Jané, C., Phalip, J., Gich, I., Sitjà-Rabert, M., Urrútia, G.
International Journal of Osteopathic Medicine, 2025/03
Free full text

517

Diagnosing and treating upper back pain: insights from New Zealand’s manipulative physiotherapists and osteopaths
Kovanur Sampath, K., Smith, T., Belcher, S., Farrell, G., Fryer, G., Vaughan, B., Moran, R.
Journal of Manual & Manipulative Therapy, 2025/03

518

The assessment of point-of-care ultrasound (POCUS) in residency: the benefits of a four-year longitudinally integrated curriculum
Le, D. Q., Scarpulla, M., Lam, H., Kern, J., Vroegop, S., Yaeger, J., Finch, C., Martini, W., Bolch, C. A., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2025/03
Free full text

519

Prevalence of pelvic examinations on anesthetized patients without informed consent
Cutting, R., Reddy, V., Polam, S., Neiman, N., Manna, D.
Journal of Osteopathic Medicine, 2025/03
Free full text


521

Osteopathic Consideration of Pelvic Girdle Pain in the Postpartum Patient: A Case Study
Lu, J., Jiao Jiang, Y., Li Williams, G. E., Volokitin, M.
Osteopathic Family Physician, 2025/03

522

Indigenous Epistemological Frameworks and Evidence-Informed Approaches to Consciousness and Body Representations in Osteopathic Care: A Call for Academic Engagement
Zegarra-Parodi, R., Loum, T., D&rsquo, Alessandro, G., Baroni, F., Zweedijk, R., Schillinger, S., Conte, J., Mehl-Madrona, L., Lunghi, C.
Healthcare, 2025/03

523

Impact of osteopathic manipulative medicine training during graduate medical education and its integration into clinical practice
Kramer, J. L., Trombetti, K., De Asis, K., Mai, V., Swing, E.
Journal of Osteopathic Medicine, 2025/03
Free full text

524

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/03

525

The impact of osteopathic recognition on multiple medical specialty residencies in a university-based setting
Nohomovich, B., Tito, E., Baker, J., Gomes, T.
Journal of osteopathic medicine, 2025/03
Free full text


527

The Seven Drivers of Change in Osteopathic Education
Engel, R.
International Journal of Osteopathic Medicine, 2025/03

528

Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., David, P., Jordan, K., Arcangelo, M., Daniela, C.
Scientific Reports, 2025/03
Free full text

529

Changes in Matches into Surgical Residencies and Fellowships Following the ACGME Merger
Soliman, S. S., Andrews, G., Emara, S., Watkins-Granville, N., Podwójniak, A., Hasan, I., Stuti, J., Brotman, A.
Journal of Surgical Education, 2025/03
Free full text



532

Increase in the Number of Medical Schools in the United States and Its Potential Adverse Ramifications for Urology Residency Applicants
Donato, U. M., Ebedes, D. M., Nelwan, D., Imam, A., Patel, T.
Cureus, 2025/03
Free full text



535

Addressing confounding factors in the match disparities between DO and MD seniors
Bohler, F.
Journal of Osteopathic Medicine, 2025/03
Free full text









544

Assigning Commercial Off-The-Shelf (COTS)-Based Board-Style Pharmacology Practice Questions to Medical Students
Ghayur, M. N., Ghayur, A.
The Journal of Pharmacology and Experimental Therapeutics, 2025/03

545

503 A Closer Look at Pathology Education in Osteopathic Medical Schools: Data from 2021 to 2024
Preston, P., Herman, M., Berry, A., Robinson, M., Kowalski, P.
Laboratory Investigation, 2025/03

546

Osteopathic Manual Therapy Versus Conventional Conservative Therapy in the Management of Temporomandibular Disorders
Rahman, S.
Journal of Modern Health and Rehabilitation Sciences, 2025/03
Free full text




550


551

Formation of myofаscial pain syndrome and its correction in patients with tension headache
Vesnin, A. V., Tovazhnianska, O. L.
Journal of V. N. Karazin Kharkiv National University. Series 'Medicine', 2025/02

552

Efficacy of pulsed electromagnetic field therapy on pain and physical function in patients with non-specific low back pain: a systematic review
Kull, P., Keilani, M., Remer, F., Crevenna, R.
Wiener Medizinische Wochenschrift, 2025/02
Free full text


554

Determining the effects of social media engagement on surgery residents within the American College of Osteopathic Surgeons
Alexander, V. S., Eke, B., Xu, A., Wong, R., Greek, A., Ernst, M., Roberts, H., Ariwodo, O., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/02
Free full text

555

Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Galeazzi, Y., Houel, N., Gouaux, L., Rohan, A., Le Heiget, H., Jung, C., Housset, B., Stubbe, L.
Pain Reports, 2025/02
Free full text


557


558

“The Dark Side of Musculoskeletal Care”: Why Do Ineffective Techniques Seem to Work? A Comprehensive Review of Complementary and Alternative Therapies
Mamud-Meroni, L., Tarcaya, G. E., Carrasco-Uribarren, A., Rossettini, G., Flores-Cortes, M., Ceballos-Laita, L.
Biomedicines, 2025/02
Free full text

559

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text


561

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text


563

Efficacy of non-surgical, non-pharmacological treatments for congenital muscular torticollis: a systematic review and meta-analysis
Antares, J. B., Jones, M. A., Chak, N. T. N., Chi, Y., Li, H., Li, M., Chan, E. Y. W., Chen, T. M. K., Lee, C. M. Y., Urquhart, D. M.
BMC Musculoskeletal Disorders, 2025/02
Free full text

564

Generative Artificial Intelligence in Medical Education—Policies and Training at US Osteopathic Medical Schools: Descriptive Cross-Sectional Survey
Ichikawa, T., Olsen, E., Vinod, A., Glenn, N., Hanna, K., Lund, G. C., Pierce-Talsma, S.
JMIR Medical Education, 2025/02
Free full text

565

Pursuing Osteopathic Recognition: A National Survey on US Program Director Perspectives
Dong, T., Shapiro, M., Soh, M., Merkebu, J., Cervero, R., McClain, R., Durning, S. J.
Journal of Graduate Medical Education, 2025/02
Free full text

566

Development and Implementation of the “Exercise is Medicine“ Elective at an Osteopathic Medical School
Mitchell, C., DeMartino, S., Ivers, L., Brown, A., Maccabee, E., Griffith, B., Pankey, C. L.
Medical Science Educator, 2025/02
Free full text


568

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text

569

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01


571

Heilungshindernisse
(Obstacles to healing)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01

572

Foot and ankle fellowship-trained osteopathic orthopaedic surgeons: a review, analysis, and understanding of current trends
Henry, J. P., Partan, M. J., Chen, K. M., Cohn, R. M., Bitterman, A. D.
Journal of Osteopathic Medicine, 2025/01
Free full text

573

An Unusual Presentation of Respiratory Dysfunction in Parkinson’s Disease: A Case Study
Rundquist, L. D., Lyons, S. E., Moljo, R. J., Blavo, C.
Cureus, 2025/01
Free full text

574

Osteopathic treatment of infants with infantile colic/excessive crying: a prospective, multicentric, randomized controlled trial and nested observational trial
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
BMC Pediatrics, 2025/01
Free full text

575

Early osteopathic manipulative treatment to prevent cranial positional deformities: A randomized controlled trial
Genelot, C., Macioce, V., Huguet, H., Harrewijn, I., Cambonie, G., Dessauge, D., Mura, T., Moulis, L., Captier, G.
Archives de Pédiatrie, 2025/01
Free full text

576

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text

577

Three-Dimensional Posture Analysis-Based Modifications After Manual Therapy: A Preliminary Study
Scoppa, F., Graffitti, A., Pirino, A., Piermaria, J., Tamburella, F., Tramontano, M.
Journal of Clinical Medicine, 2025/01
Free full text

578

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01

579

Osteopathic Manipulative Treatment: A Safe and Feasible Adjunct in Sickle Cell Disease Pain Management
Brown, A., Goubeaux, D., Jacob, S. A., Belsky, J. A.
Pediatric Blood & Cancer, 2025/01


581

Efficacy of an Abdominal Surgery Simulator in Didactic Medical Training: A Randomized Controlled Trial
Fincher, S. E., Koniuk, V. M., Benavidez, M. S., Benefield, M. C., Drew, D. L., Hasan, D. M., Minner, N., Prakash, T. C., Parks, M. J., Lindsey, T.
Cureus, 2025/01
Free full text


583

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01


585

Resident Perceptions of Migraine Management and Interventions to Improve Care
Malone, L. I., Kelley, K.
American Journal of Health-System Pharmacy, 2025/01


587

The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T. H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/01
Free full text

588

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text

589

The value of the osteopathic approach in supporting women suffering from endometriosis
Metzmacker, P., Bengoetxea, A., Mellier, J.
European Journal of Pain, 2025 Nov 01 2025–11–21
Free full text

590

Resolution of Chronic Coccydynia after Osteopathic Manipulative Treatment: A Case Report.
Valdés, D., Sherrington, M., Waters, L. M.
Osteopathic Family Physician, 2024/9


592

Osteopathic Manipulative Treatment During Post-operative Recovery: A Scoping Review
Randall, C. G., Paul, H. A., Lumley, H., Ortega, A., Rowley, J., Brown, B., Mohan, S., Smith, K., Messer, T., Swan, E., Mehra, R. S.
Cureus, 2024/2
Free full text


594

Osteopathic Treatment of a person with Arnold-Chiari Malformation and Syringomyelia: a case report
Cases-Solé, R., Varillas-Delgado, D., Trinidad-Cascudo, F., Pino-Tamayo, M. C., García-Algar, O.
International Journal of Osteopathic Medicine, 2024/12

595

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text

596

A call to include intersectionality on board examinations
Dozier, D. R., Rodríguez, J. E.
Journal of Osteopathic Medicine, 2024/12
Free full text

597

Neuropsychiatric considerations in treating anorexia nervosa patients with osteopathic manipulative medicine: a narrative review
Talebi-Talghian, T., Schulz, P., Huzij, T.
Journal of Osteopathic Medicine, 2024/12
Free full text

598

Characteristics of the practice of New Zealand osteopaths who manage patients with chronic pain
McIntyre, C., Draper-Rodi, J., Antunes Ferreira, A. P., Muddle, L., McLeod, G. A., Sampath, K. K., Sinderholm Sposato, N., Vaughan, B.
Pain Management, 2024/12

599

Treatment of migraine with aura with osteopathic manipulative treatment: a case report with renewed perspectives
Babek, N., Fiechter, C., Caretti, R., Phinney, T.
Journal of Osteopathic Medicine, 2024/12
Free full text

600

Autonomic Nervous System and Viscera-Related Responses to Manual Therapy: A Narrative Overview
Alanazi, M. S., Degenhardt, B., Franklin, G., Jacobson, E., Fritz, S., Kettner, N., Kremen, V., Lipke, L., Reed, W. R.
International Journal of Osteopathic Medicine, 2024/12
Free full text

601

Osteopathic Manual Treatment in Women with Endometriosis: A Scoping Review on Clinical Symptoms, Fertility and Quality of Life
De Strooper, M., De Nys, L., Theys, L., Vermeersch, A., Quaghebeur, J.
International Journal of Osteopathic Medicine, 2024/12
Free full text


603

Making the Cut: A Six-Year “Bone-afide“ Membership Trend From Student to Surgeon
Nemani, M. G., Barham, E., Sees, J. P.
Cureus, 2024/12
Free full text

604

Effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in individuals with chronic low back pain: A double-blind, randomised placebo-controlled trial
Armbrust, D., Arêas, G. P. T., Fonseca, C. L., Arêas, F. Z. S., Duarte, N. A. C., Santana, S. A. A., Dumont, A. J. L., Neto, H. P., Oliveira, C. S.
Clinical Rehabilitation, 2024/12

605

The Effects of Osteopathic Manipulative Treatment on Arrhythmias: A Double-blind Randomized Controlled Trial in Patients with Cardiac Implantable Electronic Devices
Nikakis, J., Malkov, D., Tale, E., Mangla, M., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
The Journal of Innovations in Cardiac Rhythm Management, 2024/12
Free full text


607

Evaluating perspectives, knowledge and behaviors of osteopathic medicine in a United States osteopathic medical school: A study in employee education and changes in understanding
Glaser, K., Roberts, J., Coleman, M. K., Payton, M., Wilke, S., Linton, M., Waller, J.
International Journal of Osteopathic Medicine, 2024/12

608

Applying an osteopathic intervention to improve mild to moderate mental health symptoms: a mixed-methods feasibility randomised trial
Hope-Bell, J., Draper-Rodi, J., Edwards, D. J.
Chiropractic & Manual Therapies, 2024/12
Free full text

609

Evaluating the Information Quality of YouTube Videos on Manual Medicine/Therapy
Is, E. E., Tarihci Cakmak, E., Damla Korkmaz, M.
International Journal of Osteopathic Medicine, 2024/12


611

Underrepresentation of Osteopathic Physicians in the Development of Medical Guidelines
Amendolara, A., Salazar, S., Nguyen, T., Fife, P., Harris, B., Rivera, M., Madrid, K., Gray, Y., Stacey, S.
Journal of Osteopathic Medicine, 2024/12

612

The Effects of Osteopathic Manipulative Treatment on Climbing Performance
Beyer, B. R., Sheppard, C., Bolig, J., Muvvala, M.
Journal of Osteopathic Medicine, 2024/12

613

Student perception of Case Based Learning at a medical school in New York before and during the COVID-19 pandemic
Bhurtyal, K. K., Kung-Lau, S., Pino, M. A.
Journal of Osteopathic Medicine, 2024/12

614

Institutional Funding of Medical Students for Research Conferences: Is There a Benefit for the NRMP?
Dennis, J. F., Khan, H., Papatheofanis, C., Agollari, K., Marino, R., Schumann, T., Woolhiser, E.
Journal of Osteopathic Medicine, 2024/12

615

Effectiveness of Prematriculation Programs for Student Success in Medical School
Frontz, A., Sheridan, L., Davidson, K., Gundler, C.
Journal of Osteopathic Medicine, 2024/12

616

Outreach Education led by Osteopathic Medical Students on Substance Use Prevention for Sustainable Health Literacy in Underserved Youth Communities
Garg, E., Gogineni, K., Mahimkar, S., Jambunathan, V., Jamal, L., Nazaroff, C., Restini, C.
Journal of Osteopathic Medicine, 2024/12



619

Perception of Osteopathic Medicine in a Rural Clinic in Peru
Hovetter, K., Henke, C., Lopes, K., Berger, M., Boswell, K., Kandil, F., Ridpath, L., Waddell, M., Schmidt, D.
Journal of Osteopathic Medicine, 2024/12

620

Building Disability Competency in Osteopathic Medical Students in Rural Ohio Pilot Study
Hughes, A., Barrett, J., Dillman, O.
Journal of Osteopathic Medicine, 2024/12


622

Trends and Outcomes in Residency Matches: Assessing the Post-Merger Landscape for DO and MD Graduates
Jerman, H., Yebernetsky, K. E., Wilson, S.M. T., Rosmarin, S., Divito, C. B.
Journal of Osteopathic Medicine, 2024/12

623

Improving Sleep with OMT: A Randomized Controlled Trial using Cervical Techniques to Improve Sleep for OMSI
Le, D., Fagen, D., Christensen, S., Jensen, C., Alacron, A., Slife, R., Thakur, C., Teo, R., Spradley, G., Jackson, S, Zamanian, P., Finley, D., Tran, N., Tran, A., Redeman, K., Marble, A., Keane, J., Mangiaracina, M.
Journal of Osteopathic Medicine, 2024/12

624

Exploring the Impact of Musculoskeletal Conducting Injuries in Choral Music Educators: An Osteopathic Survey Analysis
Li, S., Wehner, B., Sullivan, R., McNickle, C.
Journal of Osteopathic Medicine, 2024/12

625

Multifaceted Therapeutic Approaches for the Management of Dyspareunia: A Narrative Review
Rastogi, M., Deka, K., Krishnan, S., Narayan, A., Nayak, M. M., Kumar, K. V.
The Open Public Health Journal, 2024/12
Free full text



628


629

The Effect of Osteopathic Manipulative Treatment in Chronic Rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kallat, A., Callahan, M., Kohli, E., Hammes, C., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/12

630

Osteopathic Medical Student Experiences with Assessing Red-Reflex in Different Skin Tones
Shah, P., Curran, S.
Journal of Osteopathic Medicine, 2024/12

631

Evaluation of the Use of 3D Printed Spinal Models to Educate and Assess Osteopathic Medical Students
Valdés, D., Zarandy, J., Sherrington, M., Cohen, M., Matechak, J.
Journal of Osteopathic Medicine, 2024/12

632

Haltung bewahren. Körperhaltung und OMT
Liem, T.
Naturheilpraxis, 2024/12








640

The Effect of Osteopathic Manipulative Treatment on Acute Post COVID-19 Anosmia and Ageusia Symptoms: A Case Report
Mehra, M., Companion, N., Yao, S. C., Ventimiglia, M.
The AAO Journal, 2024/12


642

Third-year medical students' perceptions of confidence and readiness to perform EFAST after training
Rocic, P., Garrison, R., Stitle, K., Reynolds, A., Andrews-Dickert, R.
BMC Medical Education, 2024/12
Free full text



645

Concerns of osteopathic medical students during the COVID-19 pandemic
Hanna, O., Vinyard, C. J., Casapulla, S.
Journal of Osteopathic Medicine, 2024/11
Free full text

646

Unpacking ABSITE Performance: Evaluating International vs Domestic Medical Graduates and DO vs MD Trainees in a Joint Residency Program
Rahimpour, A., Baxter, J. D., Fox, D. W. N., Morrison, M., Denning, D. A., Ray, P. D., Barry, R.
Journal of the American College of Surgeons, 2024/11

647

Feasibility of a cinematic-virtual reality training program about opioid use disorder for osteopathic medical students: a single-arm pre–post study
Rehl, D., Mangapora, M., Love, M., Love, C., Shaw, K., McCarthy, J., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/11
Free full text

648

Osteopathie in der Rehabilitation von Patienten mit rezidivierenden muskuloskeletalen Verletzungen: eine experimentelle Studie
(Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study)
Sankova, M. V., Nikolenko, V. N., Vovkogon, A. D., Oganesyan, M. V., Trishina, A., Babarzai, L., Antonyan, S. Z., Babarzai, F., Pontes-Silva, A., Zharikov, Y. O.
Manuelle Medizin, 2024/11




652

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text

653

Pelvic joint stiffness and fear of falling in patients over 75 years of age: a prospective cohort study of 100 patients
Laizeau, C., Jochmans, S., Aufaure, S.
Journal of Osteopathic Medicine, 2024/11
Free full text

654

A Retrospective Comparison of Outcomes after Osteopathic Manipulative Treatments Compared to Trigger Point Injections for Patients with Low Back Pain
Santhosh, R., Smith, A., McCarrell, J., Goff, B.
PM&R: The Journal of Injury, Function and Rehabilitation, 2024/11

655

Efficacy of manual therapy for sacroiliac joint pain syndrome: a systematic review and meta-analysis of randomized controlled trials
Trager, R. J., Baumann, A. N., Rogers, H., Tidd, J., Orellana, K., Preston, G., Baldwin, K.
Journal of Manual & Manipulative Therapy, 2024/11

656

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text

657

A systematic review of manual therapy modalities and anxiety
West, K. L., Huzij, T.
Journal of Osteopathic Medicine, 2024/11
Free full text

658

Is Osteopathic Manipulative Treatment Clinically Superior to Sham or Placebo for Patients with Neck or Low-Back Pain? A Systematic Review with Meta-Analysis
Ceballos-Laita, L., Jiménez-Del-Barrio, S., Carrasco-Uribarren, A., Medrano-de-la-Fuente, R., Robles-Pérez, R., Ernst, E.
Diseases, 2024/11

659

Osteopathic Manipulative Therapy Effects on Prolonged Post-COVID Olfactory Dysfunction
Stenta, M. E.
PM&R: The Journal of Injury, Function and Rehabilitation, 2024/11
Free full text

660

Management of Medial Tibial Stress Syndrome with osteopathic manipulative treatment in a basketball player: Case Report
Colli, D., Tarantino, A. G., Bergna, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2024/10

661

Students with prior anatomy experience start out stronger in medical school gross anatomy
Louro, M. D., Meegan, G., Rudin, L. R., Granatosky, M. C., Thompson, N. E.
Anatomical Sciences Education, 2024/10

662

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10


664

Response to “Fostering a research culture in osteopathic medical education”
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2024/10
Free full text

665

Fostering a research culture in osteopathic medical education
Kadavakollu, S., Dang, T., Richards, S.
Journal of Osteopathic Medicine, 2024/10
Free full text

666

Assessing nutrition literacy and nutrition counseling proficiency following an interdisciplinary culinary medicine elective
Kirby, A. N., DeBellis, J., Wolter, K., Mount, G., Wang, C.H., Bishop, J., Barkhouse, J., Wirth, K., Nguyen, N., Cacciatore, C., Kraus, K.
Journal of Osteopathic Medicine, 2024/10
Free full text

667

Effect of manual manipulation on mechanical gait parameters
Yanuck, S. B., Fox, S. K., Harting, B. R., Motyka, T. M.
Journal of Osteopathic Medicine, 2024/10
Free full text

668

Improving learning experience through implementing standardized team-based learning process in undergraduate medical education
Andrews-Dickert, R., Nagaraj, R., Zhan, L., Knittig, L., Zhao, Y.
BMC Medical Education, 2024/10
Free full text


670

The Transformative Care Continuum: implementing an accelerated pathway that addresses the new roles of the family medicine physician
Chrisman-Khawam, L., Snyder, S., Tyler, C., Harley, D., Davidson, E., Anthes, L., Casapulla, S.
Medical Education Online, 2024/10
Free full text

671

Efficacy of osteopathic manipulative treatment (93.6, ICD-9) - systematic review
Dwornik, M., Puszczałowska-Lizis, E., Wójcik, M., Szajkowski, S., Graczykowski, M., Szymański, D., Marszałek, S.
Medical Studies/Studia Medyczne, 2024/10
Free full text

672

Geographical Distribution and Trends Analysis of Osteopathic General Surgery Residents
Ernst, M. D., Alexander, V. S., Wong, R., Berg, N., Roberts, H., Vogel, A. D., Burns, J. B., Conrad-Schnetz, K.
Cureus, 2024/10
Free full text


674

Effectiveness of Osteopathic Treatment in Adults with Short Hamstring Syndrome: A Systematic Review
Ogando-Berea, H., Leirós-Rodríguez, R., Hernandez-Lucas, P., Rodríguez-González, Ó
Journal of Clinical Medicine, 2024/10
Free full text

675

Novel Diagnosis and Treatment for Neurogenic Thoracic Outlet Syndrome
Tafler, L., Borkowski, S., Javaid, G., Gandolfo, D., Kleyn, D.
Cureus, 2024/10
Free full text

676

Elite Track and Field Athletes’ Perspective and Experiences of Osteopathic Treatments: A Descriptive Phenomenological Study
Cella, M., Consorti, G., Odorisio, L., Fard, R.
Journal of Bodywork and Movement Therapies, 2024/10

677

Effect of Standard Physical Exercises for Non-specific Low Back Pain Combined with Multimodal Osteopathy Treatment on Pain Intensity and Functional Capacity: A Study Protocol for a Randomized Controlled Trial
Ferreira, C. R., Hort, J. P., Bezerra, L. A., Neto, H. P., Biasotto-Gonzalez, D. A., Politti, F.
Journal of Advances in Medicine and Medical Research, 2024/10
Free full text

678

The Effect of an Anatomy Prep Course on OMS-1 Student's Performance During the Fall Semester
Prasad, D. M., Inman, A. M., Blanc, P. K., Gaunt, J. A., Guzik, H. M., Peterson, J. L.
Clinical Anatomy, 2024/10



681

Conservative, physical and surgical interventions for managing faecal incontinence and constipation in adults with central neurological diseases
Todd, C. L., Johnson, E. E., Stewart, F., Wallace, S. A., Bryant, A., Woodward, S., Norton, C.
Cochrane Database of Systematic Reviews, 2024/10

682

An Osteopathic Approach to Foot Drop: A Case Report of Posterior Fibular Head
Volokitin, M., Libman, A. E., Milani, S., Banihashem, M., Ayon, S.
Cureus, 2024/10
Free full text


684

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10

685

Primary and secondary prevention of musculoskeletal pain and disability in chiropractic, osteopathy, and physiotherapy: A scoping review
Draper-Rodi, J., Delion, T., MacMillan, A., Storey, A. I., Spadaccini, J., Jebi, W., Thomson, O. P., Hohenschurz-Schmidt, D.
International Journal of Osteopathic Medicine, 2024/09
Free full text





690

Perceived benefits and limitations of game-based simulation education by osteopathy students in early clinical training: A preliminary mixed methods study
Mhadhbi, H., Horta, L. M., Ims, J., Draper-Rodi, J., Mansfield, H., Shaw, R., Rinne, S., Cleland Silva, T., Metsälä, E., Ménard, M.
International Journal of Osteopathic Medicine, 2024/09


692

Osteopathy: A potential ally against anorexia?
Mattatia, J.
Advances in Integrative Medicine, 2024/09


694

Endometriose
(Endometriosis)
Engel-Schulmeyer, A., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

695

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09


697

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text

698

Integrating nutrition and culinary medicine into preclinical medical training
Johnston, E. A., Torres, M., Goldgraben, S., Burns, C. M.
BMC Medical Education, 2024/09
Free full text

699

Positional plagiocephaly: results of the osteopathic treatment of 424 infants. An observational retrospective cohort study
Panza, R., Piarulli, F., Rizzo, V., Schettini, F., Baldassarre, M. E., Di Lorenzo, A., Tafuri, S., Laforgia, N.
Italian Journal of Pediatrics, 2024/09
Free full text


701







707

Geographical Distribution of Osteopathic Neurosurgery Residents
Ariwodo, O., Greek, A., Wong, R., Alexander, V. S., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Cureus, 2024/09
Free full text


709


710

Response to “Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection“
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2024/09
Free full text

711

Available Treatments and Adjunctive Therapies for Polycystic Ovarian Syndrome (PCOS) Patients of Reproductive Age: A Scoping Review
Cochran, L., Nadolny, R., Garcia, K., Kluglein, K. A., Yagoda, A., Gandhi, P., Dressel, J., Prol, B., Peralta, R., Shipp, A., Costin, J. M.
Cureus, 2024/09
Free full text

712

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text


714

An osteopathic orientation to interprofessional education
Martinez, E. S., Redding, D.
Journal of Osteopathic Medicine, 2024/09
Free full text

715

Effects of Osteopathic Manipulative Treatment (OMT) on Lower Extremity Muscle Characteristics in Parkinson's disease (PD) Patients
Radigan, R., Finkelstein, A., Mehra, M., Bhushan, P., Lombardo, T., Yao, S.
Movement Disorders, 2024/09

716

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2024/09
Free full text


718

Efectividad de las manipulaciones vertebrales en pacientes con cefalea de tensión
(Effectiveness of spinal manipulations in patients with tension headaches)
Bohoyo Aramburu, C., Urien Abaunza, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text

719

Terapia manual y tratamiento osteopático en el Síndrome del Túnel Capiano
(Manual therapy and osteopathic treatment for Carpal Tunnel Syndrome)
Carleos Mayán, F., Otero Torres, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text

720

Efectividad del tratamiento osteopático en el síndrome de dolor pélvico crónico
(Effectiveness of osteopathic treatment in chronic pelvic pain syndrome)
del Pilar Jopia Escobar, M., Leal Blu, C. G., Negrete Fuentes, K. V.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text


722

Efectividad del tratamiento osteopático en el síndrome subacromial
(Effectiveness of osteopathic treatment in subacromial syndrome)
Izquierdo Aicart, L., Ruiz Rojo, N., Santiago Ramirez, J.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text

723

Professional skill priorities: Comparison views of osteopathy industry professionals and osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2024/09
Free full text


725

Trends in Utilization and Cost of Nonpharmacological Pain Therapies in the United States Under Medicare Part B, 2000-2022
Whedon, J., Zakhary, G.
Journal of Integrative and Complementary Medicine, 2024/09

726

Data-driven analysis of whole-brain intrinsic connectivity in patients with chronic low back pain undergoing osteopathic manipulative treatment
Tomaiuolo, F., Cerritelli, F., Delli Pizzi, S., Sestieri, C., Paolucci, T., Chiacchiaretta, P., Sensi, S. L., Ferretti, A.
NeuroImage: Clinical, 2024/08
Free full text

727

Changes in the Affective Empathy of Osteopathic Students: a Longitudinal Study
Newton, B. W., Vaskalis, Z. T.
Medical Science Educator, 2024/08

728

The WELLMESS Project (Move Well, Eat Well, Sleep Well, Stress Well)
Machireddy, D. R., Reid, C. G., Hollingsworth, J. C., Redden, D.
Cureus, 2024/08
Free full text

729

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text

730

On-site peer mentorship’s effect on personal and professional development, stress reduction, and ease of transition into the medical education system
Whitfield, S., Hazard, C., Haynes, B., Coffey, T., Lynch, L., Davis, S.
Journal of Osteopathic Medicine, 2024/08


732

A Natural Approach to Bell's Palsy: An Osteopathic Treatment Option
Schneider, N., Shih, S., Rundquist, L., Llanio, L., Kurian, A., Ring, A., Barry, P.
Cureus, 2024/08
Free full text

733

A Review on Osteopathic Manipulation in Patients With Headache
Sharath, H. V., Nadipena, P. T., Qureshi, M. I., Phansopkar, P.
Cureus, 2024/08
Free full text

734

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text

735

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08

736

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text

737

The effect of osteopathic manipulative treatment on quality of life in patients with cardiac implantable electronic devices
Nikakis, J., Tale, E., Malkov, D., Arora, U. S., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2024/08
Free full text

738

Students Matriculating into Integrated Plastic Surgery: Are all Medical Schools Equal?
Yau, A., Lentskevich, M. A., Reddy, N. K., Gutowski, K. S., Yau, I., Gosain, A. K.
The Journal of Craniofacial Surgery, 2024/08


740

Post-operative osteopathic manipulative treatment of Morel-Lavallee syndrome assessed using infrared thermal imaging: A case report
Maillot, C., Riquet, D., Stubbe, L., Bodnar, J.L., Houel, N.
Journal of Bodywork and Movement Therapies, 2024/07
Free full text

741

The short- and long-term effect of osteopathic manipulative treatment on pain, and psychosocial factors in adults with chronic low back pain
Nicodemus, C. L., Epstein, J., Huebner, M., DeCicco, B., Shaik, M.
Journal of Osteopathic Medicine, 2024/07
Free full text


743

The hindrance of matching into neurosurgery from doctors of osteopathic-medicine perspective
Kashif, M., Muthana, A., Al-Qudah, A. M., Hoz, S. S.
Surgical Neurology International, 2024/07
Free full text

744

Interest in Cardiothoracic Surgery Among the American College of Osteopathic Surgeons’ Medical Students
Vogel, A. D., Wynn, A. B., Richards, M. C., Sindoni, M., Brennan, Z., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2024/07

745

How completely are randomized controlled trials of non-pharmacological interventions following concussion reported? A systematic review
van Ierssel, J. J., Galea, O., Holte, K., Luszawski, C., Jenkins, E., O', Neil, J., Emery, C. A., Mannix, R., Schneider, K., Yeates, K. O., Zemek, R.
Journal of Sport and Health Science, 2024/07
Free full text

746

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text

747

Interoceptive bodily awareness in patients seeking pain relief with osteopathic manipulative treatment: an observational cohort pilot study
Emmet, D. K., Davis, G., Pierce-Talsma, S., Shubrook, J. H., Mehling, W.
Journal of Osteopathic Medicine, 2024/07
Free full text

748

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07


750


751

Leitlinien in der Osteopathie: Pro und Kontra
(Guidelines in osteopathy: Pros and cons)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07

752

The Effects of Osteopathic Manipulative Treatment on Brain Activity: A Scoping Review of MRI and EEG Studies
Bonanno, M., Papa, G. A., Ruffoni, P., Catalioto, E., De Luca, R., Maggio, M. G., Calabrò, R. S.
Healthcare, 2024/07
Free full text


754

Alternative Therapies for Ankyloglossia-Associated Breastfeeding Challenges: A Systematic Review
Chowdhury, R., Khoury, S., Leroux, J., Alsayegh, R., Lawlor, C. M., Graham, M. E.
Breastfeeding Medicine, 2024/07


756

Leitlinien in der Osteopathie: Pro und Kontra
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07


758

A 25-year-old woman with 7 years of intractable hiccups treated with OMT – A case report
Bowman, D. E., Pohlod, C.
International Journal of Osteopathic Medicine, 2024/06

759

A validity study of COMLEX-USA Level 3 with the new test design
Mao, X., Boulet, J. R., Sandella, J. M., Oliverio, M. F., Smith, L.
Journal of Osteopathic Medicine, 2024/06
Free full text

760

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text

761

Responsiveness to osteopathic manipulative treatments in people with non-specific low back pain: A secondary analysis of the LC-OSTEO trial
Rören, A., Yagappa, D. M., Zegarra-Parodi, R., Fabre, L., Krief, G., Daste, C., Lefèvre-Colau, M. M., Rannou, F., Nguyen, C.
Annals of Physical and Rehabilitation Medicine, 2024/06

762

Evidence of anchoring bias in novice (first year) osteopathic French students in the context of the primary respiratory mechanism: A randomized-experimental study
Driaï-Allègre, C., Coste, F., Olmière, C., Grinand, M., Le Nohaïc, A., Romanet, F., Gourjon, G.
International Journal of Osteopathic Medicine, 2024/06

763

Effects of osteopathic manipulative therapy on recurrent pelvic pain and dyspareunia in women after surgery for endometriosis: a retrospective study
Alboni, C., Melegari, S., Camacho Mattos, L., Farulla, A.
Minerva Obstetrics and Gynecology, 2024/06

764

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/06

765

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/06






771

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06


773

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/06
Free full text


775

Reported biological effects following Osteopathic Manipulative Treatment: A comprehensive mapping review
Dal Farra, F., Bergna, A., Lunghi, C., Bruini, I., Galli, M., Vismara, L., Tramontano, M.
Complementary Therapies in Medicine, 2024/06

776

Stabilometric and Baropodometric Evaluation after Osteopathic Scaphoid Tug Manipulation
Molina Payá, F. J., Montero Navarro, S., Del Rio Medina, S., Orts Ruiz, C., Mor-Era Balaguer, J., Salar An-Dreu, C., Sánchez Mas, J. M., Botella Rico, J. M.
International Journal of Sports Physical Therapy, 2024/06

777


778

From finger to breast: OMT helps latch
Barr, J., O'Donnell, A.
The AAO Journal, 2024/06

779

Osteopathic Manipulative Treatment, a Novel Adjunct in Sickle Cell Disease Care: Interim Safety and Feasibility Analysis
Brown, A., Eyassu, E., Hoffmann, L., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
The AAO Journal, 2024/06

780

The Role of Osteopathic Structural Findings in Meningitis
Cecil, E., Burke, D.
The AAO Journal, 2024/06

781

Efficacy of Osteopathic Manipulative Treatment in Post-Stroke Recovery Patients
Dalton, D., Walker, A., Vu, P., Medina, C.
The AAO Journal, 2024/06

782

OMT Improves Diaphragm Range of Motion on Ultrasound Imaging
DiSabato, X., Atkinson, E., Kozar, A. J., Robinson, L., Dixon, E.
The AAO Journal, 2024/06

783

OMT in Headache Management: Systematic Review and Meta-Analysis Protocol
Gibson, E., Will, M., Garcia, C. J., Johnson, R., Kirsch, J. R., Spencer, D. V., Wang, M. Y.F., Rehman, Y., Snider, K. T.
The AAO Journal, 2024/06




787

Somatic Dysfunction and Behavior Correlates in Medical Students
LaFontano, C. M., Huzij, T., Garlock, M., Speth, M., Ko, K., Crouch, N., McDaniel, R., McEchron, M.
The AAO Journal, 2024/06

788

Short leg syndrome in clinical practice
(Синдром короткой ноги в клинической практике)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06






794

Seize the Dura: An Osteopathic Approach to Postictal Delirium
Vijayakar, R., Obialo, S., Nixon, K.
The AAO Journal, 2024/06




798

Counterstrain Point Frequency and Treatment in Osteopathic Medical Students
Arnold, C., Quackenbush, D., Fahim, A., Quackenbush, G., Navarro, A., Edwards, C.
The AAO Journal, 2024/06

799

Workin’ 9 to 5, but Now Can Thrive: Chronic Headache Diagnosed and Treated with OMT
Bernett, A. M., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06


801

Osteopathic Management of Bertolotti Syndrome
Bowen, A., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06

802

Resolution of Notalgia Paresthetica Symptoms following Osteopathic Manipulative Treatment (OMT): A Case Report
Bressler, K., Macmillan, G., Mancini, J., Yao, S. C., Papadopoulos, D., Abu-Sbaih, R.
The AAO Journal, 2024/06





807

Osteopathic Management of Chronic Pain Following Bilateral Periacetabular Osteotomy in Developmental Hip Dysplasia
Edgar, T., Heller, G. R., Hutson, M., Melin, D., Bardowell, A.
The AAO Journal, 2024/06




811

Stagnating the Symptomatic Progression of Primary Lateral Sclerosis
Geyer-Roberts, E., Desai, B., Perez, J., Grote, J., Helderlein, P., Posey, A.
The AAO Journal, 2024/06

812

Exploring the Evolution of the Mind-Body Connection as First-Year Osteopathic Medical Students Learn about Common Osteopathic Dysfunctions
Krauss, A., Normil, N., Mosley, B., George, S., Volokitin, M., Milani, S., Henshaw, M.
The AAO Journal, 2024/06




816

Transforming Fibromyalgia Care: An Osteopathic Route to Improving Quality of Life
Kurian, A., Schneider, N., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06


818

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06

819

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06


821

Effects of OMT on Blood Glucose and Insulin Sensitivity in Adult Male Rats
Petrillo, G., Staudt, M., Lobo, S., Cai, W., Keys, J.
The AAO Journal, 2024/06

822

OMT in the 21st century: current use of technologies in manual therapy education and opportunities for innovation
Pietrantoni, D., Krzykwa, E., Broussard, D., Fredrickson, T., Waters, H., Mehra, R.
The AAO Journal, 2024/06


824

Osteopathic Manipulative Treatment in Occipital Neuralgia
Ring, A., Llanio, L., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06

825

An Osteopathic Approach to Cervicogenic Vertigo
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2024/06

826


827

An Osteopathic Approach to Temporomandibular Dysfunction Secondary to A Motor Vehicle Accident
Schneider, N., Kurian, A., Widboom, N., Qureshi, Y.
The AAO Journal, 2024/06

828

An Osteopathic Approach to Eyelid Myokymia
Shih, S., Rundquist, L., Qureshi, Y.
The AAO Journal, 2024/06

829

Learning Mindsets and Well-Being and Ill-Being Among Osteopathic Medical Students
Tibbetts, Y., Himmelberger, Z. M., Barron, K. E., Speicher, M. R., Hulleman, C. S.
JAMA Network Open, 2024/06
Free full text

830

Effect of Osteopathic Manipulative Treatment (OMT) for Symptomatic Headache Relief in Long-COVID Patient: A Case Report
Unser, K., Thomas, A., Cornwell, S., Yao, S. C., Keys, J.
The AAO Journal, 2024/06

831

Osteopathic Manipulative Medicine and Disorders: An Overview of Peer-Reviewed Publications 2018-2022
White, C., Xie, Y., Bigham, J., Stanczak, A., Ninan, D., Hu, C. A.
Cureus, 2024/06
Free full text

832

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06


834

Case Study: The Effect of Osteopathic Manipulation on Diabetic Gastroparesis
Yazdi, S. A., Tucker, D., Hwang, G., Majeed, A., Hsubrook, J. H., Penq, N.
The AAO Journal, 2024/06


836

Increased Alertness in Comatose Patient After Osteopathic Manipulative Treatment: A Case Report
Garcia, A. E., Kay, K., Perera, M. X., Martinez, E. S., Onyi, S., Nourani, B., Loveless, B.
The AAO Journal, 2024/06


838

An Alternative Approach to Median Arcuate Ligament Syndrome
Geyer-Roberts, E., Wallace-Ross, J.
The AAO Journal, 2024/06

839

The osteopathic concept after a century
Mackenzie, A. S.
The AAO Journal, 2024/06
Free full text

840

Successful Treatment using OMT for Chronic GERD in a Pediatric Patient
Shams, S., Chohan, M. M., King, A.
The AAO Journal, 2024/06

841

Osteopathic Approach to the Voice
Surve, S.
The AAO Journal, 2024/06


843

Research integrity and academic medicine: the pressure to publish and research misconduct
Kearney, M., Downing, M., Gignac, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text



846

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic low back pain: a single-blinded randomized controlled trial
Popovich, J. M., Cholewicki, J., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan, A.
Journal of Osteopathic Medicine, 2024/05
Free full text

847

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text

848

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text

849

Interventions to promote medical student well-being: an overview of systematic reviews
Bennett-Weston, A., Keshtkar, L., Jones, M., Sanders, C., Lewis, C., Nockels, K., Solomon, J., Howick, J.
BMJ Open, 2024/05
Free full text

850

The Tensegrity Curriculum: A Comprehensive Curricular Structure Supporting Cultural Humility in Undergraduate Medical Education
Jones, A. C., Bertsch, K. N., Williams, D., Channell, M. K.
Advances in Medical Education and Practice, 2024/05
Free full text

851

Immediate Effects of Integrative Health and Medicine Modalities Among Outpatients With Moderate-To-Severe Symptoms
Rodgers-Melnick, S. N., Srinivasan, R., Rivard, R. L., Adan, F., Dusek, J. A.
Global Advances in Integrative Medicine and Health, 2024/05
Free full text

852

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05



855

The Effects of Osteopathic Manipulative Treatment (OMT) on Postoperative Length of Stay: A Meta-Analysis
Henwood, L., Le Donne, M. E., Vaughn, A., Kamil, S., Harrington, A., Scott, R.
Cureus, 2024/05
Free full text


857

The Efficacy of Early Osteopathic Therapy in Restoring Proper Sucking in Breastfed Infants: Preliminary Findings from a Pilot Study
Parodi, A., Ruffa, R., De Felice, V., Sartini, M., Cristina, M. L., Martino, B., Bianco, F., Di Stefano, R., Mazzella, M.
Healthcare, 2024/05
Free full text


859

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05

860

Implementing paper-based patient-reported outcome collection within outpatient integrative health and medicine
Srinivasan, R., Rodgers-Melnick, S. N., Rivard, R. L., Kaiser, C., Vincent, D., Adan, F., Dusek, J. A.
PLoS One, 2024/05
Free full text

861

A modern way to teach and practice manual therapy
Kerry, R., Young, K. J., Evans, D. W., Lee, E., Georgopoulos, V., Meakins, A., McCarthy, C., Cook, C., Ridehalgh, C., Vogel, S., Banton, A., Bergström, C., Mazzieri, A. M., Mourad, F., Hutting, N.
Chiropractic & Manual Therapies, 2024/05
Free full text


863

Manual Therapy of Dysphagia in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
De Marchi, I., Buffone, F., Mauro, A., Bruini, I., Vismara, L.
Medicina, 2024/05
Free full text

864

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text


866

Doctors of Osteopathic Medicine as Plastic Surgery Residents: Demographics, Credentials, and Pathways to Residency
Raborn, L. N., Elmorsi, R., Smith, B. T., Asaad, M., Kelley, R., Egro, F. M.
Journal of Surgical Education, 2024/04

867

Effect of osteopathic manipulative treatment and Bio-Electro-Magnetic Energy Regulation (BEMER) therapy on generalized musculoskeletal neck pain in adults
Palmer, G. M., Dominick, N., Kane, M., Bawek, S., Burch, B., Sanders, T., Phrathep, D., Myers, N., Lorenzo, S.
Journal of Osteopathic Medicine, 2024/04
Free full text



870

Overcoming barriers to equality, diversity, inclusivity, and sense of belonging in healthcare education: the Underrepresented Groups' Experiences in Osteopathic Training (UrGEnT) mixed methods study
Draper-Rodi, J., Abbey, H., Hammond, J., Thomson, O. T., Brownhill, K., MacMillan, A., Fabusuyi, Y., Vogel, S.
BMC Medical Education, 2024/04
Free full text

871

The Academic Medicine and Leadership Track for Medical Students
Glaser, K., McEchron, M., Jensen, C., Park, D.
Medical Science Educator, 2024/04
Free full text

872

The Impact of Financial Education on Stress Among Orthopaedic Surgeons
Higginbotham, D. O., Nham, F. H., Cavazos, D. R., Chen, C., Stoker, S. K.
Cureus, 2024/04
Free full text

873

Effect of COVID-19 Curriculum Changes on Medical Student Exam Performance: A Case Series
Ho, J., Levy, J., Afshari, N., Patel, D., Andersen, S., Simanton, E., Linton, M.
Cureus, 2024/04
Free full text

874

Where are the Black men in osteopathic medical schools?
Megafu, M. N.
Journal of Osteopathic Medicine, 2024/04
Free full text

875

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text

876

Overview of Treatment Options for Mild Traumatic Brain Injury: A Literature Review
Patel, H., Polam, S., Joseph, R.
Cureus, 2024/04
Free full text

877

The 7 Elements Communication Rating Form for Teaching and Assessing Medical Communication Competency
Wise, C. M., Lovett, G. D., Swarm, G. M., Nazar, A.
Cureus, 2024/04
Free full text


879

How do Australian osteopaths manage migraines? Outcomes from a national practice-based research network
Fleischmann, M., Vaughan, B., Campbell, C., Ekberg, J., Evans, M., Green, M., Ong, A., Pitrone, G., Lane, R., Adams, J.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text

880

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text


882

What is wrong with osteopathy? A response to Thomson and MacMillan
Nicholls, D. A.
International Journal of Osteopathic Medicine, 2024/03

883

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03

884

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03


886

The effectiveness of manipulation in combination with exercise for patients with coccydynia: Six months follow-up of a randomized controlled trial
Tufekci, O., Yilmaz, K., Gercek, H., Unuvar, B. S.
International Journal of Osteopathic Medicine, 2024/03


888

Rehabilitation after severe gaff disease
(Реабилитация после тяжелого течения гаффской болезни)
Lebedeva, D. I., Turovinina, E. F., Marchenko, A. N., Aptekar, I. A., Raspopova, Y. I., Suvorov, A. Y., Bychenko, S. M.
Russian Osteopathic Journal, 2024/03




892

Arctic Medicine
Katrine, B.
The AAO Journal, 2024/03
Free full text



895

Osteopathic techniques and manual rotation of the fetal head successfully resolve mechanical dystocia
Miletić, A. I., Habek, D., Medić, F.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/03



898

Osteopathisch-manipulative Behandlung bei herzchirurgischen Patient*innen: Eine systematische Übersicht
(Osteopathic-manipulative treatment in cardiac surgery patients: A systematic review)
Rorris, F.P., Skouteli, E.A. T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
Osteopathische Medizin, 2024/03


900

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

901

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

902

A Survey Assessment of Neurosurgeons’ Interest in Osteopathic Medicine and Its Integration Into Their Practice.
Kolmetzky, D W, Gooder, D B, Polly, E S, Glisan, S. N., Al-Atrache, Z., Badger, C. A., Yocom, S. S., Turtz, A. R., Allison, D. L.
Cureus, 2024/03

903

Teaching ultrasound in osteopathic medical schools
Slyvka, Y., Gwilym, J. L.
Journal of Osteopathic Medicine, 2024/03
Free full text

904

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03

905

A tailored training based on students’ and teachers’ needs to improve palpation skills: A quantitative part of a mixed-method study
Lavazza, C., Zangoni, G., Sozzi, F., Abenavoli, A., Barenghi, M.
International Journal of Osteopathic Medicine, 2024/03

906

Expansion of osteopathic medicine practitioner education on substance use disorders
Petrides, J., Jha, S., Kowalski, A., Hosein, S., Collins, P. B., Coren, J.
Journal of Osteopathic Medicine, 2024/03
Free full text

907

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03

908

Medical Students' Knowledge, Attitudes Toward, and Identification of Adverse Childhood Experiences and Trauma-Informed Care
Piszczor, R., Barry, C., Gundacker, C., Wallace, C., Shibuya, J., Perle, J.
The Permanente Journal, 2024/03
Free full text

909

Academic Degree Bias Among Speaking and Leadership Roles at the American Academy of Orthopaedic Surgeons Annual Meetings, 2016-2021
Bartlett, L., Daley, A., Kazimierczak, A., Klein, B., Humbyrd, C., Bitterman, A., Cohn, R.
Cureus, 2024/03
Free full text

910

Osteopathic manipulative treatment for pediatric Long-COVID headache: A case report
Danto, S. E., Danto, J. B.
International Journal of Osteopathic Medicine, 2024/03

911

Utility of Osteopathic Manipulation Treatment in MTBI Patients With PPCS and Cervicogenic & Vestibuloocular Profiles
Chen, A., Gross, A., Marshall, J., Anilkumar, A., Patel, N., Maes, L., Mulumba, D., Dusenberry, B.
Clinical Journal of Sport Medicine, 2024/03

912

Investigation of Immediate Effects of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S., Matthias, A., Roush, A., Wilson, H., Nicholas, J., Edwards, C., Mangum, K., Pickett, B.
Clinical Journal of Sport Medicine, 2024/03

913

Meta-epidemiologic review: Blinding and sham treatment in clinical trial design for osteopathic manipulative treatment research
Irving, R., Schmidt, E., Stone, M., Fleming, R. K., Xie, J. Y.
International Journal of Osteopathic Medicine, 2024/03

914

Effect of Osteopathic Manipulation in an Autism Spectrum Child With Speech Impairment and Attention Deficit: A Case Report
Sharath, H. V., Raghuveer, R., Qureshi, M. I., Warghat, P. A., Desai, S., Brahmane, N. A.
Cureus, 2024/03
Free full text

915

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03

916

Osteopathic manipulative treatment for autism spectrum disorder: Three case reports
Wolf, K., Widjaja, F., O'Keefe, W., Chen, Y., Breard, M., Parenteau, C., Keys, J., Riemer, R., Hendren, R. L.
International Journal of Osteopathic Medicine, 2024/03

917

Efectividad del abordaje osteopático en pacientes con fibromialgia
(Effectiveness of osteopathic treatment in patients with fibromyalgia)
García Ruiz, P.
European Journal Osteopathy & Related Clinical Research, 2024/03
Free full text

918

Eficacia de las técnicas de osteopatía en la dismenorrea
(Effectiveness of osteopathic techniques in dysmenorrhea)
Romero Rodríguez, T., Ruiz Martínez, A., Fernández Villamarín, E.
European Journal Osteopathy & Related Clinical Research, 2024/03

919

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03

920

Effects of osteopathic manipulative treatment on maternal-fetal hemodynamics in third trimester pregnant women: A prospective study
Arruda Correia, M. L., Peixoto Filho, F. M., Gomes Júnior, S. C., de Jesus, G. R.
PLoS One, 2024/03
Free full text

921

Potential mechanisms for osteopathic manipulative treatment to alleviate migraine-like pain in female rats
Byrd, K., Lund, M., Pan, Y., Chung, B. H., Child, K., Fowler, D., Burns-Martin, J., Sanikommu, M., Henderson, H., Gregory, C., Fleming, R. K., Xie, J. Y.
Frontiers in Pain Research, 2024/02
Free full text

922

Prevalence and quality of medical Spanish education in US osteopathic medical schools: a national survey
Dey, K., Romero Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2024/02
Free full text

923

Osteopathic approach as an additional therapy of infertility in women with PCOS
Jędrzejczyk, S., Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jerzak, M., Jerzak, M.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/02

924


925

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text

926

The Prevalence and Distribution of Osteopathic Chief Residents in Emergency Medicine
Wandro, E., Rammaha, S., McGurk, K.
Cureus, 2024/02
Free full text

927

The endogenous oxytocin after manipulative osteopathic treatment in full-term pregnant women
Ragusa, A., Svelato, A., Fogolari, M., Ficarola, F., Plotti, F., De Luca, C., D'Avino, S., Davini, F., De Cesaris, M., Messina, G., Bertolini, A., Marci, R., Angeletti, S., Angioli, R., Terranova, C.
European Review for Medical and Pharmacological Sciences, 2024/02

928

Application Of Osteopathic Treatment for Non-Pain–Related Discomforts of Pregnancy: A Literature Review
Gomperts, J., Carroll, L., Powers, B., Rodriguez, A.
Osteopathic Family Physician, 2024/02

929

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02

930


931

Identified strategies to mitigate medical student mental health and burnout symptoms
Ozan, K. G., McGough, J. E. G., Gabel, J., Snow, M., Michel, N., Cooper, L., Robinson, K.
Journal of Osteopathic Medicine, 2024/02
Free full text


933

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text

934

An assessment of surgery core rotation quality at osteopathic medical schools
Casey, T., Brennan, Z., Pereira, K., Young, G., Paluri, S. N., Gudakunst, C.
Journal of Osteopathic Medicine, 2024/02
Free full text

935

The clinical anatomy fellowship: A participants' perspective
Thiel, G. E., Murtha, C. M., Dennis, J. F., Hopper, M.
Anatomical Sciences Education, 2024/02

936

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text

937

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text

938

Interdisciplinary Approach to Orthodontic Treatment Involving an Osteopath and a Dentist (Protocol)
Aptekar, I. A., Abramova, E. V., Postnikov, M. A., Kopetsky, I. S., Eremin, D. A., Postnikova, E. M., Poluianova, E. B., Aptekar, V. I., Muravyov, I. O.
Bulletin of Russian State Medical University, 2024/02
Free full text

939

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text

940

Osteopathic Manipulative Treatment in Dysmenorrhea: A Systematic Review
Bonner, P. E., Paul, H. A., Mehra, R. S.
Cureus, 2024/01
Free full text



943

The Effect of the Coronavirus (COVID-19) Pandemic on Gender and Medical School Diversity in Gastroenterology Fellowship Matching
Almujarkesh, M. K., Alsakarneh, S., Almeqdadi, M., Al Ta'ani, O., Mohamad, B., Kinnucan, J.
Gastro Hep Advances, 2024/01
Free full text


945

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

946

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01


948

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01



951

Visual Health Impact of Online Learning During COVID-19 in Osteopathic Medical Students
Syed, Z., Quadri, S.
Journal of Osteopathic Medicine, 2023/12

952


953

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12

954

Assessment of Long-term Effects of Adding Osteopathic Manipulative Treatment to Neck Exercises for Individuals With Non-specific Chronic Neck Pain: A Randomized Trial
Groisman, S., da Silva, L., Sanches, T., Rocha, C., Malysz, T., Jotz, G.
Journal of Chiropractic Medicine, 2023/12


956

A Student-Driven Mindfulness Curriculum for First-Year Osteopathic Medical Students: A Pilot Study
Nielsen, C., Katz, S., Parker, M., Trefsgar, J., Bcharah, H., Kalin, J., Delavary, D., Brunk-Grady, M., Jaqua, B.
Journal of Osteopathic Medicine, 2023/12
Free full text

957

Letter to the Editor: Underlining there is nothing wrong with osteopathy
Espírito Santo, J., Moita, J., Campos, B., Nunes, A.
International Journal of Osteopathic Medicine, 2023/12

958

Osteopathic Medical Students’ Preferences for Viewing Lectures at a Multi-Campus Medical School
King, L., Rodgers, J., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12

959


960

The Effect of Osteopathic Medical Students’ Age on Desired Specialty
Raidah, A., Huang, P., Tariq, N., Wong, H., Hildreth, L., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12

961

Examining Osteopathic Medical Students’ Experiences with Distance Learning and Social Connectedness
Rodgers, J., King, L., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12

962

Investigating the current published literature where osteopathic manual therapy is used as an intervention: A scoping review
Ryan, H., Friedlander, T., Anderson, H., Mason, J.
International Journal of Osteopathic Medicine, 2023/12

963

Letter o the Editor: Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12

964

Letter to the Editor: There is nothing wrong with osteopathy
van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2023/12

965

Osteopathic Manipulative Treatment for Chronic Bronchiectasis: A Case Report
Abend, D., Powell, L., Sivanandam, A., Nayar, R.
Osteopathic Family Physician, 2023/12







972

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text

973

Building Interest in the Primary Care Specialty Through Enhanced Global Health Experience
Hernandez, M., Ibiwoye, M. O., Ledbetter, M., Thacker, R., Diaz, S.
Cureus, 2023/12
Free full text

974

Mental health differences in medical students based on curriculum and gender
Jestin, M., Sharma, S., Jhaveri, D., Mitchell, B., Micciche, D., Venkataraman, V., Lambert, K.
BMC Medical Education, 2023/12
Free full text

975

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12

976

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text

977

Preliminary Evaluation of an Osteopathic Manipulative Treatment to Prevent Motion Sickness
Thomas, V. A., Kelley, A. M., Lee, A., Fotopoulos, T., Boggs, J., Campbell, J.
Aerospace Medicine and Human Performance, 2023/12

978

Improving Transparency in the Residency Application Process: Survey Study
Ulin, L., Bernstein, S. A., Nunes, J. C., Gu, A., Hammoud, M. M., Gold, J. A., Mirza, K. M.
JMIR Formative Research, 2023/12
Free full text

979

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12

980

Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12

981

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/12
Free full text

982

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/12
Free full text


984

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12

985

Safety and Efficacy of Osteopathic Manipulative Treatment (OMT) in the Pediatric Oncology Inpatient Setting
Brown, A., Hoffman, L., Eyassu, E., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
Journal of Osteopathic Medicine, 2023/12

986

Evaluation of Using Three-Dimensional Sacral Models in the Education of Sacral Osteopathic Manipulative Treatment: A Quality Improvement Study
Carr, G., Schury, C., Hammer, T., Lippert, J., Azevedo, L.
Journal of Osteopathic Medicine, 2023/12

987

OMT Alleviated Migraine-Like Pain via Blockade of Trigeminal Activation
Child, K., Fowler, D., Pan, Y., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2023/12


989



991

Healthcare Camp for High School Students Enhances the Understanding of Foundations of Osteopathic Medicine, Identifying Implicit Bias, and Recognizing Social Determinants of Health
Flanagan, M. K., Liu, E. L., Neff, A. R., Klink, A. M., Kruse, K. M., Vroegop, J. M., Orr, A. L., Skinner, B. W., Hum, J. M.
Journal of Osteopathic Medicine, 2023/12

992

Investigation of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S. P., Matthias, A., Roush, A. J., VanderMerwe, D., Starr, E. G., Wong, W. J., Parker, L. M., Nicholas, J. M., Wilson, H.
Journal of Osteopathic Medicine, 2023/12

993

Empathy Fatigue in Osteopathic Medical Students
Gernert, E., Malaker, P., Nguyen, T., Uptegrove, L., Nagireddi, S.
Journal of Osteopathic Medicine, 2023/12

994

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12


996

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12

997

Efficacy of Virtual Reality Programs versus Traditional Lectures on Osteopathic Medicine Information Retention
Jacob, T. J., Jose, R. M., Abraham, A., Syed, F., Tran, T.
Journal of Osteopathic Medicine, 2023/12


999

Use of osteopathic manipulative treatment in management of intractable singultus and associated symptoms
Bloch, R. R., Kempa, M. R., Lippert, J. A.
International Journal of Osteopathic Medicine, 2023/12

1000

Assessing the Quality and Quantity of Research Among Incoming First-Year Osteopathic Medical Students
Lynch, S., Byrne, J., Sharieff, K.
Journal of Osteopathic Medicine, 2023/12

1001

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12

1002

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12

1003

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12

1004

The Efficacy of Osteopathic Manipulation Treatment (OMT) on Post-Operative Outcomes: An Abstract
Reddy, P., Santhakumar, K.
Journal of Osteopathic Medicine, 2023/12



1007

Trends in Contributions to the Osteopathic Political Action Committee: A Twenty-Two-Year Analysis
Scully, T., Loria, R., Golden, A., Martinez, V. H., Sees, J.
Journal of Osteopathic Medicine, 2023/12

1008

Efficacy of Osteopathic Manipulation Therapy in the Treatment of Post-concussive Versus Primary Migraines
Song, J., Hall, T., Waddington, M.
Journal of Osteopathic Medicine, 2023/12

1009

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12

1010

Analyzing ChatGPT’s Proficiency In Multiple Choice Osteopathic Manipulative Medicine Questions: Insights and Implications
Sundin, A., Gawash, A., Zia, H., Lo, D. F., Averell, N., King, A., Powell, L.
Journal of Osteopathic Medicine, 2023/12

1011

Ultrasound-assisted bony landmark palpation in untrained palpators
Nichols, J. W., Schmidt, C., Raghuraman, D., Turner, D.
Journal of Osteopathic Medicine, 2023/11
Free full text

1012

A Pilot Study of Symptoms of Major Depressive Disorder in Medical Students at an Osteopathic Medical School Before and After High-Stakes Examinations
Arabatzis, T. J., Doroshenko, J., Ashraf, M. A., Smith, R. M.
Advances in Medical Education and Practice, 2023/11
Free full text

1013

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
Free full text

1014

Time Until Proof of Credentials Significantly Decreases With the Use of Blockchain Technology and the Document Management System
Tissier, E. A., Berglund, A., Johnson, G. J., Sanzone, Z. A., Goodbread, A. P., Parker, H., Lucas, J., Kashmer, D.
Cureus, 2023/11
Free full text


1016

Building Interest in Cardiothoracic Surgery at an Osteopathic Medical School: Results of an Institutional Study and a Guide for Medical Schools
Vogel, A. D., Wynn, A., Sindoni, M., Richards, M. C., Eppler, A. R., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2023/11
Free full text


1018



1020

Osteopathic Manipulative Treatment on Predominantly African American Hospitalized Coronavirus Disease 2019 Patients during Michigan’s First Wave.
Soni, E., Kattan, M., Jackson, N. M., Mainor, I., Corser, W.
MI Medical Education and Health Bulletin, 2023/11
Free full text

1021

Key factors for residency interview selection from the National Resident Matching Program: analysis of residency Program Director surveys, 2016-2020
Stone, C. L., Dogbey, G. Y., Falls, J., Kuo, Y. P.
Journal of Osteopathic Medicine, 2023/11
Free full text

1022

Neurosurgery Clerkships in United States Medical Schools: A Survey of MD- and DO-Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2023/11




1026

Effekte von Osteopathie auf Migräne
(Effects of osteopathy on migraine)
Pöchlauer-Schneck, J.
Unpublished MSc thesis, 2023/11






1032


1033

Osteopathic Manipulative Medicine and Its Role in Psychiatry
Bowes, M. R., Speicher, M. R., Tran, L. T., Santiago, P. N.
Cureus, 2023/10
Free full text

1034


1035

Enhancing Future Healthcare Professional Education Surrounding Substance Use Disorders
Riccio, K. K. C., Hales, K., Whittaker, A.
Journal of Addiction Medicine, 2023/10

1036

Effects of a focused training on first-year osteopathic medical students' ability to incorporate point-of-care ultrasound in assessment of the anterior knee
Weaver, C., Heath, D. M., Makin, I. R. S., Hanamaika'i, K., Kanumalla, R., Matsushita, S., Chatta, P., Adhikari, S.
Journal of Osteopathic Medicine, 2023/10
Free full text




1040

Case History #4
Coffey, D.
The AAO Journal, 2023/09
Free full text

1041



1043

Dermal Reflections of Neural Disorders: An Hypothesis
Patriquin, D. A.
The AAO Journal, 2023/09
Free full text

1044

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text

1045

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09

1046

The extent and quality of evidence for osteopathic education: A scoping review
MacMillan, A., Gauthier, P., Alberto, L., Gaunt, A., Ives, R., Williams, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/09

1047

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09

1048

Osteopathic treatment for cam-type Femoroacetabular impingement syndrome: A case report
Kilic, R. T., Yosmaoglu, H. B., Bayrakci Tunay, V.
International Journal of Osteopathic Medicine, 2023/09

1049

The effectiveness of disinfection protocols in medical school osteopathic manipulative medicine labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/09
Free full text

1050

Quantitative ultrasound to assess efficacy of treatment for neck somatic dysfunctions: a feasibility study
Tran, A., Ngo, T., Roberts, T., Ko, E., Holmgren, J. G., Edwards, C., Coleman, M., Gao, J.
Journal of Osteopathic Medicine, 2023/09
Free full text


1052


1053

Die Rolle des Menstruationszyklus bei Sportverletzungen
(The role of the menstrual cycle in sports injuries)
Stierl, J. A., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09





1058



1060

Osteopathic Manual Therapy for Infant Colic: A Randomised Clinical Trial
Martínez-Lentisco, M. D. M., Martín-González, M., García-Torrecillas, J. M., Antequera-Soler, E., Chillón-Martínez, R.
Healthcare, 2023/09
Free full text

1061

Evaluation of the effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in chronic nonspecific low back pain. A protocol for a randomised controlled trial
Armbrust, D., Fonseca, C. L., Lopes Dumont, A. J., Viegas da Trindade, A. M., Neto, H. P., Oliveira, C. S.
International Journal of Osteopathic Medicine, 2023/09

1062

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09

1063

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09

1064


1065

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text

1066

A Novel Approach to Assessing and Conservatively Treating Anterior Cutaneous Nerve Entrapment Syndrome: A Case Study
Newman, D. P., Holkup, S. M., Masi, E. L., Soto, A. T.
Cureus, 2023/09
Free full text

1067

Osteopathic Manipulative Treatment for a Chronic Rotator Cuff Tear: A Case Report
Scypinski, L. J., Bonitz, T. J., Lomiguen, C. M., Chin, J.
Cureus, 2023/09
Free full text

1068

Assessing interest in cardiothoracic surgery at an osteopathic medical school: Results of an institutional survey
Vogel, A. D., Wynn, A., Richards, M. C., Sindoni, M., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
JTCVS Open, 2023/09

1069

Equal but Separate: The Slow Assimilation of Osteopathic Surgery Residents Two Years After the Unified Match
Bello, G., Lyles, E., Owens, S., Wilson, A. S., Westby, R. W., Evans, W., Edmondson, E., Lindsey, T. G. II., Falcone, J. L., Boyev, A.
Journal of Surgical Education, 2023/09


1071

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09




1075

Understanding the Use of Program Resources During Virtual Recruitment by Psychiatry Residency Applicants
Bernstein, S. A., Hodgins, G. E., Abu-Hamad, S., Gih, D. E., Gold, J. A.
Academic Psychiatry, 2023/08
Free full text

1076

The process and outcomes of chronic low back pain treatment provided by osteopathic and allopathic physicians: a retrospective cohort study
Licciardone, J. C., Kellerlee, J., Joseph, M., Mohammad, M. B., Kim, K. G., Jain, J., Aryal, S.
Journal of Osteopathic Medicine, 2023/08
Free full text

1077

Osteopathic manipulative treatment for concussions and postconcussive syndrome in athletes: a literature review
Thomas, K. D., Lombard, Z. K., Shadiack, A. L.
Journal of Osteopathic Medicine, 2023/08
Free full text

1078

The Evaluation of a Digital Health Intervention to Improve Human Papillomavirus Vaccine Recommendation Practices of Medical Students
Richman, A. R., Torres, E., Wu, Q., Eldridge, D., Lawson, L.
Journal of Cancer Education, 2023/08

1079

Diversity Differences Among Cardiovascular Fellowships Across Five Geographic Regions in the United States
Dye, M., Saeed, A., Nguyen, T. Q., Yu, S., Bey, J., Hefner, D., Walk, C. T., Lantz, R.
Cureus, 2023/08
Free full text

1080

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text

1081

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., Bradley
Frontiers in Physiology, 2023/08
Free full text

1082

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text


1084

Awareness and interest in osteopathic manipulative treatment in allopathic medical students
Darby, A., Parascando, J. A., Lipinski, M., Lipinski, C., Mendez-Miller, M., Berg, A., Rabago, D., Oser, T. K.
Journal of Osteopathic Medicine, 2023/08
Free full text

1085

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text

1086

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07

1087

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/07

1088

Surgical simulation in osteopathic medical schools
Seely, K. D., Hansen, M., Paluri, S. N., Rasmussen, K., Carter, S., Nigh, A.
Journal of Osteopathic Medicine, 2023/07
Free full text

1089

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07

1090

Systematic review and meta-analysis showed that complementary and alternative medicines were not effective for infantile colic
Cabanillas-Barea, S., Jiménez-del-Barrio, S., Carrasco-Uribarren, A., Ortega-Martínez, A., Pérez-Guillén, S., Ceballos-Laita, L.
Acta Paediatrica: Nurturing the Child, 2023/07
Free full text

1091

Integrating A Student Co-Created Health Systems Science Curriculum Within UME
Ethridge, B., Steadman, M., Crews, B.
Southern Medical Journal, 2023/07


1093

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text

1094

Effectiveness of Osteopathic Manipulative Treatment in Treating Symptoms of Irritable Bowel Syndrome: A Literature Review
Lotfi, C., Blair, J., Jumrukovska, A., Grubb, M., Glidden, E., Toldi, J.
Cureus, 2023/07
Free full text


1096

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text

1097

Effectiveness of visceral fascial therapy targeting visceral dysfunctions outcome: systematic review of randomized controlled trials
da Silva, F. C., Vieira, L. S., Santos, L V., Gaudreault, N., Cruvinel-Júnior, R H., Santos, G M.
BMC Complementary Medicine and Therapies, 2023/07
Free full text

1098

An Osteopathic Approach to Dizziness Secondary to Meniere’s Disease
Grote, J., Perez, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text



1101

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
Free full text


1103

Resolution of a Plica Band Syndrome with Osteopathic Manipulative Treatment
Barr, J., Heller, G.
The AAO Journal, 2023/06
Free full text

1104

An Osteopathic Approach to Chronic Inflammatory Demyelinating Polyneuropathy
Baxter, C., Grote, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text

1105


1106

Nervous System Under Attack
Blaukovitch, C., Unger, M., Thorsvik, N., Heller, G.
The AAO Journal, 2023/06
Free full text

1107

Happy Feet are Dancing Feet, Response to OMT in a Patient with Morphea Profunda: A Case Report
Bomani-Bailey, A., Ettlinger, H.
The AAO Journal, 2023/06
Free full text

1108

Comparison of Tone and Stiffness Changes to Lumbar Paraspinal Muscle with Varying Osteopathic Treatment Modalities (254)
Companion, N., Guha, A., Naeem, A., Abu-Sbaih, R., Keys, J., Yao, S.
The AAO Journal, 2023/06
Free full text

1109

The Effects of Osteopathic Manipulative Treatment (OMT) on an Infant with Failure to Thrive (FTT); A Case Study
Cornwell, S., Yao, S., Abu-Sbaih, R.
The AAO Journal, 2023/06
Free full text

1110

Osteopathic Manipulative Treatment Reduces Pain and Improves Range of Motion in Patients with Chronic Neck Pain
Daly, E., Prodoehl, J., Bolch, C., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2023/06
Free full text



1113

Drug Induced Tibial Nerve Neuropathy in Former Collegiate Baseball Player
Dickey, Z., Turnbull, J., Sharma, N., Aldret, S.
The AAO Journal, 2023/06
Free full text

1114

Cranial Osteopathic Manipulative Treatment for Post-COVID Syndrome
Drakeley, C., Shah, R., Waters, H., Mehra, R., Kumaran, N., Johnson, T.
The AAO Journal, 2023/06
Free full text

1115

Stalled out: An Osteopathic Approach To A Post-Traumatic Gastroparesis
Fisher, B., Vijayakar, R., Coppinger, J., Motashaw, V.
The AAO Journal, 2023/06
Free full text

1116

An Osteopathic Approach to Shoulder Injury Following Post-Hemorrhage Hemiparesis
Geyer-Roberts, E., Helderlein, P., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text

1117

Effect of Objective Training Programs on Symmetry and Accuracy of Passive Motion Force Application
Hajicek, J., Huhn, M., Starks, Z., Wang, Y.F., Degenhardt, B.
The AAO Journal, 2023/06
Free full text

1118

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06


1120

Intersegmental sacral dysfunction as primary etiology of low back pain in a college athlete: A case study
Householder, L., Veach, A., Diefenderfer, J.
The AAO Journal, 2023/06
Free full text

1121


1122

Assessing Differences in Palpation Pressure between Osteopathic Medical Students and Osteopathic Physicians
Jacob, T., Khalid, A., Syed, F., Jose, R., Nikprelaj, K., Frankini, E., Yao, S., Toma, M.
The AAO Journal, 2023/06
Free full text

1123

International Overview of Osteopathic Manipulative Treatment in Infants with Nonsynostotic Plagiocephaly: A Scoping Review to Aid in the Inclusion of OMT into the Current Evidence-Based Treatment Guidelines
Jimenez, R., Cao, G., Bomstad, C., Myxter, K., Lozano, A., Tran, M.T., Roettger, V., Gubler, K. D., Brooks, B., Branda, A.
The AAO Journal, 2023/06
Free full text

1124

The Effects of Osteopathic Manipulative Treatment (OMT) on Rare Diseases- Gordon Syndrome
Johnson, T. A., Waters, H.
The AAO Journal, 2023/06
Free full text

1125

Osteopathic Manipulative Treatment for Enhanced Functional Recovery in Stroke Survivors
Kumaran, N., Drakeley, C., Waters, H., Mehra, R.
The AAO Journal, 2023/06
Free full text

1126

Learning abnormal physical examination signs: an introductory course
Sabirov, A., Chludzinski, M., Eminof, E., Eddy, A., Gallagher, J., Jung, I.
Journal of Osteopathic Medicine, 2023/06
Free full text


1128

The 5 Models of Osteopathic Medicine, An Approach to Transgendered Care: A Case Report
Lentz, A., Koehler, T., Caldwell, G., Fremarek, N.
The AAO Journal, 2023/06
Free full text

1129

Case Study on the Effect of Osteopathic Manipulation on Gallbladder Ejection Fraction
Lin, E., Montalvo, E., Garcia Garcia, D., Adams, N., Sparks, C., Gibson, J., Seals, R.
The AAO Journal, 2023/06
Free full text


1131

Osteopathic Treatment of Chronic Chest Pain After Trauma
Martini, J., Veach, A.
The AAO Journal, 2023/06
Free full text

1132

Effects of OMT on Running Performance and Recovery
Matz, O., Gustafson, H., Hartwell, L., Rudberg-Post, L., Lewis, D.
The AAO Journal, 2023/06
Free full text

1133


1134

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study, Part 2
Miranda, E., Feketeova, E., Giza, J.
The AAO Journal, 2023/06
Free full text

1135

An Osteopathic Approach to Dysmenorrhea
Paul, H., Bonner, P., Mehra, R.
The AAO Journal, 2023/06
Free full text



1138

The Effect of OMT on Insulin Sensitivity and Glucose Control in Rodent Models: A Pilot Study
Petrillo, G., Cai, W., Keys, J.
The AAO Journal, 2023/06
Free full text

1139

An Osteopathic Approach To Refractory Sternal Pain
Risov, D., Geer, R.
The AAO Journal, 2023/06
Free full text

1140

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
Free full text

1141

Palpatory tests in manual therapies: an international survey on osteopathic clinical practice
Novelli, E., Molinari, L., Consolo, S., Mingrone, L.
Journal of Complementary and Integrative Medicine, 2023/06
Free full text

1142

An Osteopathic Approach to Plagiocephaly in the Absence of Pre-Post Sphenoid Fusion
Rosten, C., Nixon, K., Jons-Cox, L.
The AAO Journal, 2023/06
Free full text


1144

Refractory Temporomandibular Joint Pain Resolved with Intraoral Osteopathic Manipulative Treatment
Shah, R., Drakeley, C., Mehra, R.
The AAO Journal, 2023/06
Free full text

1145

Ultrasound Assessment of OMT on Diaphragm Motion
Snow, N., DeDi, C., Rathjen, S., Redden, D. T., Kozar, A., Robinson, L.
The AAO Journal, 2023/06
Free full text

1146

26.2 Miles: A Case Study of Osteopathic Manipulative Treatment in Marathon Training
Sofka, M., Giovanis, A.
The AAO Journal, 2023/06
Free full text





1151

Osteopathic Manipulative Medicine as an Adjuvant Treatment for Hemicrania Continua: A Case Study
Van Fossen, E., Kanithi, M., Jelneck, S., Ferguson, D., Tran, J., Bui, N., Hassan, D., Gordon, T.
The AAO Journal, 2023/06
Free full text

1152


1153

The Planetary Benefit of Suspending USMLE Step 2 CS: Estimating Carbon Emissions Associated with US Medical Students' Travel to Testing Centers
Sherpa, J. R., Donahue, L., Tsai, J., Nguemeni Tiako, M. J.
The Yale Journal of Biology and Medicine, 2023/06
Free full text


1155

Osteopathic Manipulative Treatment of Chronic Pelvic Pain due to High-Tone Pelvic Floor Dysfunction
Barnett, M. E., Henderson, K. K., Elliott-Burke, T. L., Heinking, K. P.
Osteopathic Family Physician, 2023/06

1156

Incorporation of an osteopathic-focused lecture series into an already established pediatric residency curriculum
Wysong, M., Copenheaver, D., Powers, L., Flaherty, R.
The AAO Journal, 2023/06
Free full text

1157

Effect of OMT on post-anoxic brain injury resulting in intractable myoclonus
Zhong, X., Campo, Z., Torrents, M.
The AAO Journal, 2023/06

1158

The first step to strengthening graduate level osteopathic education: a national review
Cain, R. A.
Journal of Osteopathic Medicine, 2023/06
Free full text

1159

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06



1162

Somatic Dysfunction. Clinical Guidelines 2023
(Соматическая дисфункция. Клинические рекомендации 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
Free full text

1163

Pressure force on tissues in various osteopathic techniques (pilot study
(Сила давления на ткани при различных остеопатических техниках (пилотное исследование)
Mokhov, D. E., Tregubova, E. S., Potekhina, Y. P., Smirnova, L. M., Kolyshnitsyn, N. Y., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/06
Free full text




1167

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists: An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/06

1168

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06

1169

Terapia manual y tratamiento osteopático en pacientes con EPOC estable
(Manual therapy and osteopathic treatment in patients with stable COPD)
Diaz Serrano, R., Souto Villar, M. A.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text



1172

Eficacia del tratamiento osteopático en la dismenorrea
(Effectiveness of osteopathic treatment for dysmenorrhea)
Molina Galera, V.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text

1173

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/06
Free full text



1176

Utilization and Reimbursement Trends of Osteopathic Manipulative Treatment for Medicare Patients: 2000-2019
Starr, E., Smith, J. F., Hanson, R. B., Woolstenhulme, J. B., Roush, A. J., Sperry, N. B., Wilde, B., Brooks, A., Zapata, I.
Journal of Osteopathic Medicine, 2023/06
Free full text




1180

Assessing Clinical Reasoning in Medical Students Using a Virtual Patient Simulator
Abdulnour, R., O'Rourke, M., Smith, T.
Diagnosis, 2023/05

1181

Virtual Deliberate Practice: Assessing Clinical Reasoning Using an Illness Script-based Simulator
Abdulnour, R. E., Furfaro, D., Sternschein, R., Smith, T. M., Drazen, J. M.
American Journal of Respiratory and Critical Care Medicine, 2023/05

1182

Osteopathy in the Early Diagnosis and Management of Degenerative Cervical Myelopathy: National Survey
Brannigan, J. F. M., Mowforth, O. D., Rogers, M., Wood, H., Karimi, Z., Kotter, M. R. N., Davies, B. M.
JMIR Formative Research, 2023/05
Free full text


1184

Serological Assessment of the Effectiveness of Osteopathic Manipulative to Augment the Covid-19 Vaccine Immune Response
Martinez, E., Loveless, B., Crone, P., Szurmant, H., Fuchs, S., Sanchez, J.
Journal of Investigative Medicine, 2023/05

1185

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05

1186

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05

1187

Evaluation of Osteopathic Manipulative Treatment in Patients with Chikungunya Fever in the Chronic Phase: A Randomized Controlled Trial
Tenorio, L., Mello, K., Maia, M., Valença, A., Duarte, Â., Marques, C.
Journal of Clinical Rheumatology, 2023/05

1188

Allopathic and Osteopathic Residents Perform Similarly on the Orthopedic In-Training Examination (OITE)
Gomez, C., Ranson, R., Gianakos, A., Miskimin, C., Mulcahey, M. K.
Journal of Surgical Education, 2023/05
Free full text

1189

Response to “Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine“
Rehman, Y., Kirsch, J., Snider, K. T.
Journal of Osteopathic Medicine, 2023/05
Free full text



1192

Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine
Alvarez, G., Lucas, S., Roura, S.
Journal of Osteopathic Medicine, 2023/05
Free full text


1194

Osteopathic manipulative treatment of patients with chronic low back pain in the United States: a retrospective cohort study
Licciardone, J. C., Moore, S., Fix, K., Blair, L. G., Ta, K.
Journal of Osteopathic Medicine, 2023/05
Free full text

1195

Beyond burnout: a four-year survey of osteopathic medical student mental health and the implications for the development of wellness and mental health programs
Ley, A. F., Han, J. J., Hare, E., Sikorskii, A., Taylor, J. R., Shahed, A., Guro, C.
Journal of Osteopathic Medicine, 2023/05
Free full text

1196

Osteopathic Manual Treatment Compared to Kaltenborn-Evjenth Orthopedic Manual Therapy for Chronic Low Back Pain: A Randomized Study
Lizis, P., Kobza, W., Jaszczur-Nowicki, J., Wisniewski, D.
Alternative Therapies in Health and Medicine, 2023/05


1198

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists : An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/05

1199

Medical Education Fellowship: Who's Doing It and Why?
Cueva, J., Jobeun, N., Mody, S.
Western Journal of Emergency Medicine, 2023/05
Free full text

1200

Efficacy of the Osteopathic Pedal Pump in Reducing Lower Limb Volume in Older Adults with Lymphedema
Parikh, S. H., Adams, J. S., Goodwin, B. J., McLaughlin, M. H., Noll, D. R.
Journal of the American Geriatrics Society, 2023/04

1201

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: Randomized controlled trial
Boas Fernandes, W. V., Politti, F., Blanco, C. R., Garcia Lucareli, P. R., Gomes, C. A. F. d. P., Corrêa, F. I., Corrêa, J. C. F.
Journal of Bodywork and Movement Therapies, 2023/04

1202

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match. Letter
Bohler, F., Aggarwal, N. D.
The Journal of Urology, 2023/04
Free full text


1204

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match
Bohler, F., Aggarwal, N. D.
The Journal of Urology, 2023/04

1205

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text

1206

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text

1207

Realistic Assessment of Research Publications by Neurosurgery Residency Applicants
Hasley, H. L., O'Malley, G. R., Jr., Bala, S., Weisman, H. E., Roth
World Neurosurgery, 2023/04

1208

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text

1209

Validation of subjective manual palpation using objective physiological recordings of the cranial rhythmic impulse during osteopathic manipulative intervention
Pelz, H., Müller, G., Keller, M., Mathiak, K., Mayer, J., Borik, S., Perlitz, V.
Scientific Reports, 2023/04
Free full text

1210

Barriers to research opportunities among osteopathic medical students
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2023/04
Free full text

1211

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

1212

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text

1213

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

1214

Osteopathic Findings and Treatment of Patient with Crohn's Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text



1217

Communication strategies in psychologically informed osteopathic practice: A case report
Abbey, H.
International Journal of Osteopathic Medicine, 2023/03

1218

Understanding and preference toward DOs and OMT before and after an osteopathic principles and practice fellow lecture series
Ellson, L., Wong, N., Harper, J., Williamson, G., Zapata, I., Putnam, K., Roberts, J.
Journal of Osteopathic Medicine, 2023/03
Free full text

1219

Interventional Radiology in Osteopathic Medical Education
Cyphers, E., Groskreutz, D., Grilli, C., Ahuja, R.
Journal of Vascular and Interventional Radiology, 2023/03

1220

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text


1222

Covid-19 Fatigue: Diagnosis and Treatment for the Osteopathic Physician
Foss, V. B., Maddie, N., Frankini, E. L., Landman, S., Maccagnano, J., Yao, S. C.
Osteopathic Family Physician, 2023/03


1224

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03

1225


1226

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text

1227

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03

1228

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03

1229

Osteopathic Findings and Treatment of Patient with Crohn’s Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text

1230

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text










1240



1242

Osteopathic intervention for infants with breastfeeding difficulty: A retrospective case series
Greenwood, K., Engel, R., Grace, S.
International Journal of Osteopathic Medicine, 2023/03


1244

Response to Lo et al. regarding “The role of 3D digital applications in Manual Therapy Education – A scoping review”
Kovanur Sampath, K., Arumugam, A., Jull, G.
International Journal of Osteopathic Medicine, 2023/03
Free full text


1246

Osteopathic education: A scoping review protocol
MacMillan, A., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/03

1247

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03

1248

Evaluating the impact of a curriculum intervention using an assessment rubric for communication skill development of osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2023/03

1249

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text


1251

Eficacia de las técnicas osteopáticas en el dolor de rodilla
(Effectiveness of osteopathic techniques in knee pain)
González Ruiz, P. M., Laguna Aranda, A. M., Aranda Guirado, L.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text

1252


1253

Efecto de la osteopatía en la enfermedad por reflujo gastroesofágico
(Effect of osteopathy on gastroesophageal reflux disease)
Martín Ruiz, M.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text


1255

Manejo de las radiculopatías mediante manipulaciones espinales
(Management of radiculopathies through spinal manipulation)
Prado Posada, S.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text

1256

Efectividad del tratamiento osteopático en el dolor pélvico crónico
(Effectiveness of osteopathic treatment for chronic pelvic pain)
Rivero Rodríguez, S.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text

1257

Beneficios del tratamiento osteopático en el periodo obstétrico
(Benefits of osteopathic treatment during pregnancy)
Rodríguez Pérez-Serrano, E., Sedeño Vidal, A.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text











1268

Osteopathic Manipulation as a Method of Cortisol Modification: A Systematic Review
Thibaut, D., Santarlas, V., Hoppes, J., Vásquez-Castillo, A., Morrow, A., Oviedo, E., Toldi, J.
Cureus, 2023/03
Free full text

1269

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text



1272

Weibliche Genitalverstümmelung und Osteopathie
(Female genital mutilation and osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03



1275

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text

1276

Perceived Value of Osteopathic Recognition
Maier, R., Weaver, J., Ginoza, J. A., Meyer, D., Gothard, D.
Family Medicine, 2023/02
Free full text

1277

To the Editor: COMLEX-USA vs USMLE? Irrelevant
Terry, R., Lavertue, S.
Journal of Graduate Medical Education, 2023/02
Free full text

1278

The assessment of point-of-care-ultrasound (POCUS) in acute care settings is benefitted by early medical school integration and fellowship training
Kern, J., Scarpulla, M., Finch, C., Martini, W., Bolch, C. A., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2023/02
Free full text

1279

The Impact of Complementary and Integrative Medicine Following Traumatic Brain Injury: A Scoping Review
Kim, S., Mortera, M. H., Wen, P. S., Thompson, K. L., Lundgren, K., Reed, W. R., Sasson, N., Towner Wright, S., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
The Journal of Head Trauma Rehabilitation, 2023/02
Free full text




1283


1284


1285

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01



1288

An exploration of the experience of osteopaths managing individuals with endometriosis
Zeigler, Z. L.
Unpublished MSc thesis, 2023/01
Free full text


1290

Factors Leading to Successful Performance on U.S. National Licensure Exams for Medical Students: A Scoping Review
Jeyaraju, M., Linford, H., Bosco Mendes, T., Caufield-Noll, C., Tackett, S.
Academic Medicine, 2023/01

1291

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text


1293

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text

1294

Concussion-related visual memory and reaction time impairment in college athletes improved after osteopathic manipulative medicine: a randomized clinical trial
Mancini, J. D., Angelo, N., Abu-Sbaih, R., Kooyman, P., Yao, S.
Journal of Osteopathic Medicine, 2023/01
Free full text

1295

Effectiveness of osteopathic manipulative treatment in cardiovascular function: a systematic review protocol
Vanier, C., Johnston, K., DeArmond, M., Salloum, L., Arjmand, S., Toder, E., Ioudina, M.
JBI Evidence Synthesis, 2023/01
Free full text


1297

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Wang, M. Y., Ferguson, H., Bingham, J., Senger, B., Swogger, S. E., Johnston, R., Snider, K. T.
Journal of Osteopathic Medicine, 2023/01


1299

(Osteopathy as a treatment proposal for patients with temporomandibular disorders: a systematic review)
Pereira de Paula, R., Oliveira da Silva Almeida, D., Garcia de Paula, G., Moreira Alves, L., Oliveira Silva, M., Rodrigues da Cunha, M., Iatecola, A., Ramos Fernandes, V.A., Rodrigues Silva, V., de França, E., Barroso Hirota, V.
Revista Multidisciplinar da Saúde, 2023
Free full text


1301

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12

1302

Mental health outcomes among osteopathic physicians during COVID-19
Lee, E., Lo, Jo., Zhu, P., Fernandez Sweeny, Y., Fuchs, S.
International Journal of Osteopathic Medicine, 2022/12
Free full text


1304

Corrigendum to “Treatment of infant colic with craniosacral therapy. A randomized controlled trial“ [Complement Ther Med 71 (2022) 102885]
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/12
Free full text

1305


1306

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12










1316

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/12










1326

Epiploic Appendagitis Mimicking Acute Appendicitis: An Osteopathic Case Report
Chin, J., Oseguera, B., Hon, K., Lomiguen, C. M., McBride, T.
Cureus, 2022/12
Free full text

1327

The effect of the COVID-19 pandemic on osteopathic education in ACGME-OR residencies from February 2020 to February 2021
Bingham, S., Bray, N. N., Eddy, A. J.
Journal of Osteopathic Medicine, 2022/12
Free full text

1328

Evaluation of Osteopathic Principles in Cadaveric Specimens Using Radiological Assessment
Siddiqi, I., Wang, A., Marino, M., Bowen, I., Miulli, D. E.
Cureus, 2022/12
Free full text

1329

Evocations of Osteopathy's founder and questions for contemporary osteopathic professional identity: A thematic analysis
Skinner, D., Esber, T., Walkowski, S.
International Journal of Osteopathic Medicine, 2022/12

1330

Pain and functional recovery from chronic low back pain over 12 months: implications for osteopathic medicine
Licciardone, J. C., Pandya, V.
Journal of Osteopathic Medicine, 2022/12
Free full text


1332

A web-based review of global health programs in U.S. allopathic and osteopathic medical schools
Edwards, M. K., An, C., Rohrbaugh, R., Peluso, M. J., Lam, S. K.
Medical Teacher, 2022/12

1333

Acupuncture and Osteopathic Medicine for Atopic Dermatitis – a Three-armed Randomized Controlled Explorative Clinical Trial
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Clinical and Experimental Dermatology, 2022/12
Free full text

1334

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic neck pain: A single-blinded randomized controlled trial
Cholewicki, J., Popovich, J. M., Jr., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/12


1336

Preliminary Results from a Randomized Controlled Trial on the Efficacy of Osteopathic Manipulative Medicine in Recovery from Concussions
Benedict, A. B., Torretta, C., Cholewicki, J., DeStefano, L. A., Fitton, N., Saffarian, M., Popovich, J. M., Zatkin, M., Lee, A., Sikorskii, A., Leslie, L., Shiver, Z.
Journal of Osteopathic Medicine, 2022/12

1337

Effects of Osteopathic Manipulative Treatment on Primary Dysmenorrhea
Companion, N., Ahmed, E., Keys, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12

1338

The Use of Osteopathic Manipulative Treatment (OMT) in the Management of Patients With Post-COVID Symptoms
Foss, V., Kaur, J., Stoukides, G., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12


1340

Gender Differences in Stress, Anxiety, and Depression Perceived by Osteopathic Medical Students Within the Context of the COVID-19 Pandemic
Herr, V., Emanuel, J., Farid, A., Morris, A., Balentine, J., Blazey, W., Krishnamachari, B.
Journal of Osteopathic Medicine, 2022/12

1341

A Feasibility Study to Assess OMT for NAS
Householder, L., Glynn, B., Wadman, H., Hoffmann, K.
Journal of Osteopathic Medicine, 2022/12

1342

A Peer-led Program to Increase Diversity in Osteopathic Medical Schools: Three Year Update
Hu, J., Smart, H., Garo, J. A., Rachdi, O., Fernandes Paul, M.
Journal of Osteopathic Medicine, 2022/12

1343

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12

1344

Use of Osteopathic Manipulative Medicine in Treating Migraines
Lund, M., Pan, Y., Burns-Martin, J., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2022/12

1345

Student Developed Didactic Series Rooted in Osteopathic Philosophy
Newman, N., Ahmed, S., Shiffler, V., Sinitsa, I., Harold, Z., Naeem, A., Lovett, G., Nazar, A.
Journal of Osteopathic Medicine, 2022/12

1346

Beliefs and Attitudes About Opioid Prescribing in Patients With Low Back Pain: A Survey of Osteopathic Physicians
Pham, B., Tzau, A., Lee, A. S., DeStefano, L. A., Popovich, J. M.
Journal of Osteopathic Medicine, 2022/12

1347

Reduction in Stress Among Frontline Healthcare Workers Receiving Osteopathic Manipulation
Schnautz, R., Eilerman, A., Faherty, M.
Journal of Osteopathic Medicine, 2022/12

1348

Impact of Osteopathic Manipulative Techniques on the Management of Dizziness Caused by Neuro-Otologic Disorders: Systemic Review and Meta-Analysis
Senger, B., Rehman, Y., Snider, K. T., Kirsch, J., Wang, M. Y.F., Johnston, R., Bingham, J., Ferguson, H., Swogger, S.
Journal of Osteopathic Medicine, 2022/12

1349

Osteopathic Manipulative Treatment Efficacy in Mean HIT-6 Score Reduction in Tension-Type Headaches: A Meta-Analysis
Tran, E., Thomas, C., Zheng, T., Thalody, A., Winegar, A., Torelli, V., Wu, S. S.
Journal of Osteopathic Medicine, 2022/12


1351

A Randomized Controlled Trial of Osteopathic Manipulative Therapy to Reduce Cranial Asymmetries in Young Infants with Nonsynostotic Plagiocephaly
Bagagiolo, D., Priolo, C. G., Favre, E. M., Pangallo, A., Didio, A., Sbarbaro, M., Borro, T., Daccò, S., Manzoni, P., Farina, D.
American Journal of Perinatology, 2022/12

1352

Diagnosis and management of headache disorders in osteopathic practice: A qualitative study
Tripodi, N., Cordina, J., Jaffre, D., Mason, K., McMahon, G., Xeureb-Graham, B., Yanovsky, R., Wospil, R.
International Journal of Osteopathic Medicine, 2022/12

1353

Manual therapy as a management approach for gastroesophageal reflux disease: A systematic review
Brendon dos Santos, C., Artioli, D. P., Bertolinie, G. R. F.
International Journal of Osteopathic Medicine, 2022/12



1356

Measuring the Perception of Readiness with an EHR Training: A Look into Primary Care
Saldivar, E.
Unpublished Dissertation, 2022/11
Free full text


1358

The Austrian Osteopathic Practitioners Estimates and RAtes (OPERA): A cross-sectional survey
van Dun, P. L. S., Arcuri, L., Verbeeck, J., Esteves, J. E., Cerritelli, F.
PLoS One, 2022/11
Free full text

1359

Physiotherapists and Osteopaths' Attitudes: Training in Management of Temporomandibular Disorders
Saran, S., Saccomanno, S., Petricca, M. T., Carganico, A., Bocchieri, S., Mastrapasqua, R. F., Caramaschi, E., Levrini, L.
Dentistry Journal, 2022/11
Free full text


1361

Osteopathic Manipulative Medicine for Chronic Pain in the Setting of Cerebral Palsy
Dixon, D. S., Elwert, N. C., McDermott, G. A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/11

1362

A Systematic Review on Spinal Asymmetries in Case Studies of Unilateral Nephroptosis from a Viscerosomatic Point of View
Oliva-Pascual-Vaca, Á, Castillo-Cañuelo, M. J., Oliva-Pascual-Vaca, J., Pérez-Montalbán, M., Ordonez, F. J., Martínez-Fernández, J. A.
Healthcare, 2022/11
Free full text

1363

Podiatric Medical Resident Wellness: A Group Survey Study
Deheer, P. A., Wolfe, W., Nichols, J. A., Badell, B. J., Patel, N. A.
Journal of the American Podiatric Medical Association, 2022/11

1364

Osteopathy: effectiveness and safety for musculoskeletal pain and overview of training and quality requirements. AIHTA Project Report No.: 144 2022
Gassner, L., Hofer, V.
HTA Austria – Austrian Institute for Health Technology Assessment GmbH, 2022/11
Free full text

1365

Promoting cultural competency and osteopathic medicine awareness among premedical students through a summer premedical rural enrichment program
Kadavakollu, S., Lund, K. S., Swamy, V., Kim, W. D., Llenado, R. A., Nunes, T. F., Qureshi, M., Graneto, J. W., Boyanovsky, B. B.
Journal of Osteopathic Medicine, 2022/11
Free full text

1366

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/11
Free full text

1367

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11

1368

Model-Base Estimation of Non-Invasive Ventilation Weaning of Preterm Infants Exposed to Osteopathic Manipulative Treatment: A Propensity-Score-Matched Cohort Study
Tarantino, A. G., Vismara, L., Buffone, F., Bianchi, G., Bergna, A., Vanoni, M., Tabbi, C., Bresesti, I., Agosti, M.
Healthcare, 2022/11
Free full text

1369

Comments on “Reported completion of the USMLE Step 1 and match outcomes among senior osteopathic students in 2020“
Boulet, J. R., Gimpel, J. R., Sandella, J. M., Turner, M. D.
Journal of Osteopathic Medicine, 2022/10
Free full text

1370

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text

1371

The Profile of Belgian Osteopaths: A Cross-Sectional Survey
van Dun, P. L. S., Verbeeck, J., Arcuri, L., Esteves, J. E., Cerritelli, F.
Healthcare, 2022/10
Free full text

1372

Multisite assessment of emergency medicine resident knowledge of evidence-based medicine as measured by the Fresno Test of Evidence-Based Medicine
Katsilometes, J., Galuska, M., Kraus, C. K., Levitin, H. W., Leuchten, S., Daugherty-Luck, J., Lata, J., Brannan, G., Santarelli, A., Ashurst, J.
Journal of Osteopathic Medicine, 2022/10
Free full text

1373

The Benefits of Integrative Medicine in the Management of Chronic Pain: A Review
Trivedi, H., Avrit, T. A., Chan, L., Burchette, M., Rathore, R.
Cureus, 2022/10
Free full text

1374

Response to “Comments on 'Reported completion of the USMLE Step 1 and match outcomes among senior osteopathic students in 2020'“
Nikolla, D. A., Stratford, C. V., Bowers, K. M.
Journal of Osteopathic Medicine, 2022/10
Free full text

1375

Effect of osteopathic techniques on human resting muscle tone in healthy subjects using myotonometry: a factorial randomized trial
Bohlen, L., Schwarze, J., Richter, J., Gietl, B., Lazarov, C., Kopyakova, A., Brandl, A., Schmidt, T.
Scientific Reports, 2022/10
Free full text

1376

Effects of osteopathic manipulative treatment of the pivots on lower limb function in young professional football players
Thomas, E., Petrucci, M., Barretti, M., Messina, G., Cavallaro, A. R., Bianco, A.
Journal of Bodywork and Movement Therapies, 2022/10

1377

Osteopathic manipulative treatment use among family medicine residents in a teaching clinic
Caldwell, G., Zeng, L., Kaufman, J., Bates, J.
Journal of Osteopathic Medicine, 2022/10
Free full text

1378

Postoperative Osteopathic Manipulative Treatment in Children with Esophageal Atresia: Potential Benefits on the Anthropometric Parameters
Manzotti, A., Alati, A., Galli, M., Cerritelli, F., Leva, C., Alberti, A., Stizzoli, A., Costanzo, S., Canonica, C. P. M., Destro, F., Zuccotti, G., Calcaterra, V., Pelizzo, G.
Pediatric Reports, 2022/10


1380

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09

1381

Further insight on AOA ophthalmology residency program closure data
Bradshaw, J. T., Gawrys, S. P., Wong, W. J., Parker, L. M.
Journal of Osteopathic Medicine, 2022/09
Free full text

1382


1383



1385

UGRC 2021 recommendations on GME transition: pros and cons, opportunities and limitations
Gimpel, J. R., Swails, J. L., Bienstock, J. L., Lin, G. L., Roett, M. A., Patel, J. K., Giang, D. W.
Journal of Osteopathic Medicine, 2022/09
Free full text


1387

A Thematic Analysis of Osteopathic Physicians' Identities and Experiences in North American Professional Sports
Blacha, K., Cade, A., Russell, T., Skinner, D.
Open Access Journal of Sports Medicine, 2022/09
Free full text

1388

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text

1389

Efectividad del tratamiento osteopático en la plagiocefalia
(Effectiveness of osteopathic treatment for plagiocephaly)
Gamarra Herraiz, L.
European Journal Osteopathy & Related Clinical Research, 2022/09
Free full text











1400

The utilisation and attitudes to patient reported outcome measures by Australian osteopaths: A cross sectional study
Fleischmann, M., Fryer, G
International Journal of Osteopathic Medicine, 2022/09

1401

Case Report on Visceral Manipulation in Adolescent Idiopathic Scoliosis
Chahab, M., Donnet, P., Hernandez, D.
International Journal of Therapeutic Massage and Bodywork, 2022/09

1402

Osteopathic Medical Students’ Subjective Preparedness for LGBTQ+ Patient Care and Influencing Factors: A Multi-Institutional Survey Study
Morimoto, K., Uy, J. C., Blair, L., Barab, H., Wu, W., Oosterbaan, C., Ozdowski, L., Guenther, E.
The AAO Journal, 2022/09
Free full text



1405

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09


1407

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09





1412

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text

1413

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/09

1414

Comparing In-person vs. Live-streamed Osteopathic Manual Medicine Lab Instruction
Ellis, M., Finneran, K., Jie, C., Lewis, D.
The AAO Journal, 2022/09
Free full text

1415

Osteopathic Manipulative Treatment for Optic Pathway Glioma
Gordon, S., Hagopian, S.
The AAO Journal, 2022/09
Free full text

1416

Treatment of infant colic with craniosacral therapy. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/09
Free full text

1417

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text


1419

The Predictive Value of the Residency AOBFP In-Service Exam, Produced and Administered by ACOFP
Torres, J. W., Bowling, J. R., Zipp, C., Williams, N., Sandella, J. M., Martinez, L., Moore, B.
Family Medicine, 2022/09
Free full text

1420

Efectividad del tratamiento osteopático en pacientes con migraña
(Effectiveness of osteopathic treatment in patients with migraine)
Insausti, P. J.
European Journal Osteopathy & Related Clinical Research, 2022/09
Free full text

1421

Thoracic outlet syndrome due to first rib subluxation in a 69-year-old woman
Deveze, E., Daligault, M., Ammi, M., Picquet, J.
Annals of Vascular Surgery - Brief Reports and Innovations, 2022/09
Free full text

1422

Response to “Further insight on AOA ophthalmology residency program closure data“
Ahmed, H., Vo, K., Robbins, W.
Journal of Osteopathic Medicine, 2022/09
Free full text

1423

Student Attitudes About Osteopathic Medical Schools: Increasing Student Willingness to Apply
Mattiace, S. M.
Unpublished Dissertation, 2022/08
Free full text

1424

Investigating the safety and feasibility of osteopathic medicine in the pediatric oncology outpatient setting
Belsky, J. A., Stanek, J. R., Rose, M. J.
Journal of Osteopathic Medicine, 2022/08
Free full text

1425

Effectiveness of osteopathic interventions in patients with non-specific neck pain: A systematic review and meta-analysis
Dal Farra, F., Buffone, F., Risio, R. G., Tarantino, A. G., Vismara, L., Bergna, A.
Complementary Therapies in Clinical Practice, 2022/08

1426

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text

1427

“What you feel under your hands“: exploring professionals' perspective of somatic dysfunction in osteopathic clinical practice-a qualitative study
Arcuri, L., Consorti, G., Tramontano, M., Petracca, M., Esteves, J. E., Lunghi, C.
Chiropractic & Manual Therapies, 2022/08
Free full text


1429

Osteopathic Treatment for Gastrointestinal Disorders in Term and Preterm Infants: A Systematic Review and Meta-Analysis
Buffone, F., Monacis, D., Tarantino, A. G., Farra, F., Bergna, A., Agosti, M., Vismara, L.
Healthcare, 2022/08
Free full text

1430

The Role of Osteopathic Care in Gynaecology and Obstetrics: An Updated Systematic Review
Ruffini, N., D', Alessandro, G., Pimpinella, A., Galli, M., Galeotti, T., Cerritelli, F., Tramontano, M.
Healthcare, 2022/08
Free full text

1431

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08

1432

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text

1433

Cranial osteopathic techniques and electroencephalogram (EEG) alpha power: a controlled crossover trial
Cella, M., Acella, E., Aquino, A., Pisa, V.
Journal of Osteopathic Medicine, 2022/08
Free full text


1435

Osteopathic Manipulative Treatment and the Management of Headaches: A Scoping Review
Jara Silva, C. E., Joseph, A. M., Khatib, M., Knafo, J., Karas, M., Krupa, K., Rivera, B., Macia, A., Madhu, B., McMillan, M., Burtch, J., Quinonez, J., Albert, T., Khanna, D.
Cureus, 2022/08
Free full text

1436

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/08
Free full text

1437

Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine
Sookaromdee, P., Wiwanitkit, V.
Journal of Osteopathic Medicine, 2022/08
Free full text

1438

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08

1439

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07

1440

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text

1441

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text

1442

Reported completion of the USMLE Step 1 and match outcomes among senior osteopathic students in 2020
Nikolla, D. A., Stratford, C. V., Bowers, K. M.
Journal of Osteopathic Medicine, 2022/07
Free full text

1443

Osteopathic Manipulative Treatment for Pediatric Conditions: An Update of Systematic Review and Meta-Analysis
Posadzki, P., Kyaw, B. M., Dziedzic, A., Ernst, E.
Journal of Clinical Medicine, 2022/07
Free full text


1445

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07


1447

Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects
Gawrys, S. P., Bradshaw, J. T., Parker, L. M.
Journal of Osteopathic Medicine, 2022/07
Free full text

1448

Osteopathic practice in the United Kingdom: A retrospective analysis of practice data
Plunkett, A., Fawkes, C., Carnes, D.
PLoS One, 2022/07
Free full text

1449

Successful Osteopathic Manipulative Treatment of Foot Drop
Tafler, L., Katz, V., Kolesnikov, V., Singh, R.
Cureus, 2022/07
Free full text

1450

Reduction and Resolution of a Hiatal Hernia Using Osteopathic Manipulative Treatment: A Case Report
Volokitin, M., Song, A., Peck, M. T., Milani, S.
Cureus, 2022/07
Free full text

1451

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07

1452

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07


1454

Effectiveness of osteopathic manipulative treatment for pediatric conditions: A systematic review
Franke, H, Franke, J.D., Fryer, G.
Journal of Bodywork and Movement Therapies, 2022/07



1457

Im Gespräch mit … Christian Hartmann
(In dialog with ... Christian Hartmann)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07



1460

Osteopathic Manipulative Treatment for Refractory Gastroesophageal Reflux Disease (GERD)
Yassin, K., Mutter, C., Waters, H., Mehra, R.
The AAO Journal, 2022/06
Free full text

1461


1462

The Effect of Osteopathic Manipulative Treatment in Pregnancy on Labor Duration: A Meta-Analysis
Zak, A., Streeter, E., Tran, N., Wales, A., Yep, M., Rowane, M.
The AAO Journal, 2022/06
Free full text

1463

Osteopathic medical students’ understanding of race-based medicine
Jivens, M., Okafor, I., Beverly, E. A.
Journal of Osteopathic Medicine, 2022/06
Free full text



1466

Efectividad del tratamiento osteopático en el estrés
(Effectiveness of osteopathic treatment for stress)
Ramírez López, A.
European Journal Osteopathy & Related Clinical Research, 2022/06
Free full text



1469

Chronic cough as seen by allergy specialists: An internet survey of providers in a large nation-wide practice
Prenner, Bruce M., Topp, Robert, McCan, William A.
Allergy and Asthma Proceedings, 2022/06






1475

Osteopathy and physiotherapy compared to physiotherapy alone on fatigue in long COVID: Study protocol for a pragmatic randomized controlled superiority trial
Certain Curi, A. C., Antunes Ferreira, A. P., Calazans Nogueira, L. A., Mello Meziat Filho, N. A., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2022/06
Free full text





1480

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text



1483

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06


1485


1486

Osteopathic Evaluation and Positional Plagiocephaly: A Descriptive Study on a Population of Children with ASD
Di Renzo, M., Laurenti, A., Di Castelbianco, F. B., Vanadia, E., Petrillo, M., D’Errico, S., Ferrara, R., Racinaro, L., Rea, M.
American Journal of Pediatrics, 2022/06
Free full text

1487

Comparison of the Effect of Osteopathic Manipulations and Exercises on the Myoelectric Activity of the Pelvic Floor: A Randomized Controlled Trial
Arcanjo, G. N., Pires, Jlvr, Jacinto, M. E. M., Colares, J. M., Belo, L. M. C., Lima, P. O. P., Vilaça-Alves, J.
Journal of Chiropractic Medicine, 2022/06

1488

Adjunctive osteopathic therapy for hospitalized COVID-19 patients: A feasibility-oriented chart review study with matched controls
Lennon, R. P., Dong, H., Zgierska, A. E., Demetriou, T., Croad, J., Livelsberger, C., Hodge, L., Mendez-Miller, M., Darby, A., Rabago, D.
International Journal of Osteopathic Medicine, 2022/06

1489

Tongue stretching: technique and clinical proposal
Buscemi, A., Coco, M., Rapisarda, A., Frazzetto, G., Di Rosa, D., Feo, S., Piluso, M., Presente, L. P., Campisi, S. S., Desirò, P.
Journal of Complementary and Integrative Medicine, 2022/06
Free full text

1490

Effect of Physique on Medical Students’ Perceived Physical Ability to Perform Osteopathic Manipulative Treatment (OMT)
Than, S., Santos, L., Lin, X., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text

1491

Medical student research opportunities: a survey of osteopathic medical schools in the United States
Hamby, T., Wilson, D. P., Bui, P., Lowery, J., Basha, R.
Journal of Osteopathic Medicine, 2022/06
Free full text



1494

To the Editor: Limitations and Alternative Solutions to a USMLE COMLEX-USA Concordance
Jurich, D., Liu, C., Clauser, A.
Journal of Graduate Medical Education, 2022/06
Free full text

1495

To the Editor: Response to: Limitations and Alternative Approaches to a USMLE COMLEX-USA Concordance
Sandella, J., Boulet, J., Barnum, S., Tsai, T. H., Wang, Y.
Journal of Graduate Medical Education, 2022/06
Free full text

1496

Abnormal Foot Progression Angle Kinematics in Cervical Dystonia Improved After Osteopathic Manipulative Medicine: A Prospective Case Series
Mancini, J., Oliff, Z., Abu-Sbaih, R., Simone, J., LaRosa, A., Mody, S., Li, T. S., Leder, A.
Cureus, 2022/06
Free full text

1497

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text


1499

A long COVID patient and their experience of osteopathic care: A case report
Monro, M.
International Journal of Osteopathic Medicine, 2022/06

1500

Professional identity in osteopathy: A scoping review of peer-reviewed primary osteopathic research
Phillips, A. R.
International Journal of Osteopathic Medicine, 2022/06
Free full text







1507

Response to Osteopathic Manipulative Treatment in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
Bomani-Bailey, A., Xu, T., Ettlinger, H.
The AAO Journal, 2022/06
Free full text

1508

Variations in Average Cranial Rhythmic Impulse Rates
Crider, T., Grimm, J., Kozar, A., Tobey, A. H.
The AAO Journal, 2022/06
Free full text

1509

An Osteopathic Approach to Secondary Enuresis and Encopresis: Recovering Autonomic Stability
Goodman, F., Ammons, R., Gebhardt, G., Largent, J.
The AAO Journal, 2022/06
Free full text

1510

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

1511

SCIWORA: A Pediatric Case
Masterson, C., Byrd, A., Gebhardt, G.
The AAO Journal, 2022/06
Free full text



1514

A Randomized Pilot Study Comparing Bilirubin Levels of Newborns Treated with Osteopathic Manipulative Treatment (OMT) Versus Routine Newborn Care Alone
Stephenson, C. M., Fremarek, N., Lentz, A., Klene-Bowns, A., Boeve, M., Brinsky, K., Chatterley, L., Yarling, C., Caldwell, G., Grundwaldt, D.
The AAO Journal, 2022/06
Free full text


1516

The Effects of a Novel Virtual Reality Osteopathic Manipulative Medicine Program on First Year Practical Exam Scores
Ahmed, E., Jose, J., Stout, R., Yao, S. C.
The AAO Journal, 2022/06
Free full text

1517

Augmentation of Immune Response to COVID-19 mRNA Vaccination Through Osteopathic Manipulative Treatment
Ahn, B., Martinez, E., Hadiprodjo, H., Jackson, C., Gutierrez, M., Crone, P., Loveless, B., Fuchs, S., Szurmant, H., Sanchez, J.
The AAO Journal, 2022/06
Free full text

1518

Utilizing Osteopathic Manipulative Techniques to Mitigate Fall Risk Among Hospitalized Elderly Patients: A Literature Review
Arshad, U., Baum, B., Carter, R., Gustowski, S.
The AAO Journal, 2022/06
Free full text

1519

Upper Cross Syndrome and a Guarded Heart: Posture in a Case of Depression
Benzell, J. A., Abend, D., Bailey, J., Cooley, D., King Channell, M.
The AAO Journal, 2022/06
Free full text

1520

Osteopathic Manipulative Treatment of Individual with Intractable Singultus
Bloch, R., Kempa, M., Lippert, J.
The AAO Journal, 2022/06
Free full text

1521

SOAP Note Review: Evaluating Osteopathic Principles and Practice in Clinical Education
Budny, B., Gigliotti, D., Diggs, B., Fotopoulos, T., Johns, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text

1522

An Osteopathic Approach to Chronic Pelvic Pain
Cameron, D. L., Mainville, M., Wallace-Ross, J.
The AAO Journal, 2022/06
Free full text

1523

Effects of Osteopathic Manipulative Treatment (OMT) on Anosmia and Ageusia in Post-COVID-19 Patient: A Case Report
Companion, N., Ventimiglia, M., Yao, S. C.
The AAO Journal, 2022/06
Free full text


1525

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

1526

Relief of Post-COVD-19 Burning Mouth Syndrome (BMS) with OMM- A case study
Frankini, E. L., Leder, A., Yao, S. C.
The AAO Journal, 2022/06
Free full text

1527

Blended Learning: Evaluating the effectiveness of various instructional methods
Garo, J. A., Dasar, Y., Nichols, M., Goering, E., Blumer, J.
The AAO Journal, 2022/06
Free full text


1529

Body-Mind-Spirit Connection as an Approach to Treatment of Spasmodic Torticollis
Haley, L., Clark, M., Litman, R., Heller, G.
The AAO Journal, 2022/06
Free full text

1530

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text

1531

Osteopathic Manipulative Treatment may be a Cost-Effective Approach to Reducing Pain Associated with Acute Flare of Interstitial Cystitis
Hermann, S. J., Barnett, M. E., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text

1532

Effects of Osteopathic Manipulative Therapy on Temporomandibular Joint Disorders
Honeyman, J., Robke, B., Reed, G., Jacob, L., O'Donnell, M., Lynch, W. D., Moore, W.
The AAO Journal, 2022/06
Free full text

1533

Out of Place: An Osteopathic Approach to Recurrent Shoulder Dislocations in an Ehlers Danlos Patient
Lambros, S., Tuyn, D., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text

1534

Effect of Medical School Experiences on Perceived Likelihood of Performing Osteopathic Manipulative Treatment (OMT) in Future Practice
Lin, X., Santos, L., Than, S., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text

1535

Managing Muscle Rigidity: An Osteopathic Approach to the Treatment of Stiff Person Syndrome
Mainville, M., Cameron, D. L., Barry, P.
The AAO Journal, 2022/06
Free full text

1536

Osteopathic Manipulative Treatment of the Deep Fascia for the Treatment of Chronic Trauma-induced Somatic Dysfunction
Nelson, C., Henderson, J., Kim, C., Le, B., Mintier, K.
The AAO Journal, 2022/06
Free full text


1538

An Osteopathic Approach to Childhood Scoliosis and Leg Length Inequality in a Pediatric Patient with Chiari I Malformation
Schultz, R., Baig, Y., Henderson, K. K., Heinking, K. P.
The AAO Journal, 2022/06
Free full text

1539

Establishing OMT as a Key Treatment Modality in Injury Rehabilitation: Teres Major Tear
Shah, N., Cortes, M., Posey, A.
The AAO Journal, 2022/06
Free full text

1540

Novel Lymphatic Counterstrain (LC) in a Case of Low Ankle Sprain
Trinh, D., Henderson, J., Goering, E.
The AAO Journal, 2022/06
Free full text

1541

Uncovering Trigger Points Masked by Lumbar Radiculopathy
Tuyn, D., Lambros, S., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text

1542

“Skateboard to the Head” A Case of Persistent Headaches Following Blunt Eye Trauma
Williams, D., Richie, C.
The AAO Journal, 2022/06
Free full text

1543

Restricted Shoulder Range of Motion: A Neglected Component That May Surprise You
Williams, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text

1544

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text

1545

Complementary medicine visits by palliative care patients: a cross-sectional survey
Steel, Amie, Schloss, Janet, Diezel, Helene, Palmgren, Per J., Maret, Jean Baptiste, Filbet, Marilène
BMJ Supportive and Palliative Care, 2022/05

1546

Cross-Sectional Study of Osteopathic General Surgeons in University-Based General Surgery Departments
Khan, M. T., Patnaik, R., Wheeler, C., Ibrahim, M., Wolf, H., Baumgardner, K. C., Lovely, R. S.
Cureus, 2022/05
Free full text

1547

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text

1548

Advocacy for Change: An Osteopathic Review of Traumatic Brain Injury Among Combat Veterans
Pendlebury, G. A., Oro, P., Haynes, W., Byrnes, T. R., Keane, J., Goldstein, L.
Cureus, 2022/05
Free full text

1549

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text

1550

The Effect of Clinical Anatomy Integration on Medical Student Academic Performance and Learning Approach
Stoudemire, Claire, Terrell, Mark, McCarthy, Sarah, Gulati, Raj, Fonner, Christopher, Kulesza, Randy
FASEB journal, 2022/05
Free full text


1552

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text

1553

Effect of osteopathic manipulation of the sacroiliac joint vs electrotherapy on pain and functional disability in patients with low back pain: A pilot study
Rodríguez-Pastor, J. A., Caro-Puértolas, B., Caña-Pino, A., Sánchez-Preciado, A. M., Garrido-Ardila, E. M., Apolo-Arenas, M. D.
Journal of Back and Musculoskeletal Rehabilitation, 2022/05

1554

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05

1555

Association of sleep quality and chronification of musculoskeletal pain in an older adult: A case report
Westendorp, R., Thaker, V., Srbely, J.
International Journal of Osteopathic Medicine, 2022/05

1556

Parental leave in medical school: supporting students as parents
Ortega, S. R., Barnes, J. M., Waller, J. D.
Journal of Osteopathic Medicine, 2022/05
Free full text

1557

Assessing the United States' most frequently asked questions about osteopathic medicine, osteopathic education, and osteopathic manipulative treatment
Sajjadi, N. B., Ottwell, R., Shepard, S., Bray, N., Dyer, R., Wilson, J., Vassar, M., Hartwell, M.
Journal of Osteopathic Medicine, 2022/05
Free full text

1558

Effects of osteopathic manipulative treatment vs. osteopathic cranial manipulative medicine on Parkinsonian gait
Terrell, Z. T., Moudy, S. C., Hensel, K. L., Patterson, R. M.
Journal of Osteopathic Medicine, 2022/05
Free full text



1561

An updated brief overview on post-traumatic headache and a systematic review of the non-pharmacological interventions for its management
Argyriou, A. A., Mitsikostas, D. D., Mantovani, E., Litsardopoulos, P., Panagiotopoulos, V., Tamburin, S.
Expert Review of Neurotherapeutics, 2022/04
Free full text

1562

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text

1563

Osteopathy as a complementary/alternative medicine for breast cancer: a Canadian case study and comprehensive review
Fortin, J., Beaupré, A., Thamar Louis, L. A., Roy, C.A., Bourque, M. A., Cappeliez, S., Fadhlaoui, A.
Breast Cancer Management, 2022/04
Free full text

1564

Incidence Rate of Somatic Dysfunction in Previously Undiagnosed Spotted Fever Rickettsiosis: A Case Report
Unger, M. D., Palmer, J. L., Thorsvik, N. M.
Cureus, 2022/04
Free full text

1565

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text




1569

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text

1570

Store-and-forward teledermatology impact on diagnosis, treatment and dermatology referrals: Comparison between practice settings
Pasadyn, S. R., McAfee, J. L., Vij, A., Warren, C. B.
Journal of Telemedicine and Telecare, 2022/04

1571

Attracting Medical Students to Family Medicine: An Historical View
Young, R. A., Tinger, S.
Family Medicine, 2022/04
Free full text

1572

Comparative assessment of osteopathy technique with manual therapy associated with biofeedback in patients with the lumbar spine pain.
Mańko, G., Jekiełek, M., Sosulska, A., Pieniążek, M., Jaszczur-Nowicki, J.
Medical Rehabilitation, 2022/04
Free full text


1574

Retention of tissue texture change after cervical muscle energy and high velocity low amplitude intervention: implications for treatment intervals
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2022/04
Free full text


1576

A Review of Glymphatics and the Impact of Osteopathic Manipulative Treatment in Alzheimer's Disease, Concussions, and Beyond
Marino, M. A., Petrova, S., Sweiss, R., Duong, J., Miulli, D. E.
Cureus, 2022/03
Free full text

1577

A Content Analysis of Osteopaths' Attitudes for a More Inclusive Clinical Practice towards Transgender People
Baldin, I., Esteves, J. E., Tramontano, M., Macdonald, M., Baroni, F., Lunghi, C.
Healthcare, 2022/03
Free full text

1578

Eficacia del tratamiento osteopático en el estreñimiento crónico
(Effectiveness of osteopathic treatment for chronic constipation)
Cabello Romero, E.
European Journal Osteopathy & Related Clinical Research, 2022/03
Free full text


1580

Efectos de la osteopatía en pacientes con fibromialgia
(Effects of osteopathy on patients with fibromyalgia)
Hormigo Navarro, R.
European Journal Osteopathy & Related Clinical Research, 2022/03
Free full text



1583

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text

1584

Student Perception of an OMM Virtual Practical Examination: In the Setting of Social Distancing
Berenbeim, G., Metzler, I., Lewis, D., Jie, C.
The AAO Journal, 2022/03
Free full text








1592

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text

1593

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text


1595

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

1596

Study to assess existing knowledge of headache disorders among registered osteopaths practising in the UK: A cross-sectional survey
Huzzey-Cunningham, E., McWilliam, M., Mahtani, V., Bridge, H., Breukel, C., Schytz, H. W., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2022/03

1597

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03

1598

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text

1599

Patellofemoral pain syndrome: a review of the literature with osteopathic emphasis
Balint, T., Jones, J., Paquette, M., Amalfitano, J.
The AAO Journal, 2022/03
Free full text


1601

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text

1602

Efficacy and Feasibility of an Osteopathic Intervention for Neurocognitive and Behavioral Symptoms Usually Associated With Fetal Alcohol Spectrum Disorder
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., García-Algar, Ó.
Frontiers in Behavioral Neuroscience, 2022/03
Free full text

1603

Should person-centredness care be an affordable goal in French osteopathic education?
Salmon, M., Cretal, A., Gonzales-Bandres, M.
International Journal of Osteopathic Medicine, 2022/03
Free full text

1604

The Portuguese Osteopathic Practitioners Estimates and RAtes (OPERA): A cross-sectional survey
Santiago, R. J., Nunes, A., Esteves, J. E., Cerritelli, F., Verbeeck, J., Lopes, S., Paquete, M., van Dun, P.
International Journal of Osteopathic Medicine, 2022/03

1605

A Concordance Study of COMLEX-USA and USMLE Scores
Barnum, S., Craig, B., Wang, X., Sandella, J., Tsai, T.H., Boulet, J., Wang, Y.
Journal of Graduate Medical Education, 2022/03
Free full text


1607

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

1608

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

1609

In bestimmter Weise auf jemanden wirken …
(To affect someone in a certain way...)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03






1615

Efeitos da abordagem osteopática em neonatos com dificuldade na biomecânica da amamentação: ensaio clínico randomizado
(Effects of the osteopathic approach in neonates with difficulties in the biomechanics of breastfeeding: a randomized clinical trial)
Barros, R. C. T., Vilagra, J. M., Taglietti, M., Tori, F.S., Cagnini, T. L., Camilo, J.M., Grando, F., Abico, R. M., Abico, S. T.
Research, Society and Development, 2022/03
Free full text


1617




1620

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text

1621

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02

1622

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text


1624

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text

1625

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02

1626

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text

1627

Advances in the therapeutic approach of pudendal neuralgia: a systematic review
Murer, S., Polidori, G., Beaumont, F., Bogard, F., Polidori, E., Kinne, M.
Journal of Osteopathic Medicine, 2022/01
Free full text

1628

The rationale for including osteopathic manipulative treatment in the management of infections: a hermeneutic review
Lesho, E., McKeown, A., Laguio-Vila, M.
Expert Review of Anti-Infective Therapy, 2022/01
Free full text

1629

International Overview of Somatic Dysfunction Assessment and Treatment in Osteopathic Research: A Scoping Review
Tramontano, M., Tamburella, F., Farra, F., Bergna, A., Lunghi, C., Innocenti, M., Cavera, F., Savini, F., Manzo, V., D', Alessandro, G.
Healthcare, 2022/01
Free full text


1631

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text

1632

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text



1635

20/20 Vision
Finch, T.
Health Communication, 2022/01
Free full text

1636

Neurogenic Bowel Dysfunction Changes after Osteopathic Care in Individuals with Spinal Cord Injuries: A Preliminary Randomized Controlled Trial
Tamburella, F., Princi, A. A., Piermaria, J., Lorusso, M., Scivoletto, G., Masciullo, M., Cardilli, G., Argentieri, P., Tramontano, M.
Healthcare, 2022/01
Free full text

1637

The immediate effect of thoracolumbar manipulation and diaphragmatic release on inspiratory muscle strength in healthy smokers: A randomized clinical trial
Albarrati, A., Taher, M., Nazer, R., Alshameri, T.
Journal of Back and Musculoskeletal Rehabilitation, 2022/01

1638

Relationship between osteopathic manipulative treatment of the temporomandibular joint, molar shim and the orthostatic position: A randomized, controlled and double blinded study
Detoni, R., Heartz, C. S., Fusatto, E. L., Bicalho, E., Nacimento-Moraes, K. S. G., Rizzatti-Barbosa, C. M., Lopes, F. O. T.
Journal of Bodywork and Movement Therapies, 2022/01
Free full text

1639

Osteopathic treatment in addition to standard care in patients with Gastroesophageal Reflux Disease (GERD) – A pragmatic randomized controlled trial
Lynen, A., Schömitz, M., Vahle, M., Jäkel, A., Rütz, M., Schwerla, F.
Journal of Bodywork and Movement Therapies, 2022/01

1640

Cranial manipulation affects cholinergic pathway gene expression in aged rats
Anandakrishnan, R., Tobey, H., Nguyen, S., Sandoval, O., Klein, B. G., Costa, B. M.
Journal of Osteopathic Medicine, 2022/01
Free full text

1641

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01

1642

Lymphatic osteopathic manipulative treatment reduces duration of deltoid soreness after Pfizer/BioNTech COVID-19 vaccine
Marshall, S., Winter, S., Capobianco, J. D.
Journal of Osteopathic Medicine, 2022/01
Free full text



1645


1646

The Effect of Pedal Pump Lymphatic Technique Versus Passive Recovery Following Maximal Exercise: A Randomized Cross-Over Trial
DiFrancisco-Donoghue, J., Chan, T., Jensen, A. S., Docherty, J. E. B., Grohman, R., Yao, S. C.
Sports Medicine - Open, 2022/01
Free full text


1648

Results of a feasibility randomised controlled trial of osteopathy on neck-shoulder pain in computer users
Santiago, R. J., Esteves, J. E., Baptista, J. S., Magalhães, A., Costa, J. T.
Complementary Therapies in Clinical Practice, 2022/01
Free full text




1652

Undergraduate pre-requisite coursework: Six important tips for pre-medical students considering Osteopathic Medical school in the USA
Kadavakollu, S., Moullet, Z., Yoshida, M., Qureshi, M., Graneto, J., Boyanovsky, B.
International Journal of Osteopathic Medicine, 2021/12

1653

Erratum to “The legacy and implications of the body-mind-spirit osteopathic tenet: A discussion paper evaluating its clinical relevance in contemporary osteopathic care” [Int J Osteopath Med 41 (2021) 57–65]
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/12
Free full text

1654

Mini-medical school programs decrease perceived barriers of pursuing medical careers among underrepresented minority high school students
Abdulrazzak, A., Chandler, A., Lu, R., Mobarakai, O., Lebron, B., Ingram, N., Sheth, A., Patel, N., Parikh, S., Kumar, R., Bedi, J., Diaw, N. K., Abonamah, A., Lomiguen, C., Fanning, S. L.
Journal of Osteopathic Medicine, 2021/12
Free full text

1655

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text

1656

Adaptation and validation of the SEGUE checklist to assess osteopathy students' clinical communication skills
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2021/12

1657

Letter to the Editor - Osteopathic manipulative techniques for management of Huntington's disease
Rohani, B., Newland, H., Agustines, D.
International Journal of Osteopathic Medicine, 2021/12




1661

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12

1662

Osteopathic Manipulation of the Sphenopalatine Ganglia Versus Sham Manipulation, in Obstructive Sleep Apnoea Syndrom: A Randomised Controlled Trial
Attali, V., Jacq, O., Martin, K., Arnulf, I., Similowski, T.
Journal of Clinical Medicine, 2021/12
Free full text







1669

Perceptions of COVID-19 vaccines among osteopathic medical students (OMS)
Al Janabi, T., Chinsky, R., Pino, M. A.
International Journal of Osteopathic Medicine, 2021/12
Free full text


1671

Epidemiology, common diagnoses, treatments and prognosis of shoulder pain: A narrative review
Hodgetts, C., Walker, B.
International Journal of Osteopathic Medicine, 2021/12

1672

Pain knowledge and fear-avoidance beliefs of French osteopathy students and educators towards chronic low back pain: An osteopathic educational institution-based cross-sectional survey
Mhadhbi, H., Thierry-Hildenbrand, B., Draper-Rodi, J., Esteves, J. E., Ménard, M.
International Journal of Osteopathic Medicine, 2021/12


1674

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: Protocol for systematic review and meta-analysis
Rehman, Y., Kirsch, J., Bhatia, S., Johnston, R., Bingham, J., Senger, B., Swogger, S., Snider, K. T.
International Journal of Osteopathic Medicine, 2021/12

1675


1676

OMM alters chronic ethanolinduced changes to VTA GABA neurons, NAc DA release and measures of withdrawal in rats
Bills, K., Small, C., Otteson, D., Jones, G., Steffensen, S.
Journal of Osteopathic Medicine, 2021/12

1677

Serum osteocalcin in the osteopathic treatment for motor function in Parkinson’s Disease
Gupta, S., Lamba, S., Yao, S. C., Mancini, J.
Journal of Osteopathic Medicine, 2021/12

1678

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

1679

Factors Influencing Osteopathic Medical Students’ Decision to Pursue a Surgical Specialty
Keever, K., Kiernan, R. N., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12

1680

Factors Affecting Osteopathic Medical Students’ Specialty Choice in Light of a Future Pass/Fail COMLEX Level 1 and USMLE Step 1
Kiernan, R. N., Keever, K., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12

1681

Understanding medical student perspectives in virtual osteopathic manipulative medicine education during the COVID pandemic
Liu, T., Torrents, M., Sharma, S., Burke, D., Giovanis, A.
Journal of Osteopathic Medicine, 2021/12

1682

Assessing usage and perceptions of osteopathic manipulative treatment (OMT) and self-identity among osteopathic physicians
Mangla, M., Asif, S., Asif, S., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

1683

A Pilot Study to Examine Medical Students’ Perception of their Osteopathic Manipulative Therapy Education
Mazzi, J., Leavitt, N., Kisby, G.
Journal of Osteopathic Medicine, 2021/12

1684

Patient Perception of Clinical Trials With and Without Osteopathic Manipulative Treatment During the COVID-19 Pandemic
Nikakis, J., Singh Arora, U., Wang, L., Abramowitz, C., Malkov, D., Cohen, T. J.
Journal of Osteopathic Medicine, 2021/12

1685

Improving Upon Osteopathic Palpatory Skills using a 3D Printed Rotational Lumbar Spine Model
Rey, T., Thomas, A., Nolin, J., Sanders, J. G., Cedoz, K., Berwick, R.
Journal of Osteopathic Medicine, 2021/12

1686

The Importance of Dermatology Education During Osteopathic Preclerkship Curriculum
Tan, V., Schukow, C., Vitale, V., Restini, C.
Journal of Osteopathic Medicine, 2021/12


1688

Correction: Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/12
Free full text

1689

An Osteopathic Approach to Complex Regional Pain Syndrome (CRPS)
Deol, N., Nuño, V., Schuman, M., Contreras, C.
The AAO Journal, 2021/12
Free full text

1690

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text

1691

MD and DO: Differing Medical Degrees and the Associated Perceptions
Harfouch, N., Grunhut, J., Hsu, A., Pinsky, S., Chacko, J., Raden, M., Slanetz, P. J., Sarkany, D.
Current Problems in Diagnostic Radiology, 2021/11

1692

A comparative study of the effectiveness of an osteopathic primary care sports medicine led intervention on performance in men's collegiate lacrosse players
Rao, N. C., Zwibel, H., Berezanskaya, J., Pena, P., Jung, M. K.
Journal of Osteopathic Medicine, 2021/11
Free full text

1693

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text


1695

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text

1696

Effect of joint manipulation and muscle energy technique in patients with Chronic Obstructive Pulmonary Disease: A review
Bains, D., Goyal, M., Chahal, A., Shaphe, M. A.
Annals of Clinical and Analytical Medicine, 2021/11
Free full text

1697

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11

1698

Fast improvements in functional status after osteopathic manipulative treatment based on myofascial release in patients with moderate or severe fibromyalgia: a retrospective study
Farra, F., Chiesa, A., Risio, R. G., Vismara, L., Bergna, A.
Journal of Complementary and Integrative Medicine, 2021/11
Free full text

1699

Analyzing the cost of medical student virtual conference registration by specialty during the COVID-19 pandemic
Veyg, D., Gurevich, R.
Journal of Osteopathic Medicine, 2021/11
Free full text

1700

Effect of osteopathic manipulation on gait asymmetry
Hill, C. N., Romero, M., Rogers, M., Queen, R. M., Brolinson, P. G.
Journal of Osteopathic Medicine, 2021/11
Free full text



1703

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11

1704

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11


1706

Response to Alvarez et al
Coste, J., Medkour, T., Maigne, J. Y., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/11
Free full text

1707

The ACAMTO study—impact of add-on osteopathic treatment on adolescent patients with anorexia nervosa: study protocol for a randomized controlled trial
Letranchant, A., Montebello, Y., Dugré-Le bigre, C., Wagner, A., Curt, F., Silva, J., Nicolas, I., Votadoro, P., Kalindjian, N., Korchonnoff, A., Gutierre, A., Novelli, Ana B., Pham-Scottez, A., Corcos, M.
Trials, 2021/11
Free full text







1714

Effectiveness of myofascial release on pain, sleep, and quality of life in patients with fibromyalgia syndrome: A systematic review
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P.
Complementary Therapies in Clinical Practice, 2021/11



1717

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text

1718

Comprehensive Reform and Greater Equity in Applying to Residency-Trainees' Mixed Responses to a Pass/Fail USMLE Step 1
Ganesh Kumar, N., Pontell, M. E., Makhoul, A. T., Drolet, B. C.
Journal of Graduate Medical Education, 2021/10
Free full text


1720

Most common infant health concerns in osteopathic practices in Germany. A survey
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2021/10

1721

Spinal Manipulative Therapy for Acute Neck Pain: A Systematic Review and Meta-Analysis of Randomised Controlled Trials
Chaibi, A., Stavem, K., Russell, M. B.
Journal of Clinical Medicine, 2021/10
Free full text

1722

Evaluating for a correlation between osteopathic examination and ultrasonography on thoracic spine asymmetry
Chang, S., Maddox, J., Berg, E., Kim, K., Messier, S., Swanson, L., Dobrusin, R., Stein, A. B., Nakken, G. N., Noble, J., Nydam, R.
Journal of Osteopathic Medicine, 2021/10
Free full text





1727

Stimulating the Use of OMT in Primary Care Offices Via Point-of-Care Reminders
Agcopra, A., Collins, P., Jha, S., Mancuso, A.
Osteopathic Family Physician, 2021/10

1728

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10


1730

Osteopathy in Germany: attitudes, beliefs and handling among general practitioners - results of a nationwide cross-sectional questionnaire survey
Schmid, G. L., Kluge, J., Deutsch, T., Geier, A. K., Bleckwenn, M., Unverzagt, S., Frese, T.
BMC Family Practice, 2021/10
Free full text

1731

Osteopathic Treatment and Evaluation in the Clinical Setting of Childhood Hematological Malignancies
Barbieri, M., Zardo, W., Frittoli, C., Rivolta, C., Valdata, V., Bouquin, F., Passignani, G., Maggiani, A., Jankovic, M., Cossio, A., Biondi, A., Balduzzi, A., Lanfranconi, F.
Cancers, 2021/10
Free full text

1732

Osteopathic Treatment of Infants in Their First Year of Life: A Prospective Multicenter Observational Study (OSTINF Study)
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Complementary Medicine Research, 2021/10
Free full text




1736

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09


1738



1740

Efficacy of osteopathic manipulative treatment in patients with Parkinson's disease: a narrative review
Li, R., Jose, A., Poon, J., Zou, C., Istafanos, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/09
Free full text

1741

Exploring Race and Ethnicity Representational Inequities in Illinois Medical Schools
Francone, N. O., Simon, M. A., Ortega, P.
Health Equity, 2021/09
Free full text

1742

Exploring the Utility of Motion Analysis in Osteopathic Clinical Trials; a School-Based Pilot Study on Jaw and Cervical Range of Motion
Bagory, T., Vaucher, P., Mhadhbi, H., Ménard, M.
International Journal of Osteopathic Medicine, 2021/09

1743

Effects of myofascial release applied to neck muscles and craniocervical flexor training in patients with chronic myofascial TMD: A single arm study
Calixtre, L. B., Rezende, M. A., Kamonseki, D. H., Beatriz de Oliveira, A.
International Journal of Osteopathic Medicine, 2021/09

1744

The Challenges of Implementing a Joint Interprofessional Education Program Between a Pharmacy College and an Osteopathic Medical College: A Case Study
Huggins, C., Basu, P., Senhaji-Tomza, B., Warwick, S., Anthony, M. E.
International Journal of Osteopathic Medicine, 2021/09

1745

The legacy and implications of the body-mind-spirit osteopathic tenet: a discussion paper evaluating its clinical relevance in contemporary osteopathic care
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/09


1747

Osteopathic Cranial Manipulation for a Patient With Whiplash-Associated Disorder: A Case Report
Parravicini, G., Ghiringhelli, M.
Journal of Chiropractic Medicine, 2021/09

1748

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text

1749

Embracing industry sponsored research to expand osteopathic medical student research experiences
Morehouse, Z. P., Nash, R. J.
Journal of Osteopathic Medicine, 2021/09
Free full text

1750

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09


1752

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09

1753

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09



1756

Effects of Osteopathic Manipulation and Other Manual Manipulative Treatments on Cystic Fibrosis
Ball, K. T., Kraft, D. E., Snider, K. T.
The AAO Journal, 2021/09
Free full text


1758

Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/09
Free full text

1759

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study
Miranda, E., Giza, J., Feketeova, E., Castro-Nunez, C., Vieux, U., Huynh, M.D.
The AAO Journal, 2021/09
Free full text



1762

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09

1763

A Systematic Review of Musculoskeletal Mobilization and Manipulation Techniques Used in Veterinary Medicine
Haussler, K. K., Hesbach, A. L., Romano, L., Goff, L., Bergh, A.
Animals, 2021/09
Free full text

1764

(Osteopoathic medical treatment of pediatric patient)
Angersbach, N.
Unpublished MSc thesis, 2021/09

1765

Resident opinions of diabetes management in training: a survey
Healy, A. M., Uhrig, J. L., Shubrook, J. H., Aung, N. L., Sadhu, A. R.
Journal of Osteopathic Medicine, 2021/09
Free full text





1770

Osteopathic Manipulative Treatment for Chronic Low Back Pain
Licciardone, J. C.
JAMA Internal Medicine, 2021/08

1771

Osteopathic Manipulative Treatment for Chronic Low Back Pain—Reply
Nguyen, C., Zegarra-Parodi, R., Boutron, I.
JAMA Internal Medicine, 2021/08

1772

Response to “COMSAE phase 1: value added“
Sandella, J. M., Craig, B., Tsai, T. H., Fleury, M., Clem, A.
Journal of Osteopathic Medicine, 2021/08
Free full text

1773

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08

1774

COMSAE Phase 1: value added
Sefcik, D., Petsche, E. M.
Journal of Osteopathic Medicine, 2021/08
Free full text

1775

Osteopathic interventions via telehealth in a pediatric population: a retrospective case series
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2021/08
Free full text


1777


1778

Arkansas College of Osteopathic Medicine Simulated Emergency Response Team: A Student Driven Pilot Program
Newman, C. W., Ackerman, R., Brown, T., Ramsey, H., Spector, D., Carson, J., Sanders, K., Daniels, D., Potts, H.
Southern Medical Journal, 2021/08

1779

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text


1781

Effect of a required online graded curriculum in the clerkship years on medical student national standardized examination performance
Glaser, K., Pazdernik, V. K., Sackett, D., Sheridan, V.
Journal of Osteopathic Medicine, 2021/08
Free full text

1782

Vertigo and Balance Disorders-The Role of Osteopathic Manipulative Treatment: A Systematic Review
Tramontano, M., Consorti, G., Morone, G., Lunghi, C.
Complementary Medicine Research, 2021/08

1783



1785

The Lymphatic System: An Osteopathic Review
Hruby, R. J., Martinez, E. S.
Cureus, 2021/07
Free full text


1787

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07

1788

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07


1790


1791

Effects of myofascial release or self-myofascial release and control position exercises on lower back pain in idiopathic scoliosis: A systematic review
López-Torres, O., Mon-López, D., Gomis-Marzá, C., Lorenzo, J., Guadalupe-Grau, A.
Journal of Bodywork and Movement Therapies, 2021/07

1792

Secondary dysmenorrhea and dyspareunia associated with pelvic girdle dysfunction: A case report and review of literature
Origo, D., Piloni, S., Tarantino, A. G.
Journal of Bodywork and Movement Therapies, 2021/07

1793

Physician wellbeing - what do physicians want?
Ryan, E. P.
Journal of Osteopathic Medicine, 2021/07
Free full text

1794

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text



1797

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text

1798

Knowledge of osteopathic manipulative medicine and osteopathic physicians in a New York South Asian community
Lee, J., Maung, C., Espares, J., Chen, J., Yip, F., Lin, W., Zhao, L., Li, T. S.
Journal of Osteopathic Medicine, 2021/07
Free full text







1805

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07

1806

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07


1808

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text

1809

The use of visceral techniques in Australian osteopathic practice: A descriptive cross-sectional study
Fleischmann, M., Vaughan, B., Grace, S., Stewart, A., Hart, C., Brew, E., Masters, G., Smeeton, L., Thompson, L., Brooks, M.
Advances in Integrative Medicine, 2021/07

1810

Osteopathic empirical research: a bibliometric analysis from 1966 to 2018
Morin, C., Gaboury, I.
BMC Complementary Medicine and Therapies, 2021/07
Free full text


1812

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06

1813

Efficacy of implementing intermittent STOP THE BLEED® reviews on long term retention of hemorrhage control skills of first year medical students
Sainbayar, E., Holt, N., Jacobson, A., Bhatia, S., Weaver, C.
Journal of Osteopathic Medicine, 2021/06
Free full text


1815

The development and application of a remediation process in an osteopathic curriculum
Aubin, A., Boulanger, C., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2021/06

1816

Inclusivity and accessibility in undergraduate osteopathic education for students with disability: A scoping review
MacMillan, A., Corser, A., Clark, Z.
International Journal of Osteopathic Medicine, 2021/06

1817

The importance of osteopathic physician scientist training programs
Doyle, S. J.
Journal of Osteopathic Medicine, 2021/06
Free full text


1819

Diversity and Inclusion on General Surgery, Integrated Thoracic Surgery, and Integrated Vascular Surgery Residency Program Websites
Mortman, R., Frazier, H. A., Haywood, Y. C.
Journal of Graduate Medical Education, 2021/06
Free full text


1821

Establishing osteopathic assessments to fulfill osteopathic recognition standards: a model for dermatology and other subspecialties
Mahlberg, S. J., Liou, Y. L., Lloyd, J.
Journal of Osteopathic Medicine, 2021/06
Free full text






1827

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06

1828

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text

1829

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text

1830

Crochet the Pain Away: A Case Study of Osteopathic Manipulation for Cervical Rib Induced Thoracic Outlet Syndrome
Herring, J. A., Soto, G. N., Silver, S.
The AAO Journal, 2021/06
Free full text

1831

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text


1833

Scholar 12: Beta Trial of an Osteopathic Research Cultural Development Computer Application
Rowane, M.J., Hellmann, D. E., Branning, R. A., Cola, H. M., Fahoum, J. M., Snyder, B. M., Healy, A. M., Qi-Lytle, X., Rowane, M. P., Terrell, M. A., Hostoffer, R. W.
The AAO Journal, 2021/06
Free full text

1834

Craniosacral Therapy Use in Normal Pressure Hydrocephalus
Park, Y., Kabariti, J., Tafler, L.
Cureus, 2021/05
Free full text

1835

Osteopathic Manipulative Treatment of Herpes Zoster Ophthalmicus/Postherpetic Neuralgia
Volokitin, M., Izadi, N., Myers, R., Kane Diaw, N., Milani, S.
Cureus, 2021/05
Free full text

1836

Current state of nutrition and nutritional supplement training in medical schools
Lowther, D. P.
Unpublished PhD thesis, 2021/05
Free full text

1837

The importance of epistemological consideration in the reporting of evidence for osteopathic care in Covid-19 papers
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/05
Free full text

1838

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05

1839

Effect of Osteopathic Manipulative Treatment vs Sham Treatment on Activity Limitations in Patients With Nonspecific Subacute and Chronic Low Back Pain: A Randomized Clinical Trial
Nguyen, C., Boutron, I., Zegarra-Parodi, R., Baron, G., Alami, S., Sanchez, K., Daste, C., Boisson, M., Fabre, L., Krief, P., Krief, G., Lefèvre-Colau, M.M., Rannou, F.
JAMA Internal Medicine, 2021/05

1840

Organizational behavior among academic medical school faculty
Hoegerl, C.
Journal of Osteopathic Medicine, 2021/05
Free full text

1841

The Rule of Three
Abend, D.
Osteopathic Family Physician, 2021/05
Free full text

1842

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

1843

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

1844

The usage of multidisciplinary physical therapies at the Rio de Janeiro 2016 Olympic Summer Games: an observational study
Grant, M. E., Steffen, K., Palmer, D.
Brazilian Journal of Physical Therapy, 2021/05
Free full text

1845

Gnathological and osteopathic treatments with digital evaluations before and after therapies: a case report of a patient with ehlers-danlos syndrome
Di Giacomo, P., Cerignoli, E., D'Ermes, V., Ferrato, G., Polimeni, A., Di Paolo, C.
La Clinica Terapeutica, 2021/05
Free full text

1846

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05

1847

Obstructed defecation syndrome associated with paradoxical puborectalis contraction: osteopathic treatment versus anal biofeedback. Results of a pilot study
Ascanelli, S., Portinari, M., Canella, M., Solari, S., Dall&rsquo, Omo, F., Danese, S., De Troia, A., Carcoforo, P.
Techniques in Coloproctology, 2021/05



1850

Osteopathic Medicine: What Radiologists Need to Know
Gunderman, L. D., Gunderman, R. B.
Academic Radiology, 2021/05

1851

The Effectiveness of Pump Techniques and Pompages: A Systematic Review
Vanti, C., Golfari, M., Pellegrini, G., Panizzolo, A., Turone, L., Giagio, S., Pillastrini, P.
Applied Sciences, 2021/05
Free full text

1852

Direct and mediated effects of treatment context on low back pain outcome: a prospective cohort study
Bishop, F., Al-Abbadey, M., Roberts, L., MacPherson, H., Stuart, B., Carnes, D., Fawkes, C., Yardley, L., Bradbury, K.
BMJ Open, 2021/05
Free full text



1855

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text




1859

Effects of Osteopathic T9-T10 Vertebral Manipulation in Tonsillitis: A Randomized Clinical Trial
Luceño-Mardones, A., Luceño-Rodríguez, I., Rodríguez-López, E. S., Oliva-Pascual-Vaca, J., Rosety, I., Oliva-Pascual-Vaca, Á
Healthcare, 2021/04
Free full text

1860

Osteopathic manual therapy in heart failure patients: A randomized clinical trial
Thomaz, S. R., Teixeira, F. A., de Lima, Acgb, Cipriano Junior, G., Formiga, M. F., Cahalin, L. P.
Journal of Bodywork and Movement Therapies, 2021/04

1861

Dietary views and habits of students in health professional vs. non-health professional graduate programs in a single university
Downing, M. A., Bazzi, M. O., Vinicky, M. E., Lampasona, N. V., Tsvyetayev, O., Mayrovitz, H. N.
Journal of Osteopathic Medicine, 2021/04
Free full text

1862

Assessment of Studies Evaluating Spinal Manipulative Therapy and Infectious Disease and Immune System Outcomes: A Systematic Review
Chow, N., Hogg-Johnson, S., Mior, S., Cancelliere, C., Injeyan, S., Teodorczyk-Injeyan, J., Cassidy, J. D., Taylor-Vaisey, A., Cote, P.
JAMA Network Open, 2021/04
Free full text


1864

Teleclerkships? The role of telemedicine in medical student education during COVID-19 and beyond
Vadhan, J. D., Crispino, L. J., Carmody, J. B.
Journal of Osteopathic Medicine, 2021/04
Free full text

1865

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text

1866

Direct measurement of the rhythmic motions of the human head identifies a third rhythm
Rasmussen, T. R., Meulengracht, K. C.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text


1868

Osteopathic manipulative medicine in the management of headaches associated with postconcussion syndrome
Esterov, D., Thomas, A., Weiss, K.
Journal of Osteopathic Medicine, 2021/04
Free full text


1870

Perceptions of nonopioid treatment for pain in a homeless population
Fraser, K. A., Nguyen, H., Kim, S., Park, F., Bernal, J., Westberg, A. D., Podawiltz, A.
Journal of Osteopathic Medicine, 2021/04
Free full text







1877

Meaningful use of COMSAE Phase 1 in preparation for COMLEX-USA Level 1
Wang, X., Maeda, H., Craig, B., Tsai, T. H., Sandella, J. M., Fleury, M.
Journal of Osteopathic Medicine, 2021/04
Free full text



1880

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text

1881

A Closer Look into the Association between the Sacroiliac Joint and Low Back Pain
Wieczorek, A., Campau, E., Pionk, E., Gabriel-Champine, M. E., Rios-Bedoya, C. F.
Spartan Medical Research Journal, 2021/04
Free full text

1882

Using contact-based education to destigmatize opioid use disorder among medical students
Mort, S. C., Díaz, S. R., Beverly, E. A.
Teaching and Learning in Medicine, 2021/04

1883

Osteopathic medicine for fibromyalgia: a sham-controlled randomized clinical trial
Coste, J., Medkour, T., Maigne, J., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/04
Free full text



1886

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04


1888

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text

1889

Osteopathic manipulative treatment to improve exclusive breast feeding at 1 month
Danielo Jouhier, M., Boscher, C., Roze, J. C., Cailleau, N., Chaligne, F., Legrand, A., Flamant, C., Muller, J. B.
Archives of Disease in Childhood. Fetal and Neonatal Edition, 2021/04

1890

Mentors’ experiences in an osteopathic medical student research program
Hamby, T., Bowman, W. P., Wilson, D. P., Basha, R.
Journal of Osteopathic Medicine, 2021/04
Free full text

1891

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text

1892

Osteopathic Manipulative Treatment to Optimize the Glymphatic Environment in Severe Traumatic Brain Injury Measured With Optic Nerve Sheath Diameter, Intracranial Pressure Monitoring, and Neurological Pupil Index
Kashyap, S., Brazdzionis, J., Savla, P., Berry, J. A., Farr, S., Patchana, T., Majeed, G., Ghanchi, H., Bowen, I., Wacker, M. R., Miulli, D. E.
Cureus, 2021/03
Free full text




1896

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03

1897

Osteopathische Behandlung bei Vulvodynie
(Osteopathic treatment for vulvodynia)
Morgentau, M. J., Reinartz, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03



1900

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03


1902

Actions Speak Louder Than Words: Exploring Pragmatism in Osteopathy
Macfarlane, C.
Unpublished PhD thesis, 2021/03
Free full text

1903

Osteopathic model of the development and prevention of occupational musculoskeletal disorders
Price, J. W.
Journal of Osteopathic Medicine, 2021/03
Free full text


1905

The Philadelphia surgery conference: a value analysis of a hands-on surgical skill-building event
DiPasquale, L., Libera, R., Do-Nguyen, C. C., Brehman, E., Tatagari, V., Waring, H., Appelt, D., Sesso, A.
Journal of Osteopathic Medicine, 2021/03
Free full text

1906

Effects of osteopathic manipulative treatment and bio-electromagnetic energy regulation therapy on lower back pain
Auger, K., Shedlock, G., Coutinho, K., Myers, N. E., Lorenzo, S.
Journal of Osteopathic Medicine, 2021/03
Free full text

1907

Support for osteopathic manipulative treatment inclusion in chronic pain management guidelines: a narrative review
Franzetti, M., Dries, E., Stevens, B., Berkowitz, L., Yao, S. C.
Journal of Osteopathic Medicine, 2021/03
Free full text

1908

Teaching and use of cervical high-velocity, low-amplitude manipulation at colleges of osteopathic medicine
Hu, A., Motyka, T., Gish, E., Dogbey, G.
Journal of Osteopathic Medicine, 2021/03
Free full text

1909

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03

1910

Manual treatment for kidney mobility and symptoms in women with nonspecific low back pain and urinary infections
Lo Basso, F., Pilzer, A., Ferrero, G., Fiz, F., Fabbro, E., Oliva, D., Cazzarolli, C., Turrina, A.
Journal of Osteopathic Medicine, 2021/03
Free full text

1911

The use of 3D printing for osteopathic medical education of rib disorders
Moriles, K., Ramnot, A., Lai, M., Jacobs, R. J., Qureshi, Y.
Journal of Osteopathic Medicine, 2021/03
Free full text

1912

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03


1914

Predictors of research self efficacy in first-year osteopathic medical students
Jacobs, R. J., Kane, M. N.
International Journal of Osteopathic Medicine, 2021/03


1916

Radiation oncology education and experience in the undergraduate medical setting
Odiase, O. M., Huang, D., Sura, K. T.
Medical Education Online, 2021/03
Free full text

1917

Objectivation of an Educational Model in Cranial Osteopathy Based on Experience
Requena-García, J., García-Nieto, E., Varillas-Delgado, D.
Medicina (Kaunas), 2021/03

1918

Impact of different types of revision materials on the learning of musculoskeletal techniques
Launay, F., Ménard, M., Bourgin, M., Mhadhbi, H., Sutre, F., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2021/03


1920

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text



1923

Thomas L. Northup Lecture: Accepting the Death of Osteopathy: A New Beginning
Jealous, J. S.
The AAO Journal, 2021/03
Free full text


1925

Complementary and alternative medicine use by pediatric oncology patients before, during, and after treatment
Lüthi, E., Diezi, M., Danon, N., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
BMC Complementary Medicine and Therapies, 2021/03


1927

An Osteopathic Approach to Neck Pain
Zona, J. C., Cranor, M.
American Family Physician, 2021/03

1928

Poor match rates of osteopathic applicants into ACGME dermatology and other competitive specialties
Craig, E., Brotzman, E., Farthing, B., Giesey, R., Lloyd, J.
Journal of Osteopathic Medicine, 2021/03
Free full text

1929

A splenic cyst causing a viscerosomatic reflex in the thoracic spine. A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2021/03

1930

Osteopathic students and graduates matching into pathology residency, 2011–2020
Jajosky, R. P., Coulson, H. C., Rosengrant, A. J., Jajosky, A. N., Jajosky, P. G.
Journal of Osteopathic Medicine, 2021/02
Free full text

1931

The history of medical education: a commentary on race
Daher, Y., Austin, E. T., Munter, B. T., Murphy, L., Gray, K.
Journal of Osteopathic Medicine, 2021/02
Free full text

1932

Osteopathic manipulative treatment and the Spanish flu: a historical literature review
Baroni, F., Mancini, D., Tuscano, S. C., Scarlata, S., Lunghi, C., Cerritelli, F., Haxton, J.
Journal of Osteopathic Medicine, 2021/02
Free full text

1933

The flipped classroom: a novel approach to physical examination skills for osteopathic medical students
Bhai, S. A., Poustinchian, B.
Journal of Osteopathic Medicine, 2021/02
Free full text

1934

Diversity in osteopathic medical school admissions and the COMPASS program
Dady, N., Mungroo, K. A., Young, T., Akinsanya, J., Forstein, D.
Journal of Osteopathic Medicine, 2021/02
Free full text

1935

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text

1936

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text

1937

Predictors of emotional wellbeing in osteopathic medical students in a COVID-19 world
Jacobs, R., Lanspa, M., Kane, M., Caballero, J.
Journal of Osteopathic Medicine, 2021/02
Free full text

1938

Characteristics and treatment of geriatric patients in an osteopathic neuromusculoskeletal medicine clinic
King, A. A., Cox, J., Bhatia, S., Snider, K. T.
Journal of Osteopathic Medicine, 2021/02
Free full text


1940

Effect of occipitoatlantal decompression on cerebral blood flow dynamics as evaluated by Doppler ultrasonography
Roberts, B., Makar, A. E., Canaan, R., Pazdernik, V., Kondrashova, T.
Journal of Osteopathic Medicine, 2021/02
Free full text


1942

Supportive care and osteopathic medicine in pediatric oncology: perspectives of current oncology clinicians, caregivers, and patients
Belsky, J. A., Stanek, J., Skeens, M. A., Gerhardt, C. A., Rose, M. J.
Supportive Care in Cancer, 2021/02
Free full text




1946

Pediatric Osteopathic Manipulative Medicine: A Scoping Review
DeMarsh, S., Huntzinger, A., Gehred, A., Stanek, J. R., Kemper, K. J., Belsky, J. A.
Pediatrics, 2021/02

1947

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text

1948

The role of touch in osteopathic practice: A narrative review and integrative hypothesis
Baroni, F., Ruffini, N., D'Alessandro, G., Consorti, G., Lunghi, C.
Complementary Therapies in Clinical Practice, 2021/02

1949

Should Osteopathic Medical Students Take the USMLE?
Lenchus, J.
Academic Medicine, 2021/02
Free full text


1951

Education, Perceptions, and Delivery: Factors Shaping the Perceived Role in the Pre-Exposure Prophylaxis (PrEP) Care Continuum Among a Sample of Osteopathic Medical Students
O'Neil, A. M., Meyers, H. J., DeBoy, K. R., Stowe, M., Hamrick, J., Giano, Z., Hubach, R. D.
AIDS Education and Prevention, 2021/02

1952

Associations between stress, anxiety, depression, and emotional intelligence among osteopathic medical students
Doyle, N. A., Davis, R. E., Quadri, S. S. A., Mann, J. R., Sharma, M., Wardrop, R. M., Nahar, V. K.
Journal of Osteopathic Medicine, 2021/02
Free full text


1954

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Spanish osteopaths
Alvarez, G., Justribo, C., Sundberg, T., Thomson, O. P., Leach, M. J.
BMC Health Services Research, 2021/02
Free full text



1957

Osteopathische Behandlung bei Plagiozephalie
(Osteopathic treatment of plagiocephaly)
Kenner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01

1958

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01


1960

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01

1961


1962

Gut Microbiome Changes with Osteopathic Treatment of Constipation in Parkinson's Disease: A Pilot Study
Mancini, J. D., Yao, S., Martinez, L. R., Shakil, H., Li, T. S.
Neurology (ECronicon), 2021/01
Free full text

1963

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01

1964

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01

1965

Impact of an osteopathic presence in a large categorical pediatric residency training program
Barnhardt, E. W., Comer, F., Zmuda, E., Rakowsky, A.
Journal of Osteopathic Medicine, 2021/01
Free full text

1966

Pilot study assessing the effect of osteopathic manipulative treatment (OMT) on length of stay in neonates after therapeutic hypothermia
Bendixen, K., Beinlich, A., Beck, B., Hashmi, N., Craig, A.
Journal of Osteopathic Medicine, 2021/01

1967

Transforming a clerkship with telemedicine
Bhatia, R. K., Cooley, D., Collins, P. B., Caudle, J., Coren, J.
Journal of Osteopathic Medicine, 2021/01
Free full text

1968

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text

1969

Osteopathic manipulative treatment (OMT) use among osteopathic physicians in the United States
Healy, C. J., Brockway, M. D., Wilde, B. B.
Journal of Osteopathic Medicine, 2021/01
Free full text

1970

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text

1971

Journal of Osteopathic Medicine: a refreshed and refocused publication for our profession
Zafonte, R. D.
Journal of Osteopathic Medicine, 2021/01
Free full text



1974

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text

1975

Perceptions of the Osteopathic Profession in New York City's Korean Communities
Justin Chin, D. O., Haeinn Woo, Oms-Iv, Diane Choi, O. M. S., III, Emily Dube, M. S., Mikhail Volokitin, Md Do, Christine Lomiguen
Osteopathic Family Physician, 2021/01
Free full text

1976

Effectiveness of osteopathic interventions in chronic non-specific low back pain: A systematic review and meta-analysis
Dal Farra, F., Risio, R. G., Vismara, L., Bergna, A.
Complementary Therapies in Medicine, 2021/01
Free full text

1977

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text

1978

“Somebody who does something other than osteopathy”
Sajjadi, N. B., Shepard, S.
Journal of Osteopathic Medicine, 2021/01

1979

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text

1980

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text

1981


1982

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text

1983

The Effect of Osteopathic Manipulative Treatment (OMT) on Proprioception in Adults: A Pilot Study
Hoevemeyer, K., Teng, K. Y., Mehner, T., McMunn, R., Figueroa, J., Jie, C.
The AAO Journal, 2020/12
Free full text






1989

The importance of rigour in the reporting of evidence for osteopathic care in Covid-19 papers
Draper-Rodi, J., Vaucher, P., Thomson, O. P.
Explore (NY), 2020/12
Free full text

1990

Characteristics and Management of Pregnant Patients From a Neuromusculoskeletal Medicine/Osteopathic Manipulative Medicine Clinic
Frank, L. D., Bhatia, S., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/12
Free full text

1991

Osteopathic Approach to the Treatment of a Patient With Idiopathic Iliohypogastric Neuralgia
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

1992

CRI over MRI: A Cranial Approach to Dizziness
Qureshi, Y., Patel, U., Mercer, A.
The AAO Journal, 2020/12
Free full text

1993

Comparison of State Medical Licensing Board Disclosures Regarding Resident Performance for United States Allopathic, Osteopathic, and Foreign Medical Graduates
Gajewski, M., Hillen, M., Matassa, D., Kunac, A., Anana, M., Pompeo, L., Kothari, N., Murano, T.
The Journal of the American Osteopathic Association, 2020/12
Free full text

1994




1997

The Use of Osteopathic Manipulative Medicine in the Management of Recurrent Mastitis
Jackson, C., Loveless, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

1998

Crying Unsettled and disTressed Infants Effectiveness Study of osteopathic care (CUTIES trial): Pragmatic randomised superiority trial protocol
Carnes, D., Bright, P., Brownhill, K., Carroll, K., Engel, R., Grace, S., Vogel, S., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/12


2000

Motivating High School Students From Rural Areas to Attend College and Pursue Careers as Osteopathic Physicians
Kadavakollu, S., Shindi, R. S., Nummerdor, H. R., Singh, V. K., Pillai, S. B., Ontiveros, S. J., Boyanovsky, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

2001

Brain Connectivity Changes after Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tramontano, M., Cerritelli, F., Piras, F., Spanò, B., Tamburella, F., Piras, F., Caltagirone, C., Gili, T.
Brain Sciences, 2020/12
Free full text





2006

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12

2007

Training Osteopathic Medical Students for Drastic 2021 Health Record Documentation Policy Changes
Bains, R., Gill, A., Singh, J., Antos, A., Lim, S., Molga, H., Malik, A., St. Pierre, S., Davis, G., Warner, M.
The Journal of the American Osteopathic Association, 2020/12

2008

The effect of osteopathic medicine on pain in musicians with nonspecific chronic neck pain: a randomized controlled trial
Rotter, G., Fernholz, I., Binting, S., Keller, T., Roll, S., Kass, B., Reinhold, T., Willich, S. N., Schmidt, A., Brinkhaus, B.
Therapeutic Advances in Musculoskeletal Disease, 2020/12
Free full text

2009

The Effect of Osteopathic Manipulative Treatment on Stiff Person Syndrome
Bazzi, M. O., Vemuri, A., Downing, M. A., Barry, P. E.
The Journal of the American Osteopathic Association, 2020/12

2010

Hand Model Utility for Osteopathic Pelvic Diagnosis in a Remote Learning Setting
Burg, B. J., Ketigian, L. A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/12

2011

Effects of the COVID-19 Pandemic on Osteopathic Medical Students’ Screen Time
Edimo, C. O., Espares, J. K., Falus, N. A., Bupathi, S. K., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12

2012

Prevalence of Computer Vision Syndrome (CVS) Symptoms on Osteopathic Medical Students
Espares, J. K., Edimo, C. O., Bupathi, S. K., Falus, N. A., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12

2013

The Use of Osteopathic Manipulation to Facilitate Bone Remodeling in a Postmenopausal Osteoporotic Woman
Grabie, Y., Jamil, N., Habib, N., Simone, J. J.
The Journal of the American Osteopathic Association, 2020/12

2014

Burn-out in Osteopathic Medical Students: The Effects of Meditation Before and After the Arrival of the COVID-19 Pandemic
Krishnamachari, B., Morris, A., Chinsky, R., Pendyala, R., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2020/12

2015

Levels of Resilience & Coping of Osteopathic Medical Students during COVID-19: Implications for Mental Health Innovations for Physicians in Training
Lanspa, M. E., Jacobs, R. J., Patel, K. C.
The Journal of the American Osteopathic Association, 2020/12

2016

The Effects of Osteopathic Manipulative Treatment on HbA1c in Type 2 Diabetes and Pre-diabetes: A Randomized-Control Clinical Trial
Sureshbabu, S., Sheflin, K., Li, T. S., Heller, M., Yusupov, E., Krishnamachari, B., Allera, A., Rivera-Martinez, S.
The Journal of the American Osteopathic Association, 2020/12

2017

2020 AOA Research Abstracts and Poster Competition
listed, No authors
The Journal of the American Osteopathic Association, 2020/12
Free full text




2021

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12

2022

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12



2025

The Effect of Osteopathic Manipulative Treatment on Lower Limb Muscle Rigidity in a Parkinson's Patient
Vemuri, A., Xu, E., Downing, M., Widboom, N.
Southern Medical Journal, 2020/12



2028

The effect of tongue and suprahyoid muscles release in the treatment of chronic non-specific neck pain: Study protocol for a randomized controlled trial
Silva, A. C., Godinho, M. M., Biasotto Gonzalez, D. A., Politti, F.
International Journal of Osteopathic Medicine, 2020/12

2029

Toward Resilience: Medical Students' Perception of Social Support
Casapulla, S., Rodriguez, J., Nandyal, S., Chavan, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text



2032

[PREPRINT] “Somebody Who Does Something Other Than Osteopathy“
Sajjadi, N. B., Shepard, S.
The Journal of the American Osteopathic Association, 2020/11
Free full text

2033

An Osteopathic Modular Approach to Asthma: A Narrative Review
Schend, J., Rowane, M., Sanan, N., Hostoffer, S. R.
The Journal of the American Osteopathic Association, 2020/11
Free full text

2034

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text

2035

The clinical management of neck pain of novice and experienced Australian osteopaths: a secondary analysis of a nationally representative sample
Fleischmann, M., McLaughlin, P., Hayes, A., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2020/11

2036

Ultrasonography to Assess the Efficacy of Osteopathic Manipulative Treatment for Lumbar Spine Asymmetry
Winter, J., Kimber, A., Montenegro, S., Gao, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text

2037

Status of Entrustable Professional Activities (EPA) Implementation at Colleges of Osteopathic Medicine in the United States and Future Considerations
Linsenmeyer, M., Wimsatt, L., Speicher, M., Basehore, P., Sexton, P. S.
The Journal of the American Osteopathic Association, 2020/11



2040

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text

2041


2042

Osteopathic Approach to Treatment of Carpal Dysfunction: The Carpal Mobilization Technique
Mehner, T. R., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/11
Free full text





2047

Evaluating the quality of clinical teaching in osteopathy
Vaughan, B.
Unpublished PhD thesis, 2020/10
Free full text

2048

Osteopathic Manipulative Treatment in Individuals With Vertigo and Somatic Dysfunction: A Randomized, Controlled, Comparative Feasibility Study
Fraix, M., Badran, S., Graham, V., Redman-Bentley, D., Hurwitz, E. L., Quan, V. L., Yim, M., Hudson-McKinney, M., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text


2050

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text

2051

Cranial osteopathic treatment and stress-related effects on autonomic nervous system measured by salivary markers: A pilot study
Abenavoli, A., Badi, F., Barbieri, M., Bianchi, M., Biglione, G., Dealessi, C., Grandini, M., Lavazza, C., Mapelli, L., Milano, V., Monti, L., Seppia, S., Tresoldi, M., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2020/10

2052

Cerebral tissue oxygenation during cranial osteopathic CV4 procedure in newborns
Malak, R., Kozłowska, Z., Owsiańska, Z., Sikorska, D., Andrusiewicz, M., Szymankiewicz-Bręborowicz, M., Samborski, W., Szczapa, T.
Advances in Clinical and Experimental Medicine, 2020/10
Free full text

2053

New investigator editorial: the osteopathic medical student perspective on research
Persand, D., Maddie, N.
American Journal of Physiology. Heart and Circulatory Physiology, 2020/10
Free full text


2055

Communication Skills of Grandview/Southview Medical Center General Surgery Residents
Johnson, W., Ngo, A., Elrod, M.
The Journal of the American Osteopathic Association, 2020/10
Free full text


2057

A Pilot Study of Jugular Compression (Queckenstedt maneuver) for Cranial Movement Perception
Abenavoli, A., Pisa, S., Maggiani, A.
The Journal of the American Osteopathic Association, 2020/10

2058

The Role of Musculoskeletal Disorders in Chronic Disease: A Narrative Review
Asahi, M. G., Briganti, D., Cam, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text

2059

Osteopathic Manipulative Treatments for Pediatric Conditions
Raines, S. G. M., Ramey, A. L.
Osteopathic Family Physician, 2020/10
Free full text

2060

A Case of Resolved Vincristine-Induced Constipation Following Osteopathic Medicine in a Patient With Infantile Fibrosarcoma
Belsky, J. A., Wolf, K., Setty, B. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text

2061

Osteopathic Manipulative Treatment for a Recognizable Pattern of Somatic Dysfunction Following Laparoscopic Cholecystectomy
Mills, M., Sevensma, K., Serrano, J.
The Journal of the American Osteopathic Association, 2020/10
Free full text

2062

La fascia desde la medicina osteopática
(Fascia from the perspective of osteopathic medicine)
Stambulie Padilla, E. A.
Unpublished MSc thesis, 2020/10
Free full text

2063

Treating Complex Regional Pain Syndrome Using Counterstrain: A Novel Approach
Schranz, K., Meitz, D., Powers, B., Ables, A.
Cureus, 2020/10
Free full text

2064

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text

2065

Osteopathie in Norwegen
(Osteopathy in Norway)
Becher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10

2066

Im Gespräch mit … Diana Stöckl
(In dialog with … Diana Stöckl)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10

2067



2069

Osteopathie bei epileptischen Anfällen
(Osteopathy for epileptic disorder)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10



2072

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text

2073

The Immediate, Intermediate, and Long-Term Effects of Osteopathic Manipulative Treatment on Pulmonary Function in Adults with Asthma
Kasten, K. M., Tyler, S. K., Johnson, A. R., Kolakowski, E. R., Pickos, J., Heineman, K., Jie, C.
The AAO Journal, 2020/09
Free full text


2075

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09

2076

Biomedical origins of the term 'osteopathic lesion' and its impact on people in pain
Noy, M., Macedo, L., Carlesso, L.
International Journal of Osteopathic Medicine, 2020/09

2077

Severe Viscerosomatic Neck Pain from Refractory Gastroesophageal Reflux
Uhrig, J., Rettos, J.
The AAO Journal, 2020/09
Free full text



2080

Aquatic Osteopathy Treatment Assessment by Infrared Thermography on Healthy Subjects After Thermoneutral Water Immersion
Maxel, X., Girollet, F., Stubbe, L., Boudot, E., Darraillans, L., Bodnar, J. L.
Journal of Chiropractic Medicine, 2020/09
Free full text

2081

Spinal Manipulation and Select Manual Therapies: Current Perspectives
Hinkeldey, N., Okamoto, C., Khan, J.
Physical medicine and rehabilitation clinics of North America, 2020/09

2082

EEG-Fokus: osteopathisch-manualmedizinische Therapie?
Paul, H., Heller, R.
Manuelle Medizin, 2020/09

2083

What Makes an Osteopathic Treatment Effective From a Patient's Perspective: A Descriptive Phenomenological Study
Consorti, G., Marchetti, A., De Marinis, M. G.
Journal of Manipulative and Physiological Therapeutics, 2020/09








2091

Finding a way between osteopathic principles and evidence-based practices: Response to Esteves et al
Ménard, M., Draper-Rodi, J., Merdy, O., Wagner, A., Tavernier, P., Jacquot, E., Mhadhbi, H.
International Journal of Osteopathic Medicine, 2020/09






2097

Osteopathie für Neugeborene in der Klinik?: Eine qualitative Studie
Osteopathy for newborns in hospitals?: A qualitative study
Brintrup, V., Hartmann, M., Herrmann, H., Belz, S., Esch, S.
Osteopathische Medizin, 2020/09

2098

Instrumentation used to assess pain in osteopathic interventions: A critical literature review
Santiago, R. J., Esteves, J., Baptista, J. S., Marques, A. T., Costa, J. T.
International Journal of Osteopathic Medicine, 2020/09



2101

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text


2103

Does Osteopathic Manipulative Treatment Induce Autonomic Changes in Healthy Participants? A Thermal Imaging Study
Cerritelli, F., Cardone, D., Pirino, A., Merla, A., Scoppa, F.
Frontiers in Neuroscience, 2020/08
Free full text

2104

Osteopathic Considerations for the Pregnant Patient with COVID-19
Gray, K. M., Murphy, L., Buckner, B.
The Journal of the American Osteopathic Association, 2020/08
Free full text

2105

Effectiveness of Osteopathic Manipulative Medicine vs Concussion Education in Treating Student Athletes With Acute Concussion Symptoms
Yao, S. C., Zwibel, H., Angelo, N., Leder, A., Mancini, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text

2106

Osteopathic Manipulative Treatment for Inhaled Rib Somatic Dysfunction
Koch, J., Tsui, C., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/08
Free full text

2107

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

2108

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text

2109

Osteopathic Medicine and the Osteoporosis Management Gap
Lowery, J. W., Baker, J., Gebhardt, G. P., Gorbis, S., Hoehn, A., Hum, J. M., Nelligan, L., Sefcik, D., Wacker, B., Wagner, A., Williams, D., Wright, A.
The Journal of the American Osteopathic Association, 2020/08
Free full text

2110

Treatment Modalities for Notalgia Paresthetica Including OMT
Cooley, D., McAree, M., Joshi, N., Peerzada, W.
Osteopathic Family Physician, 2020/08
Free full text

2111

Effects of Osteopathic Manipulative Treatment on Sleep Quality in Student Athletes After Concussion: A Pilot Study
Mazzeo, S., Silverberg, C., Oommen, T., Moya, D., Angelo, N., Zwibel, H., Mancini, J., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/08
Free full text

2112

Rib Somatic Dysfunction Among General Surgical Patients
Baltazar, G. A., Kolwitz, C. E., Florek, M. G.
The Journal of the American Osteopathic Association, 2020/08
Free full text

2113

Clinical Efficacy of Mesenteric Lift to Relieve Constipation in Traumatic Brain Injury Patients
Berry, J. A. D., Ogunlade, J., Kashyap, S., Berry, D. K., Wacker, M., Miulli, D. E., Saini, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

2114

Use of Osteopathic Manipulation for Treatment of Chronic Shoulder Injury Related to Vaccine Administration
Veera, S., Chin, J., Kleyn, L., Spinelli, S., Tafler, L.
Cureus, 2020/08
Free full text


2116

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07

2117

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text

2118

Perspectives on tissue adaptation related to allostatic load: scoping review and integrative hypothesis with a focus on osteopathic palpation
Lunghi, C., Consorti, G., Tramontano, M., Esteves, J. E., Cerritelli, F.
Journal of Bodywork and Movement Therapies, 2020/07

2119

Vestibular failure managed with osteopathic manipulative treatment: A report of two cases
Origo, D., Tarantino, A. G., Romagnoli, M.
Journal of Bodywork and Movement Therapies, 2020/07


2121

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07

2122

Services and staffing practices in academic health sciences libraries serving college of osteopathic medicine programs: a mixed methods study
Muellenbach, J. M., Duncan, W. C., Vanier, C., Ennis, L. A., Yang, A.
Journal of the Medical Library Association, 2020/07
Free full text

2123

Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Cicchitti, L., Di Lelio, A., Barlafante, G., Cozzolino, V., Di Valerio, S., Fusilli, P., Lucisano, G., Renzetti, C., Verzella, M., Rossi, M. C.
Medical sciences, 2020/07
Free full text

2124

Osteopathic Manipulation in the Management of Chronic Pain: Current Perspectives
Licciardone, J. C., Schultz, M. J., Amen, B.
Journal of Pain Research, 2020/07
Free full text


2126

Osteopathic Response to the COVID-19 Pandemic
Martinez, E., Redding, D.
The Journal of the American Osteopathic Association, 2020/07
Free full text

2127

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text



2130

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06


2132

Neuro-Ocular Release: A New Osteopathic Technique For Resolving Somatic Dysfunction
Feely, R. A., Smith, J. A.
The AAO Journal, 2020/06
Free full text

2133

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06

2134

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text


2136

Test der Faszienkompartimente
(Test for fascia compartments)
Lunghi, C.
Osteopathische Medizin, 2020/06


2138

Integrating Osteopathic Manipulative Treatment and Injections in the Diagnosis and Management of a Hip Labral Tear
Snyder, L. L., Knox, S. C., Smutny, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text


2140

Choosing Primary Care: Factors Influencing Graduating Osteopathic Medical Students
Stefani, K. M., Richards, J. R., Newman, J., Poole, K. G., Scott, S. C., Scheckel, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text

2141

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text

2142

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06

2143

Does Empathy Decline in the Clinical Phase of Medical Education? A Nationwide, Multi-Institutional, Cross-Sectional Study of Students at DO-Granting Medical Schools
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
Academic Medicine, 2020/06
Free full text

2144

Pain knowledge, attitudes and beliefs of Australian osteopaths drawn from a nationally representative sample of the profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Austin, P.
Journal of Bodywork and Movement Therapies, 2020/06




2148

The Spanish Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross-sectional survey
Alvarez, G., Roura, S., Cerritelli, F., Esteves, J. E., Verbeeck, J., van Dun, P. L. S.
PLoS ONE, 2020/06
Free full text


2150

Effects of Osteopathic Manipulative Treatment on Musicians: A Systematic Review
Kiepe, M. S., Fernholz, I., Schmidt, T., Brinkhaus, B., Schmidt, A., Weikert, C., Rotter, G.
Medical problems of performing artists, 2020/06

2151

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text




2155

PROMIS® General Life Satisfaction scale: construct validity in musculoskeletal pain patients
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/06
Free full text

2156

Efficacy of osteopathic manipulative treatment on postural control in Parkinsonian patients with Pisa syndrome: A pilot randomized placebo-controlled trial
Zarucchi, A., Vismara, L., Frazzitta, G., Mauro, A., Priano, L., Maestri, R., Bergna, A., Tarantino, A. G.
NeuroRehabilitation, 2020/06


2158

A subjective and objective analysis of the immediate effect of osteopathic manual treatment OMT on the golf swing
Maass, Z, Buffington, A, Miner, M, Hall, M
Clinical journal of sport medicine, 2020/06

2159

Practice Locations of Michigan Ophthalmologists as a Model to Compare Practice Patterns of DO and MD Surgical Subspecialists
Ahmed, H., Price, M. J., Robbins, W., Braich, P. S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

2160

Influence of Research on Osteopathic Medical Student Residency Match Success
Lowery, J. W., Hum, J. M., Obeime, I., Zahl, S., Parr, C. P., Larsen, B., King, T., Kisby, G.
The Journal of the American Osteopathic Association, 2020/06
Free full text










2170

Partnering With Patients to Reduce Firearm-Related Death and Injury
Ozuna, L., Champion, C., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/06
Free full text



2173

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

2174

Weekly Osteopathic Manipulative Treatment to Improve Measures of Sympathetic Tone in Women With Polycystic Ovary Syndrome: A Randomized, Controlled Pilot Study
Davis, S. E., Hendryx, J., Menezes, C., Bouwer, S., Menezes, H., Patel, V., Bostick Smith, C. A., Speelman, D. L.
The Journal of the American Osteopathic Association, 2020/05
Free full text

2175

Osteopathic Manipulative Medicine Practice Patterns of Third-Year and Fourth-Year Osteopathic Medical Students: An Educational Research Project
Snider, K. T., Couch, R., Bhatia, S.
The Journal of the American Osteopathic Association, 2020/05
Free full text

2176

Double Jeopardy: The USMLE for Osteopathic Medical Students
Ahmed, H., Carmody, J. B.
Academic Medicine, 2020/05
Free full text

2177

Evaluation of the stomatognathic system before and after osteopathic manipulative treatment in 120 healthy people by using surface electromyography
Manzotti, A., Viganoni, C., Lauritano, D., Bernasconi, S., Paparo, A., Risso, R., Nanussi, A.
International Journal of Environmental Research and Public Health, 2020/05
Free full text

2178

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text

2179

Osteopathie auf dem Prüfstand
[Osteopathy under scrutiny]
Dräger, K., Heller, R.
Bundesgesundheitsblatt Gesundheitsforschung Gesundheitsschutz, 2020/05



2182

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05

2183

Transitions in Undergraduate Medical Education
Baker, J., Wright, A.
The Journal of the American Osteopathic Association, 2020/05





2188

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04


2190

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04


2192

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text

2193

More Information on Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/04
Free full text

2194

Developing Neuraxial and Regional Pain Procedural Skills Through Innovative 3-Dimensional Printing Technology
Headman, Z. C., Matson, M. C., Schneider, R. P., Potter, J. L., Loguda-Summers, D. L., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2020/04
Free full text

2195

Osteopathic manipulative treatment combined with exercise improves pain and disability in individuals with non-specific chronic neck pain: A pragmatic randomized controlled trial
Groisman, S, Malysz, T, de Souza da Silva, L., Rocha Ribeiro Sanches, T., Camargo Bragante, K., Locatelli, F., Pontel Vigolo, C., Vaccari, S., Homercher Rosa Francisco, C., Monteiro Steigleder, S., Jotz, G. P.
Journal of Bodywork and Movement Therapies, 2020/04

2196

Relationship of Clinical Skills Performance in Medical School With COMLEX-USA Level 2-Performance Evaluation
Wang, S., Basehore, P.
The Journal of the American Osteopathic Association, 2020/04
Free full text

2197

Severe Postoperative Chronic Constipation Related to Anorectal Malformation Managed with Osteopathic Manipulative Treatment
Vismara, L., Cozzolino, V., Pradotto, L. G., Gentile, R., Tarantino, A. G.
Case Reports in Gastroenterology, 2020/04
Free full text

2198

Osteopathic Manipulative Treatment Relieves Post-concussion Symptoms in a Case of Polytrauma
Baltazar, G. A., Kolwitz, C., Petrone, P., Stright, A., Joseph, D'A.
Cureus, 2020/04
Free full text

2199

Inhibitory Tests as Assessment Tools for Somatic Dysfunctions: Mechanisms and Practical Applications
Bicalho, E., Vieira, L., Makita, D. K., Rivas, L.
Cureus, 2020/04
Free full text

2200

The Effect of High Velocity Low Amplitude Cervical Manipulations on the Musculoskeletal System: Literature Review
Giacalone, A., Febbi, M., Magnifica, F., Ruberti, E.
Cureus, 2020/04
Free full text

2201




2204

Effect of Osteopathic Manipulative Therapy on Generalized Anxiety Disorder
Dixon, L., Fotinos, K., Sherifi, E., Lokuge, S., Fine, A., Furtado, M., Anand, L., Liberatore, K., Katzman, M. A.
The Journal of the American Osteopathic Association, 2020/03
Free full text


2206

Educating Leaders 2019: Abstracts From AACOM's Annual Conference
listed, No authors
The Journal of the American Osteopathic Association, 2020/03
Free full text

2207

An osteopathic approach to Graves’ ophthalmopathy: A case report
McDermott, G., Qureshi, Y., Foster-Moumoutjis, G., Espejo, A.
International Journal of Osteopathic Medicine, 2020/03

2208

Transitions: Our Own, Our Patients’, Our Profession’s
Newman, D.B.
The AAO Journal, 2020/03
Free full text

2209

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text

2210

A new perspective for Somatic Dysfunction in Osteopathy: the Variability Model
Bergna, A., Vismara, L., Parravicini, G., Farra, F.
Journal of Bodywork and Movement Therapies, 2020/03

2211

Assessment and Management of Somatic Dysfunctions in Patients With Patellofemoral Pain Syndrome
Tramontano, M., Pagnotta, S., Lunghi, C., Manzo, C., Manzo, F., Consolo, S., Manzo, V.
The Journal of the American Osteopathic Association, 2020/03
Free full text


2213

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text

2214

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text

2215

Characteristics and Treatment of Pediatric Patients in an Osteopathic Manipulative Medicine Clinic
Kaiser, G., Degenhardt, B. F., Michael Menke, J., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/03
Free full text

2216

La prise en charge de la douleur testiculaire chronique due a un syndrome de charniere thoraco-lombaire : étude pilote
(Management of chronic testicular pain due to thoracolumbar junction syndrome: A pilot study)
Aoun, F., Malek, E., Kazan, D., Albisinni, S., Peltier, A., Bollens, R., Roumeguère, T.
Progres en urologie : journal de l'Association francaise d'urologie et de la Societe francaise d'urologie, 2020/03

2217

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text

2218

Life satisfaction and musculoskeletal complaints in a population seeking osteopathy care: consecutive sample of 611 patients
Vaughan, B., Mulcahy, J., Allen, T., Coupe, E., Gobbo, D., Nasser, L., Pain, K., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/03


2220

Pre-professional reflective practice: Strategies, perspectives and experiences
McLeod, G. A., Vaughan, B., Carey, I., Shannon, T., Winn, E.
International Journal of Osteopathic Medicine, 2020/03

2221

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text


2223

Osteopathic Manipulative Medical Assistant: A Proposed Allied Profession
Lennon, J. L.
The Journal of the American Osteopathic Association, 2020/02
Free full text


2225

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text

2226

Effect of manual approaches with osteopathic modality on brain correlates of interoception: an fMRI study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Perrucci, M. G., Barassi, G., Visciano, C., Bellomo, R. G., Saggini, R., Ferretti, A.
Scientific Reports, 2020/02
Free full text

2227

Osteopathic Medical Care With and Without Osteopathic Manipulative Treatment in Patients With Chronic Low Back Pain: A Pain Registry-Based Study
Licciardone, J. C., Gatchel, R. J.
The Journal of the American Osteopathic Association, 2020/02
Free full text


2229

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01



2232

Perceptions of the osteopathic profession in New York City’s Chinese Communities
Chin, J., Li, S., Yim, G., Zhou, Y. Q., Wan, P., Dube, E., Volokitin, M., Sahni, S., Terrell, M., Lomiguen, C.
Family Medicine and Community Health, 2020/01
Free full text

2233

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text



2236

The labor study: Labor length and birth outcomes osteopathic research
Martingano, D., Mitrofanova, A., Kim, A. F., Ulfers, A., Mersch, M., Stevenson, R., Singh, S.
American Journal of Obstetrics & Gynecology, 2020/01

2237

Preserving osteopathic antiquity through historical pamphlets and postcards
Fitterling, L. A., Oro, R.
Journal of the Medical Library Association, 2020/01

2238

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01

2239

Tratamento manipulativo osteopático em Unidade de Terapia Intensiva Neonatal / Osteopathic manipulative treatment in a neonatal intensive care unit
(Osteopathic manipulative treatment in a neonatal intensive care unit)
dos Santos Varela, A. P. A., Yasojima, E. Y., Gonçalves, H. M. T., Silvestre, L. C., Tannus, L. O.
Brazilian Journals Publicações de Periódicos e Editora Ltda, 2020/01


2241

The use of complementary medicine in palliative care in France: an observational cross-sectional study
Filbet, M., Schloss, J., Maret, J.-B., Diezel, H., Palmgren, P. J., Steel, A.
Supportive care in cancer, 2020/01

2242

Determinants of health, health behaviours and demographic profile of patients attending an Australian university student-led osteopathy clinic
Vaughan, B., Fitzgerald, K., Fleischmann, M., Mulcahy, J.
Chiropractic & Manual Therapies, 2020/01
Free full text

2243

Isometric osteopathic manipulation influences on cervical ranges of motion and correlation with osteopathic palpatory diagnosis: A randomized trial
Niewiadomski, C., Bianco, R. J., Arnoux, P. J., Evin, M.
Complementary Therapies in Medicine, 2020/01

2244

Burnout, Perceived Stress, Sleep Quality, and Smartphone Use: A Survey of Osteopathic Medical Students
Brubaker, J. R., Beverly, E. A.
The Journal of the American Osteopathic Association, 2020/01
Free full text

2245

Lateral Strain Patterns at the Sphenobasilar Synchondrosis
Burruano, M. P.
The Journal of the American Osteopathic Association, 2020/01
Free full text

2246

Im Gespräch mit … Professor Karl-Ludwig Resch
(In dialog with...Professor Karl-Ludwig Resch)
Engemann, K. Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01



2249

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020



2252

Who Uses Osteopathic Manipulative Treatment? A Prospective, Observational Study Conducted by DO-Touch.NET
Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2019/12
Free full text

2253

Impact of Predoctoral Teaching Fellows on Osteopathic Medical Students: A Near-Peer Teaching Program Evaluation
Akers, B., Davis, G., Keys, J., Pierce-Talsma, S. L., Lund, G.
The AAO Journal, 2019/12
Free full text

2254

Influence of Future Prescribers’ Personal and Clinical Experiences With Opioids on Plans to Treat Patients With Opioid Use Disorder
Mort, S. C., Díaz, S. R., Miller, C., Bowlby, M., Henderson, D., Beverly, E. A.
The Journal of the American Osteopathic Association, 2019/12
Free full text

2255





2259

Impact of osteopathic manipulative treatment on range of motion of the pelvis during the one-sided tilt test: a pilot study
Menard, M., Ferrari, M., Bouchet, A., Puchaud, P., Vaucher, P., Sutre, F., Bideau, B., Bourgin, M.
HAL CCSD Taylor & Francis, 2019/12
Free full text

2260

Self-directed learning and practice of Italian osteopathic students during summer break: a cross-sectional survey
D'Alessandro, G., Consorti, G., Cerritelli, F.
BMC Complementary and Alternative Medicine, 2019/12
Free full text

2261

Complaint risk among mental health practitioners compared with physical health practitioners: A retrospective cohort study of complaints to health regulators in Australia
Veness, B. G., Tibble, H., Grenyer, B. F., Morris, J. M., Spittal, M. J., Nash, L., Studdert, D. M., Bismark, M. M.
BMJ Open, 2019/12
Free full text


2263

Constipation in Parkinson’s Disease Improved by an Osteopathic Manipulative Medicine Sequence in a Repeated Measures Study
Valasareddi, S., Mathai, M., Li, T. S., Yao, S. C., Mancini, J.
The Journal of the American Osteopathic Association, 2019/12








2271

Developing “Migraneous” Rat Models to Evaluate the Efficacy of OMT on Various Migraine Biomarkers
Byrd, K. E., Gregory, C., Krishna, S., Xie, J. Y., Fleming, R. K.
The Journal of the American Osteopathic Association, 2019/12

2272

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12

2273

Perceptions and Awareness of Osteopathic Medicine Among Students in Other Health Professions
Dyches, R. P., Ruck, L. D., Stein, A. B., Gailius, G. C., Worden, K.
The Journal of the American Osteopathic Association, 2019/12


2275

Meditation and Empathy in Osteopathic Medical Students: A Longitudinal Randomized Controlled Trial
Krishnamachari, B., Ramya, P., Shermon, S., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2019/12

2276

Osteopathic Medical Students: Promoting Physical Activity
Law, A., Hollar, L., Sklar, E., Sprague, P.
The Journal of the American Osteopathic Association, 2019/12

2277

Osteopathic Manipulative Medicine Vs Counseling in the Treatment of Sports-Related Concussion: Comparative Balance Assessment
Morris, J. Z., Shah, J., Zwibel, H., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12


2279

The Effect of OMM on Opioid Users with Chronic Low Back Pain
Patel, K. C., Cooley, D. L., Bailey, J. W., Janora, D. M., Fusco, C.
The Journal of the American Osteopathic Association, 2019/12

2280

The Efficacy of Osteopathic Manipulative Treatment on Decreasing the Severity of Migraine Headaches
Rhoads, A., Metzgar, M. M., Donovan, P.
The Journal of the American Osteopathic Association, 2019/12

2281

The Efficacy of Treating Thoracic Cage Counterstrain Tender Points With Varied Mobile Point Time Durations in a Classroom Setting
Smith, J. M., Docherty, J., Kooyman, P., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12



2284

Efecto de la Osteopatía sobre el sistema nervioso autónomo mediante interpretación de la variabilidad
(Effect of osteopathy on the autonomic nervous system through interpretation of variability)
Llinás, A. S. J., Rausell, J. M. S., Escobio Prieto, I.
European Journal Osteopathy & Related Clinical Research, 2019/12
Free full text


2286

Tratamiento osteopático en la infertilidad femenina
(Osteopathic treatment for female infertility)
Vázquez, A., Ortega, D.
European Journal Osteopathy & Related Clinical Research, 2019/12

2287

Myofascial Release for Vulvar Pain and Pubic Shear After a Straddle Injury in a 3-Year-Old Girl
Dade, M. M., Broecker, J. D.
The Journal of the American Osteopathic Association, 2019/11
Free full text

2288

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text

2289

The Role of Mental Imagery in Osteopathic Palpation: a qualitative study
Kraml, M. M., Besse, J.P.
European Journal of Osteopathic Research, 2019/11
Free full text

2290

Effectiveness of the muscle energy technique on respiratory muscle strength and endurance in patients with fibromyalgia
Uysal, S. C., Tuzun, E. H., Eker, L., Angin, E.
Journal of Back and Musculoskeletal Rehabilitation, 2019/11
Free full text

2291

Experience with and perception of research among first year osteopathic medical students
Jackson, K., Ogunbekun, O., Zahl, S., Lowery, J.
Poster presentation, 2019/11

2292

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11

2293

Osteopathic manipulative medicine to improve balance and quality of life in parkinson disease
Yao, S., Docherty, J., Mancini, J., Leder, A., DiFrancisco-Donoghue, J.
Movement Disorders, 2019/11

2294

The Effect of Osteopathic Manual Treatment on Concussion Injury Rehabilitation
Henderson, L. D.
Unpublished MSc thesis, 2019/11
Free full text



2297

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text




2301

Effectiveness of an osteopathic treatment on the autonomic nervous system: a systematic review of the literature
Rechberger, V., Biberschick, M., Porthun, J.
European Journal of Medical Research, 2019/10
Free full text


2303

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10

2304

Medical Students' Knowledge About Children With Disabilities, Special Education Laws, and Social Services: A Preliminary Scale Development and Pilot Study
Vitalone-Raccaro, N., Sheppard, M. E., Kaari, J. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text

2305

Understanding the role of osteopathic manipulative medicine in the management of gastrointestinal disorders and symptoms: a survey study
Shah, R. N., Diehl, D. L., Graham, J., Kim, A. H., Loughlin, M. T.
The American Journal of Gastroenterology, 2019/10
Free full text

2306

Effects of Osteopathic Visceral Treatment in Patients with Gastroesophageal Reflux: A Randomized Controlled Trial
Eguaras, N., Rodriguez-Lopez, E. S., Lopez-Dicastillo, O., Franco-Sierra, M. A., Ricard, F., Oliva-Pascual-Vaca, A.
Journal of Clinical Medicine, 2019/10


2308

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10





2313

Osteopathic Manipulative Treatment for Allostatic Load Lowering
Nuno, V., Siu, A., Deol, N., Juster, R. P.
The Journal of the American Osteopathic Association, 2019/10
Free full text


2315

Does Compression of the Fourth Ventricle Cause Preterm Labor? Analysis of Data From the PROMOTE Study
Hensel, K. L., Roane, B. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text


2317

Engaging with evidence-based practice in the osteopathy clinical learning environment: A mixed methods pilot study
Vaughan, B., Grace, S., Gray, B., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2019/09


2319

Developing teamwork skills in pre-registration osteopathy education: A qualitative pilot investigation
Vaughan, B., Grace, S., Yoxall, J.
International Journal of Osteopathic Medicine, 2019/09



2322

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text

2323

Evaluating the Influence of Research on Match Success for Osteopathic and Allopathic Applicants to Residency Programs
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M., Roberts, M. B.
The Journal of the American Osteopathic Association, 2019/09
Free full text

2324

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text

2325

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09

2326

Osteopathic Approach for Lateral Knee Pain Caused by Iliotibial Band Friction Syndrome: A Case Report
Kostanjevec, J., Fleming, R. K.
The AAO Journal, 2019/09
Free full text


2328

Student Perceived Value of Reading Assignments During Mandatory Clerkship-Years OMM Course
Lewis, D. D., Pickos, J. J.
The AAO Journal, 2019/09
Free full text

2329

Osteopathic approach with a patient undergoing cardiac transplantation: the five diaphragms
Bordoni, B., Morabito, B., Simonelli, M., Nicoletti, L., Rinaldi, R., Tobbi, F., Caiazzo, P.
International medical case reports journal, 2019/09
Free full text

2330

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy in somatoform disorders - Systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
Free full text

2331

Patient Education of Osteopathic Manipulative Medicine as a Gateway to Treatment: A Pilot Study
Majetich, S. A., Majetich, M. W., Clegg, J. M., Ratay, S. M.
The AAO Journal, 2019/09
Free full text

2332

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

2333

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09


2335

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text


2337

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09

2338

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09


2340

Temporomandibuläre Dysfunktion (TMD) mit Diskusprolaps
(Temporomandibular dysfunction (TMD) with discus prolapse: Case study on the efficacy of osteopathic treatment)
Vathrakokoilis, K., Liem, T., Aetopoulos, I., Antoniadis, K., Triantafyllidou, E.
Osteopathische Medizin, 2019/09

2341

Enhancing Culturally Sensitive Curriculum in an Osteopathic Medical School
Lopez-Hernandez, G. Y.
Missouri Medicine, 2019/09
Free full text

2342

Osteopathic Manipulation Treatment Improves Cerebro-splanchnic Oximetry in Late Preterm Infants
Marinelli, B., Pluchinotta, F., Cozzolino, V., Barlafante, G., Strozzi, M. C., Marinelli, E., Franchini, S., Gazzolo, D.
Molecules, 2019/09
Free full text

2343

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text

2344

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text

2345

Expanding options: Supporting skills transfer from a post-graduate osteopathy program to clinical practice
Macfarlane, C., Cornall, D.
International Journal of Osteopathic Medicine, 2019/09

2346

A Literature Review of Osteopathic Manipulative Techniques for Otalgia
Lindsey, T., Lawson, R., Hiffernan, F.
Osteopathic Family Physician, 2019/09


2348

Fascial Nomenclature: An Update
Bordoni, B., Walkowski, S., Morabito, B., Varacallo, M. A.
Cureus, 2019/09
Free full text

2349

Introduction to Clerkship: Bridging the Gap Between Preclinical and Clinical Medical Education
Butts, C. A., Speer, J. J., Brady, J. J., Stephenson, R. J., Langenau, E., DiTomasso, R., Fresa, K., Becker, M., Sesso, A.
The Journal of the American Osteopathic Association, 2019/09

2350

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy for somatoform disorders - a systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

2351

Using the Multitheory Model to Predict Initiation and Sustenance of Physical Activity Behavior Among Osteopathic Medical Students
Nahar, V. K., Wilkerson, A. H., Stephens, P. M., Kim, R. W., Sharma, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

2352

Ergojump evaluation of the explosive strength in volleyball athletes pre- and post-fascial treatment
Buscemi, A., Petralia, M. C., Ramaci, T., Rapisarda, A., Provazza, C., Di Corrado, D., Perciavalle, V., Perciavalle, V., Coco, M.
Experimental and Therapeutic Medicine, 2019/08
Free full text

2353

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

2354

Influence of Osteopathic Medical Students’ Personal Health on Attitudes Toward Counseling Obese Pediatric Patients
Whipps, J., Mort, S. C., Beverly, E. A., Guseman, E. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text

2355

Efficacy of osteopathic treatment in patients with stable moderate-to-severe chronic obstructive pulmonary disease: a randomized controlled pilot study
Buscemi, A., Pennisi, V., Rapisarda, A., Pennisi, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2019/08

2356

Muscle energy technique for chronic obstructive pulmonary disease: a systematic review
Baxter, D. A., Shergis, J. L., Fazalbhoy, A., Coyle, M. E.
Chiropractic & Manual Therapies, 2019/08

2357

Empathy in Medicine Osteopathic and Allopathic Physician Interpersonal Manner, Empathy, and Communication Style and Clinical Status of Their Patients: A Pain Registry-Based Study
Licciardone, J. C., Schmitt, M. E., Aryal, S.
The Journal of the American Osteopathic Association, 2019/08
Free full text

2358

Assessment of shoulder pain and somatic dysfunction in young competitive swimmers: Preventive Osteopathic Manipulative Treatment
Granger, F., Etevenard, M., Kily, J. P., Garet, M.
Journal of Sports Medicine and Therapy, 2019/08
Free full text

2359

Osteopathic Manipulative Therapy in Patients With Chronic Tension-Type Headache: A Pilot Study
Deodato, M., Guolo, F., Monticco, A., Fornari, M., Manganotti, P., Granato, A.
The Journal of the American Osteopathic Association, 2019/08

2360

Stretch Receptor and Somatic Dysfunction: A Narrative Review
Andrews, M. A. W.
The Journal of the American Osteopathic Association, 2019/08


2362

Effects of Post-Isometric Relaxation on Ankle Plantarflexion and Timed Flutter Kick in Pediatric Competitive Swimmers
Noto-Bell, L., Vogel, B. N., Senn, D. E.
The Journal of the American Osteopathic Association, 2019/08

2363

Novel Approach to Introducing an Ultrasonography Curriculum With Limited Instructor Resources
Evans, D. K., Thiessen, M. E. W.
The Journal of the American Osteopathic Association, 2019/08
Free full text

2364

Empathy in Medicine National Norms for the Jefferson Scale of Empathy: A Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text

2365

Understanding Myalgic Encephalomyelitis/Chronic Fatigue Syndrome and the Emerging Osteopathic Approach: A Narrative Review
Larrimore, C., Ramnot, A., Jaghab, A., Sarduy, S., Guerrero, G., Troccoli, P., Hilton, K., Bested, A.
The Journal of the American Osteopathic Association, 2019/07
Free full text

2366

OMT for the Prevention and Management of Chronic Constipation and Distal Intestinal Obstructive Syndrome in Cystic Fibrosis: A Pilot Study
Modlin, S. E., Borofka, K., Franzini, D., Klene-Bowns, A. C., Nuño, V. A.
The Journal of the American Osteopathic Association, 2019/07
Free full text

2367

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text

2368

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07

2369

WVSOM Anatomy Lab Tour Program: An Osteopathic Medicine Pipeline With Student Teaching Opportunities
Wines, K. S.
The Journal of the American Osteopathic Association, 2019/07
Free full text

2370

Student academic performance factors affecting matching into first-choice residency and competitive specialties
Mitsouras, K., Dong, F., Safaoui, M. N., Helf, S. C.
BMC Medical Education, 2019/07
Free full text



2373

Simulation can offer a sustainable contribution to clinical education in osteopathy
Fitzgerald, K. M., Denning, T., Vaughan, B., Fleischmann, M. J., Jolly, B. C.
Chiropractic & Manual Therapies, 2019/07
Free full text




2377

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text








2385

Effect of Osteopathic Obstetrical Management on the Duration of Labor in the Inpatient Setting: A Prospective Study and Literature Review
Martingano, D., Ho, S., Rogoff, S., Chang, G., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2019/06
Free full text



2388


2389

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06


2391

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06

2392

Integrated pilot medical study on 40 patients affected by open angle glaucoma undergoing topical therapy with additional osteopathic manipulation
Paoli, D., Brusini, P., Michelin, L., Vassallo, F., Ciullo, L., Torelli, L.
Acta Ophthalmologica, 2019/06


2394

Do empathic osteopaths achieve better clinical results? An observational feasibility study
Acquati, A., Uberti, S., Aquino, A., Cerasetti, E., Castagna, C., Rovere-Querini, P., Pisa, V.
International Journal of Osteopathic Medicine, 2019/06

2395

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text

2396

Identifying a need and knowledge gap of osteopathic medicine in pediatric oncology providers
Belsky, J., Stanek, J., Gerhardt, C., Rose, M.
Pediatric Blood & Cancer, 2019/06


2398

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06


2400

Patient experience, satisfaction, perception and expectation of osteopathic manipulative treatment: A systematic review
Lam, M. T., Banihashem, M., Lam, H. R., Wan, A. B., Chow, E.
International Journal of Osteopathic Medicine, 2019/06

2401

The role of osteopathic complementary treatment in high frequency paediatric headache: a randomised controlled study
Rossi, R., Versace, A., Lauria, B., Grasso, G., Bagagiolo, D., Cappitella, E., Altieri, R., Delli Santi, M., Scarinzi, C., Urbino, A. F.
Neurological Sciences, 2019/06

2402

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text


2404

Learning and teaching of patient-centred communication skills in allied healthcare manual therapy students: A systematic review
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2019/06


2406

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06

2407

Osteopathic Approach to the Treatment of a Patient With an Atypical Presentation of Coccydynia
Alexandre, K., Channell, M. K.
The Journal of the American Osteopathic Association, 2019/06
Free full text

2408

Integrating Osteopathic Philosophy in Cancer Care
Brown, Z. J., Martin, S. P., Carman, R.
The Journal of the American Osteopathic Association, 2019/06
Free full text


2410

Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Levy, V. J., Holt, C. T., Haskins, A. E.
The Journal of the American Osteopathic Association, 2019/05
Free full text


2412

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text

2413

Survey of Osteopathic Medical Students Regarding Physician Shadowing Experiences Before and During Medical School Training
Langenau, E., Frank, S. B., Calardo, S. J., Roberts, M. B.
Journal of Medical Education and Curricular Development, 2019/05
Free full text

2414

A National Evaluation of Scholarly Activity Requirement in Osteopathic EM Residency Programs: Survey of EM Program Directors
Kirkpatrick, A., Doran, T., Mullins, D., Gnugnoli, D., Ashurst, J.
Southern Medical Journal, 2019/05

2415

Cynefin Framework for Evidence-Informed Clinical Reasoning and Decision-Making
Lunghi, C., Baroni, F.
The Journal of the American Osteopathic Association, 2019/05
Free full text


2417

Cranial Osteopathy: Obscurantism and Enlightenment
Bordoni, B., Morabito, B., Simonelli, M.
Cureus, 2019/05

2418

The Other Side of the Fascia: Visceral Fascia, Part 2
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05

2419

The Other Side of the Fascia: The Smooth Muscle Part 1
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
Free full text

2420

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05

2421

Can Osteopathic Medical Students Accurately Measure Abdominal Aortic Dimensions Using Handheld Ultrasonography Devices in the Primary Care Setting?
Hower, K., Young, C. F., Wagner, A., Thorsen, D., Dugan, J.
The Journal of the American Osteopathic Association, 2019/05
Free full text


2423

Role of Debt and Loan Forgiveness/Repayment Programs in Osteopathic Medical Graduates' Plans to Enter Primary Care
Scheckel, C. J., Richards, J., Newman, J. R., Kunz, M., Fangman, B., Mi, L., Poole, K. G.
The Journal of the American Osteopathic Association, 2019/04
Free full text

2424

Manual therapy for musculoskeletal pain in cystic fibrosis: Review of the literature
Graziano, L., Giordani, B., Nico, D., Colella, E., Savi, D., Cimino, G., Di Vito, A., Valente, D., Palange, P.
Italian Journal of Pediatrics, 2019/04

2425

Comprehensive Medical College Admission Test Preparatory Course as a Strategy to Encourage Premedical Students to Pursue Osteopathic Medicine in Rural Areas
Shipley, T. W., Phu, N., Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2019/04
Free full text

2426

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text

2427

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text


2429

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text


2431

Manipulasjonsteknikker ved nakkeasymmetri hos spedbarn
(Manipulation techniques for infant torticollis)
Brurberg, K. G., Dahm, K. T., Kirkehei, I.
Tidsskrift for den Norske Laegeforening, 2019/04
Free full text

2432

Allopathic supervision of osteopathic education: What support is needed?
James, S. J., Zakletskaia, L:
Osteopathic Family Physician, 2019/04

2433

Empathy, Religious Affiliation, and the Growth of Osteopathic Medicine
Cunningham, B.
Unpublished PhD thesis, 2019/04
Free full text

2434

Effects of osteopathic manipulative treatment on patients with multiple sclerosis: A pilot study
Porcari, B., Russo, M., Naro, A., La Via, C., Pullia, M., Accorinti, M., De Luca, R., Calabro, R. S.
Complementary Therapies in Medicine, 2019/04

2435

Timing of oral feeding changes in premature infants who underwent osteopathic manipulative treatment
Vismara, L., Manzotti, A., Tarantino, A. G., Bianchi, G., Nonis, A., La Rocca, S., Lombardi, E., Lista, G., Agosti, M.
Complementary Therapies in Medicine, 2019/04

2436

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text

2437

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04

2438

Osteopathic Manipulative Treatment as a Novel Way to Manage Postvasectomy Pain Syndrome
Gray, R. E., Kasper, K.
The Journal of the American Osteopathic Association, 2019/04
Free full text


2440

Patient satisfaction and perception of treatment in a student-led osteopathy teaching clinic: Evaluating questionnaire dimensionality and internal structure, and outcomes
Vaughan, B., Burns, C., Burridge, L., Wigger, J., Blair, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2019/03

2441

Osteopathic Structural Findings in Women During Menstruation
Cabrera, K. L., Darwish, A. M., Lurz, K. L., L., McClain. R., McClain, E., Cox, J., Segars, L.
The AAO Journal, 2019/03
Free full text




2445

Rescued Root Canal: A Case Report on OMT for Jaw Pain Following Repeat Root Canal Procedure
Fong, K. F., Rummel, T. B.
The AAO Journal, 2019/03
Free full text




2449

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text



2452

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text

2453

Osteopathie bei Bone Bruise
(Osteopathy for bone bruise)
Bick, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03

2454

Reflecting on new models for osteopathy – it's time for change
Smith, D.
International Journal of Osteopathic Medicine, 2019/03

2455

The River of Life: Flüssigkeiten in der Osteopathie
(The river of life: fluids in osteopathy)
Mayer-Fally, E., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03

2456

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03


2458

Manual therapy for the pediatric population: a systematic review
Parnell Prevost, C., Gleberzon, B., Carleo, B., Anderson, K., Cark, M., Pohlman, K. A.
BMC Complementary and Alternative Medicine, 2019/03
Free full text


2460

Dancers’ experience of osteopathy and their attitudes towards dance injuries
Maddren, K.
Unpublished MSc thesis, 2019/03
Free full text

2461

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text

2462

Does somatic dysfunction lead to lower extremity injuries in the high school soccer player?
Wisinski, J., Lipp, T., Dougherty, J. J.
Clinical Journal of Sport Medicine, 2019/03

2463

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03

2464

Short-term effectiveness of the flexion-distraction technique in comparison with high-velocity vertebral manipulation in patients suffering from low-back pain
Carrasco-Martínez, F., Ibáñez-Vera, A. J., Martínez-Amat, A., Hita-Contreras, F., Lomas-Vega, R.
Complementary Therapies in Medicine, 2019/03

2465

Effects of Practicing Osteopathic Manipulative Treatment (OMT) on Hand Function
Barnum, I. F. O., Chang, M. E., Patterson, R. M., Surve, S.
UNTHSC Scholarly Repository, 2019/03


2467

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text

2468

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text

2469

Osteopathic Manipulative Treatment: A Primary Care Approach
Bodine, W. A.
American Family Physician, 2019/02

2470

Assessment of the Efficacy of An Osteopathic Treatment in Infants with Biomechanical Impairments to Suckling
Herzhaft-LeRoy, J., Xhignesse, M., Gaboury, I.
Journal of Visualized Experiments, 2019/02

2471

Osteopathic Manipulative Treatment for Pertussis in the 19th and 20th Centuries: A Structured Historical Literature Review
Liem, T.
The Journal of the American Osteopathic Association, 2019/02
Free full text


2473

Evaluating Patient's Understanding of Pain Neurophysiology: Rasch Analysis of the Neurophysiology of Pain Questionnaire
Vaughan, B., Mulcahy, J., Fitzgerald, K., Austin, P.
The Clinical Journal of Pain, 2019/02

2474

Medical Degree Disparity Among Authors in Obstetrics and Gynecology Journals
Merritt, B., Simunich, T., Ashurst, J.
The Journal of the American Osteopathic Association, 2019/02
Free full text

2475

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text

2476

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text

2477

Back to the Roots: Palpation
(Back to the Roots: Palpation)
Eulenberg, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

2478

Zentralbahnhof Thorax
(Central station: thorax)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01


2480

Nonpharmacologic Management of Symptoms in Females With Polycystic Ovary Syndrome: A Narrative Review
Speelman, D. L.
The Journal of the American Osteopathic Association, 2019/01
Free full text

2481

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text

2482

The Italian Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross sectional survey
Cerritelli, F., van Dun, P. L. S., Esteves, J. E., Consorti, G., Sciomachen, P., Lacorte, E., Vanacore, N.
PLoS One, 2019/01
Free full text

2483

Ultrasound Evaluation of Diaphragmatic Mobility and Contractility After Osteopathic Manipulative Techniques in Healthy Volunteers: A Prospective, Randomized, Double-Blinded Clinical Trial
Mancini, D., Cesari, M., Lunghi, C., Benigni, A. M., Antonelli Incalzi, R., Scarlata, S.
Journal of Manipulative and Physiological Therapeutics, 2019/01

2484

Women’s experiences of osteopathic care whilst living with endometriosis
Waugh, M. D.
Unpublished MSc thesis, 2019/01
Free full text

2485

Investigating interpretation of ACC claims in an osteopathy teaching clinic
Urgert, C.
Unpublished MSc thesis, 2019/01
Free full text

2486

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01

2487

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text

2488

Osteopathic Physical Exam Findings in Chronic Hepatitis C: A Case Study
Chin, J., Francis, M., Lavalliere, J. M., Lomiguen, C. M.
Cureus, 2019/01
Free full text

2489

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text

2490

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text

2491

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12

2492

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text

2493

Exodus From the Classroom: Student Perceptions, Lecture Capture Technology, and the Inception of On-Demand Preclinical Medical Education
Ikonne, U., Campbell, A. M., Whelihan, K. E., Bay, R. C., Lewis, J. H.
The Journal of the American Osteopathic Association, 2018/12

2494

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text

2495

An overview of osteopathy graduates' perceived preparedness at transition from educational environment to clinic environment one year after graduation: a cross sectional study
Luciani, E., Consorti, G., van Dun, P. L. S., Merdy, O., Lunghi, C., Petracca, M., Esteves, J. E., Cerritelli, F.
BMC Medical Education, 2018/12
Free full text

2496

Attitudes, skills and use of evidence-based practice among UK osteopaths: a national cross-sectional survey
Sundberg, T., Leach, M. J., Thomson, O. P., Austin, P., Fryer, G., Adams, J.
BMC Musculoskeletal Disorders, 2018/12
Free full text

2497

Effect of the soft-tissue techniques in the quality of life in patients with Crohn's disease: A randomized controlled trial
Espi-Lopez, G. V., Ingles, M., Soliva-Cazaban, I., Serra-Ano, P.
Medicine (Baltimore), 2018/12
Free full text

2498

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

2499

Can lateral epicondylitis be relief by osteopathic treatments targeting tensions from the thoracic region? Results of a case study
Brisson-Larouche, A., Kassab, G., Wehbe, W.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

2500

Effect of global osteopathic treatment on functional mobility in the parkinsonian patient: A quasi-experimental study
Devantéry, K., Bouchard, J.C.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

2501

The effect of early osteopathic manual treatment (OMT) care, after vaginal delivery, on pelvic health recovery
Fafard, A.M.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text


2503

Assessing the immediate behavioural responses of hospitalized preterm babies during osteopathic manipulative treatment (OMT): A case series
O'Connor, S., Lafrenaye, S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

2504

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text


2506

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text

2507

First-year osteopathic students' use and perceptions of complementary video-based learning
Tripodi, N.
International Journal of Osteopathic Medicine, 2018/12

2508

Osteopaticheskaia korrektsiia v kompleksnoi terapii i reabilitatsii patsientov s sindromom pozvonochnoi arterii.
Belash, V. O., Mokhov, D. E., Tregubova, E. S.
Voprosy Kurortologii, Fizioterapii, i Lechebnoi Fizicheskoi Kultury, 2018/12


2510

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

2511

Effect of Osteopathic Visceral Manipulation on Pain, Cervical Range of Motion, and Upper Trapezius Muscle Activity in Patients with Chronic Nonspecific Neck Pain and Functional Dyspepsia: A Randomized, Double-Blind, Placebo-Controlled Pilot Study
Silva, A. C. O., Biasotto-Gonzalez, D. A., Oliveira, F. H. M., Andrade, A. O., Gomes, Cafp, Lanza, F. C., Amorim, C. F., Politti, F.
Evidence-based Complementary and Alternative Medicine, 2018/11
Free full text

2512

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text

2513

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text

2514

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text

2515

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text

2516


2517

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
The Journal of the American Osteopathic Association, 2018/11

2518

The Effect of Osteopathic Manipulative Medicine on Oxidative Stress Following Mild Traumatic Brain Injury: A Pilot Study
Angelo, N., Mazzeo, S., Oommen, T., Zwibel, H., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

2519



2521

The Effect of Osteopathic Manipulative Treatment on Reactive Oxygen Species in Parkinson Disease
Docherty, J., Chu, K., Orshan, D., Kulason, K., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

2522

The Influence of Medical School Debt on Specialty Choice: An Analysis of Colleges of Osteopathic Medicine
Dyches, R. P., Speicher, M. R.
The Journal of the American Osteopathic Association, 2018/11


2524

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

2525


2526

Managing Tremor in Parkinson Disease Using Osteopathic Manipulative Medicine
Li, R., Docherty, J., Koo, S. L., Shinners, J., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

2527

Patient Perceptions of Osteopathic and Allopathic Physician Communication Style and Empathy and Reported Satisfaction with Low Back Care
Licciardone, J. C., Schmitt, M. E.
The Journal of the American Osteopathic Association, 2018/11

2528

Current Trends in COMLEX-USA Level 1 and Level 2-CE Study Resources
McMurray, M., Bires, S.
The Journal of the American Osteopathic Association, 2018/11

2529

Integration of Pressure Sensors in Lumbar Palpation Education
Panchmatia, J. H., Docherty, J., Kooyman, P., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

2530

Using Wearable Technology to Measure the Effectiveness of Osteopathic Manipulative Treatment on Parkinson Disease Motor Symptoms
Poon, J., Docherty, J., Mancini, J., DiFrancisco-Donoghue, J., Cheriyan, G., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

2531

Where Comfort and Confidence Diverge: Missed Opportunities for Sexual and Gender Minority Competency in Osteopathic Education
Rashid, H., Schenck-Smith, N., Weirich, E., Lenox, A., Sheikh, H., Boesler, D.
The Journal of the American Osteopathic Association, 2018/11

2532

Structure and Function in Medical Education: Trend Analysis of Osteopathic Medical Student Emotional Intelligence (EI) Suggests Curricular Modifications May Improve Functional Traits
Singer-Chang, G., Dong, F., Nevins, N., Seffinger, M., Blumer, J., Darmani, N., Helf, S.
The Journal of the American Osteopathic Association, 2018/11

2533

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11

2534

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text

2535

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text

2536

Professional trust in osteopathy: a theory for educational practice
Mackay Tumber, L.
Unpublished Dissertation, 2018/10
Free full text


2538

An Osteopathic Approach to Diagnosis and Management of Sacroiliac Joint Dysfunction
Glover, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/10
Free full text

2539

Outpatient satisfaction with osteopathic manipulative treatment in a hospital center: A survey
Tramontano, M., Cinnera, A. M., Petracca, M., Gaeta, A., Tamburella, F., Audouard, M., Caltagirone, C.
Alternative Therapies in Health and Medicine, 2018/10

2540

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text

2541

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10

2542

Association Between Performance on COMLEX-USA and the American College of Osteopathic Family Physicians In-Service Examination
Hudson, K. M., Feinberg, G., Hempstead, L., Zipp, C., Gimpel, J. R., Wang, Y.
Journal of Graduate Medical Education, 2018/10
Free full text



2545

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text


2547

Osteopathic Evaluation of Urinary Retention Caused by Atypical Presentation of Invasive Cervical Cancer Mimicking Primary Urothelial Tumor
Martingano, D., Ramirez, L. C., Bjurlin, M. A.
The Journal of the American Osteopathic Association, 2018/10
Free full text

2548

Meralgia paresthetica: A 5 model osteopathic approach
Torrents, M., Malik, R.
Osteopathic Family Physician, 2018/10
Free full text

2549

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10


2551

Validity of the Rule of Threes and Anatomical Relationships in the Thoracic Spine
Oakley, C. K., Janssen, S. A. K., Pankratz, J. P., McCumber, T. L., Treffer, K. D., Olinger, A. B.
The Journal of the American Osteopathic Association, 2018/10
Free full text


2553

A Short Review of the Treatment of Headaches Using Osteopathic Manipulative Treatment
Whalen, J., Yao, S., Leder, A.
Current Pain and Headache Reports, 2018/10

2554

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text

2555

An Osteopathic Approach to Rib Somatic Dysfunction in Respiratory Disorders
Pierce-Talsma, S., Talsma, J., Ferrill, H.
The Journal of the American Osteopathic Association, 2018/10
Free full text

2556

Empathy and Osteopathic Manipulative Medicine: Is It All in the Hands?
Rizkalla, M. N., Henderson, K. K.
The Journal of the American Osteopathic Association, 2018/09
Free full text

2557

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text

2558

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09

2559

It depends on how things are to you
Vogel, S.
International Journal of Osteopathic Medicine, 2018/09
Free full text

2560

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09


2562

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09




2566

Osteopathic Manipulative Treatment Including Specific Diaphragm Techniques Improves Pain and Disability in Chronic Nonspecific Low Back Pain: A Randomized Trial
Marti-Salvador, M., Hidalgo-Moreno, L., Domenech-Fernandez, J., Lison, J. F., Arguisuelas, M. D.
Archives of Physical Medicine and Rehabilitation, 2018/09

2567

Learning through multiple lenses: analysis of self, peer, near-peer and faculty assessment of a clinical history taking task in Australia
Fitzgerald, K., Vaughan, B.
Journal of Educational Evaluation for Health Professions, 2018/09
Free full text

2568

Primary care physicians' attitude and reported prescribing behavior for chronic low back pain: An exploratory cross-sectional study
Rodondi, P. Y., Dubois, J., Bill, A. S., Koutaissoff, D., Ros, J., Aveni, E., Pasquier, J., Herzig, L., Decosterd, I., Burnand, B.
PLoS One, 2018/09
Free full text

2569

The role of osteopathy in the Swiss primary health care system: a practice review
Vaucher, P., Macdonald, R. J. D., Carnes, D.
BMJ Open, 2018/09
Free full text


2571


2572

Is digital image correlation able to detect any mechanical effect of cranial osteopathic manipulation? – A preliminary study
Pellet, M., Chenel, A., Behr, M., Thollon, L.
International Journal of Osteopathic Medicine, 2018/09

2573

Association of Mindfulness With Residency Preference and Curriculum Selection in Preclinical Osteopathic Medical Students
Nayyar, N., Saggio, G., Plummer, M., Jung, M. K., Kappenberg, J.
The Journal of the American Osteopathic Association, 2018/09
Free full text

2574

History of Research at Midwestern University/Chicago College of Osteopathic Medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2018/09
Free full text


2576

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text


2578

Efectividad del tratamiento osteopático en el síndrome del túnel carpiano
(Effectiveness of osteopathic treatment in carpal tunnel syndrome)
Bueno Fleirez, M.
European Journal Osteopathy & Related Clinical Research, 2018/09
Free full text


2580

Design and development of an e-learning programme: An illustrative commentary
Draper-Rodi, J., Vogel, S., Bishop, A.
International Journal of Osteopathic Medicine, 2018/09

2581

Osteopathic Manipulative Therapy and Multiple Sclerosis: A Proof-of-Concept Study
Cordano, C., Armezzani, A., Veroni, J., Pardini, M., Sassos, D., Infante, M. T., Tacchino, A., Lapucci, C., Cellerino, M., Calabro, V., Ciullo, L., Nourbakhsh, B.
The Journal of the American Osteopathic Association, 2018/08
Free full text

2582

Effectiveness of an Osteopathic Abdominal Manual Intervention in Pain Thresholds, Lumbopelvic Mobility, and Posture in Women with Chronic Functional Constipation
Martinez-Ochoa, M. J., Fernandez-Dominguez, J. C., Morales-Asencio, J. M., Gonzalez-Iglesias, J., Ricard, F., Oliva-Pascual-Vaca, A.
The Journal of Alternative and Complementary Medicine, 2018/08

2583

Sleep and Lifestyle Habits of Osteopathic Emergency Medicine Residents During Training
Hughes, K. E., Hughes, P. G., Hughes, M. J.
The Journal of the American Osteopathic Association, 2018/08
Free full text

2584

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
listed, , No authors
The Journal of the American Osteopathic Association, 2018/08
Free full text

2585

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text

2586

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text

2587

Evaluating the effectiveness of teaching osteopathy in a combined didactics setting
Eilerman, A., Keller, M. E., Hixson, D., II, Gupta
Osteopathic Family Physician, 2018/08

2588

Medical Infrared Thermography in back pain osteopathic management
Polidori, G., Kinne, M., Mereu, T., Beaumont, F., Kinne, M.
Complementary Therapies in Medicine, 2018/08

2589

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text

2590

Resident Duty Hour Restrictions: The Implications Behind the New Data Ahead of the Single Accreditation System
Berry, A. C., McClain, E. K.
The Journal of the American Osteopathic Association, 2018/08
Free full text

2591

Quantitative Description of Osteopathic Physician Authorship in Prominent Neurosurgery Journals Since 1944: Coming of Age?
Cuoco, J. A., Busch, C. M., Rogers, C. M., Guilliams, E. L., Klein, B. J., Howes, G. A., Marvin, E. A.
Cureus, 2018/08
Free full text

2592

Progressive Infantile Scoliosis Managed With Osteopathic Manipulative Treatment Response
Feely, R. A., Kapraun, H. E.
The Journal of the American Osteopathic Association, 2018/07
Free full text

2593

Treatment of bilateral dyshidrotic eczema with drugs versus nutritional and osteopathic treatment
Aceranti, A., Vernocchi, S.
Italian Journal of Medicine, 2018/07
Free full text

2594

Oral Health Training in Osteopathic Medical Schools: Results of a National Survey
Simon, L., Silk, H., Savageau, J., Sullivan, K., Riedy, C.
The Journal of the American Osteopathic Association, 2018/07
Free full text

2595

Osteopathic Lymphatic Pump Techniques
Franzini, D., Cuny, L. A., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/07
Free full text

2596

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text

2597

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07

2598

Medical Students' Knowledge, Attitudes, and Behaviors With Regard to Skin Cancer and Sun-Protective Behaviors
Ivanov, N. N., Swan, A., Guseman, E. H., Whipps, J., Jensen, L. L., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text

2599

Role of osteopathic manipulative treatment in cystic fibrosis: A pilot study
Fainardi, V., Benecchi, S., Longo, F., Tripodi, M. C., Villani, M. L., Teopompi, E., Chetta, A. A., Pisi, G.
Journal of Cystic Fibrosis, 2018/07

2600

Use of complementary health approaches at military treatment facilities, active component, U.S. Armed Forces, 2010-2015
Williams, V. F., Clark, L. L., McNellis, M. G.
Medical Surveillance Monthly Report, 2018/07


2602

UK trained osteopaths' relationship to evidence based practice - An analysis of influencing factors
Weber, V., Rajendran, D.
International Journal of Osteopathic Medicine, 2018/07

2603

Lymphatic Pump Treatment Mobilizes Bioactive Lymph That Suppresses Macrophage Activity In Vitro
Castillo, R., Schander, A., Hodge, L. M.
The Journal of the American Osteopathic Association, 2018/07
Free full text

2604

Osteopathic Manipulative Therapy Potentiates Motor Cortical Plasticity
Ponzo, V., Cinnera, A. M., Mommo, F., Caltagirone, C., Koch, G., Tramontano, M.
The Journal of the American Osteopathic Association, 2018/06
Free full text

2605

Blood pressure screening in an Australian osteopathy student-led clinic
Vaughan, B., Cannon, N., Davies, D., Kourtis, N., Neophitou, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2018/06


2607

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text

2608


2609

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text

2610

First-Year Osteopathic Medical Students' Knowledge of and Attitudes Toward Physical Activity
Guseman, E. H., Whipps, J., Howe, C. A., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/06
Free full text

2611

Osteopathic Cranial Manipulative Medicine in the Setting of Concussion
Warren, C., Keys, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/06
Free full text

2612

Osteopathic manipulative treatment for post mastectomy pain: A case report
Downey, H. F.
International Journal of Osteopathic Medicine, 2018/06

2613

The Lancet Low Back pain series: A call to action for osteopathy?
Fitzgerald, K., Vaughan, B., Austin, P., Grace, S., Orchard, D., Orrock, P.l, Fleischmann, M.
International Journal of Osteopathic Medicine, 2018/06


2615

Clinical reasoning in osteopathy: Experiences of novice and experienced practitioners
King, L., Kremser, S., Deam, P., Henry, J., Reid, D., Orrock, P., Grace, S.
International Journal of Osteopathic Medicine, 2018/06

2616

Musculoskeletal Education in Medical Schools: A Survey of Allopathic and Osteopathic Medical Students
Sabesan, V. J., Schrotenboer, A., Habeck, J., Lombardo, D., Stine, S., Jildeh, T. R., Meiyappan, A.
Journal of the American Academy of Orthopaedic Surgeons. Global research & reviews, 2018/06
Free full text

2617

Anastamosis
Ackert, K.
The Journal of the American Osteopathic Association, 2018/06
Free full text



2620

Reducing Health Disparities: Understanding the Unintended Effects of Health Care Professional and Patient Characteristics on Treatment
Nazione, S., Nazione, A.
The Journal of the American Osteopathic Association, 2018/06
Free full text

2621

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text




2625


2626

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05

2627

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects
Abdelfattah, A., Abdelraoof, N., Nasef, S.
Internal Medicine Journal, 2018/05
Free full text

2628

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05

2629


2630

Myofascial Release Therapy Beneficial for Patients With Chronic Low Back Pain
Jazayeri, S., Seffinger, M.
The Journal of the American Osteopathic Association, 2018/05
Free full text


2632

Fibromyalgia Symptoms Reduced by Osteopathic Manipulative Medicine and Gabapentin
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

2633

Osteopathic Manipulation Shown to Improve Upper Airway Stabilization
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

2634

Cervical Osteopathic Manipulation Shown to Affect Median Nerve Function
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

2635

Manipulation and mobilization for treating chronic low back pain: a systematic review and meta-analysis
Coulter, I. D., Crawford, C., Hurwitz, E. L., Vernon, H., Khorsan, R., Suttorp Booth, M., Herman, P. M.
The Spine Journal, 2018/05
Free full text

2636

The perceptions and experiences of osteopathic treatment among cancer patients in palliative care: a qualitative study
Steel, A., Tricou, C., Monsarrat, T., Ruer, M., Deslandes, C., Sisoix, C., Filbet, M.
Supportive Care in Cancer, 2018/05


2638

Faculty Vitality in Osteopathic Medical Schools: A Pilot Study
Ables, A. Z., Shan, L., Broyles, I. L.
The Journal of the American Osteopathic Association, 2018/05
Free full text

2639

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

2640

Restoration of Full Shoulder Range of Motion After Application of the Fascial Distortion Model
Boucher, J. D., Figueroa, J.
The Journal of the American Osteopathic Association, 2018/05
Free full text

2641

Factors Associated With Osteopathic Primary Care Residency Choice Decisions
Dogbey, G. Y., Collins, K., Russ, R., Brannan, G. D., Mivsek, M., Sewell, S.
The Journal of the American Osteopathic Association, 2018/04
Free full text

2642

Appendix 2: American Osteopathic Association Specialty Board Certification
Wieting, J. M., Williams, D. G., Kelly, K. A., Morales-Egizi, L.
The Journal of the American Osteopathic Association, 2018/04
Free full text

2643

Neck-stomach syndrome in the cervical spondylosis: An update on preliminary 2017 data
Ramieri, A., Miscusi, M., Costanzo, G.
European Spine Journal, 2018/04

2644

Fibromyalgia with Gabapentin and Osteopathic Manipulative Medicine: A Pilot Study
Marske, C., Bernard, N., Palacios, A., Wheeler, C., Preiss, B., Brown, M., Bhattacharya, S., Klapstein, G.
The Journal of Alternative and Complementary Medicine, 2018/04



2647

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text

2648

How type and number of training sessions influence the reliability of palpation
Lavazza, C., Milano, V., Abenavoli, A., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2018/04

2649

Osteopathic manipulative treatment in chronic coccydynia: A case series
Origo, D., Tarantino, A. G., Nonis, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2018/04

2650

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04

2651

The immediate effect of osteopathic cervical spine mobilization on median nerve mechanosensitivity: A triple-blind, randomized, placebo-controlled trial
Whelan, G., Johnston, R., Millward, C., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2018/04

2652

Profile of osteopathic practice in Spain: Results from a standardized data collection study
Alvarez Bustins, G., López Plaza, P. V., Carvajal, S. R.
BMC Complementary and Alternative Medicine, 2018/04
Free full text

2653

IGeL-Monitor. Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text

2654

Assessment Considerations for Core Entrustable Professional Activities for Entering Residency
Linsenmeyer, M., Wimsatt, L., Speicher, M., Powers, J., Miller, S., Katsaros, E.
The Journal of the American Osteopathic Association, 2018/04
Free full text



2657

Educational Intervention in a Medically Underserved Area
Atance, J., Mickalis, M., Kincade, B.
The Journal of the American Osteopathic Association, 2018/04
Free full text

2658

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text

2659

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text

2660

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03

2661

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03

2662

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03


2664

Rethinking Superior and Inferior Sacroiliac Shear: A New Approach to Diagnosis and Treatment
Goldman, S. I., van Buskirk, R. L.
The AAO Journal, 2018/03
Free full text



2667

Characterizing Adverse Events Reported After Osteopathic Manipulative Treatment
Degenhardt, B. F., Johnson, J. C., Brooks, W. J., Norman, L.
The Journal of the American Osteopathic Association, 2018/03
Free full text

2668

Increasing Self-Awareness of Medical Students Through the Use of Ultrasonography
Sandefur, K., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text

2669

Shaping conservative spinal services with the Spine Tango Registry
Morris, S., Booth, J.
European spine journal, 2018/03

2670

The Safety of Osteopathic Manipulative Treatment (OMT)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/03
Free full text

2671

Influence of Transverse Process Landmark Localization on Palpation Accuracy of Lumbar Spine Models
Snider, E. J., Pamperin, K., Pazdernik, V., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text

2672

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text

2673

OMT for Patients With Sacral Somatic Dysfunction
Yu, K., Pfotenhauer, K., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/03
Free full text

2674

Der achtsame A.T. Still
(The mindful A.T. Still)
Schötta, M.
Unpublished MSc thesis, 2018/03
Free full text

2675

Tool for Predicting Medical Student Burnout From Sustained Stress Levels: Factor Analysis of the Medical Education Hassles Scale-R
Johnson, J. C., Degenhardt, B. F., Smith, C. K., Wolf, T. M., Peterson, D. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text


2677

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text

2678

A Mokken scale analysis of the peer physical examination questionnaire
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2018/03
Free full text

2679

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text


2681

Work-related musculoskeletal injuries among Australian osteopaths: A preliminary investigation
McLeod, G. A., Murphy, M., Henare, T. M., Dlabik, B.
International Journal of Osteopathic Medicine, 2018/03


2683

Pre-entry qualifications as predictors of success in first year osteopathic education
Palfreyman, S., Mercier, J., Friedlander, T.
International Journal of Osteopathic Medicine, 2018/03

2684

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03

2685

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text



2688

The effects of osteopathic treatment on psychosocial factors in people with persistent pain: A systematic review
Saracutu, M., Rance, J., Davies, H., Edwards, D. J.
International Journal of Osteopathic Medicine, 2018/03

2689

Morphogenese
(Morphogenesis)
Leitner, M.
Unpublished MSc thesis, 2018/03
Free full text



2692

Terapia manual como tratamiento en pacientes con coccigodinia
(Manual therapy as treatment for patients with coccygodynia)
Guimaraens, F. I.
European Journal Osteopathy & Related Clinical Research, 2018/03
Free full text


2694

OMT to Address the Physiologic Effects of Stress
Emmet, D., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/02
Free full text

2695

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text

2696


2697

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text

2698

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

2699

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text

2700

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text

2701

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text

2702

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text

2703

Conceptualizing Addiction From an Osteopathic Perspective: Dopamine Homeostasis
Baron, D., Blum, K., Chen, A., Gold, M., Badgaiyan, R. D.
The Journal of the American Osteopathic Association, 2018/02
Free full text


2705

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

2706

Effect of Ultrasonography on Student Learning of Shoulder Anatomy and Landmarks
de Vries, K. D., Brown, R., Mazzie, J., Jung, M. K., Yao, S. C., Terzella, M. J.
The Journal of the American Osteopathic Association, 2018/01
Free full text


2708

Chronic Pain Management: Perspective of an Osteopathic Medical Student in New Mexico
Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2709

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2710

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2711

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2712

Effects of spinal manipulation and myofascial techniques on heart rate variability: A systematic review
Amoroso Borges, B. L., Bortolazzo, G. L., Neto, H. P.
Journal of Bodywork and Movement Therapies, 2018/01

2713

OMT May Be Helpful in the Management of Benign Paroxysmal Positional Vertigo
Tegeler, L., Blumer, J.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2714

Postural and autonomic modifications following osteopathic manipulative treatment (OMT): Comparison between two techniques. A pilot study
Scoppa, F., Pirino, A., Belloni, G., Gallamini, M., Messina, G., Iovane, A.
Acta Medica Mediterranea, 2018/01
Free full text

2715

Lymphatic Vessels Found in the Brain-Osteopathic Considerations, Part 2: Now in Humans and Monkeys
King, H. H.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2716

OSTMED.DR(R), an Osteopathic Medicine Digital Library
Fitterling, L., Powers, E., Vardell, E.
Medical reference services quarterly, 2018/01

2717

Manual therapy for unsettled, distressed and excessively crying infants: a systematic review and meta-analyses
Carnes, D., Plunkett, A., Ellwood, J., Miles, C.
BMJ Open, 2018/01
Free full text

2718

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01

2719

Gross Anatomy Education Today: The Integration of Traditional and Innovative Methodologies
Houser, J. J., Kondrashov, P.
Missouri Medicine, 2018/01
Free full text

2720

Combined osteopathy and exercise management of Achilles tendinopathy in an athlete
Ross, G., Macfarlane, C., Vaughan, B.
The Journal of Sports Medicine and Physical Fitness, 2018/01


2722

Osteopathic Medical Education: Answering the Call
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2723

Gratitude: Reflections and Belonging in the Osteopathic Family
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2724

Osteopathy as an Aid to Treatment
Riedel, M.
Deutsches Ärzteblatt International, 2018/01
Free full text

2725

Safety of Osteopathic Cranial Manipulative Medicine as an Adjunct to Conventional Postconcussion Symptom Management: A Pilot Study
Patel, K. G., Sabini, R. C.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2726

OMT for Cancer Patients After Bowel Resection
Pena, N., Prieto, H., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text

2727

Level of evidence and quality of reports of cranial and visceral osteopathic treatment trials
Morin, C., Gaboury, I.
Global Advances in Health and Medicine, 2018


2729

Tratamiento osteopático en el asma
(Osteopathic treatment for asthma)
Martínez Fernández, J. A.
European Journal Osteopathy & Related Clinical Research, 2017/9
Free full text

2730

Técnica de thrust para disfunción unilateral anterior del cóndilo occipital
(Thrust technique for unilateral anterior occipital condyle dysfunction)
Rausell, J. M. S., Escobio Prieto, I.
European Journal Osteopathy & Related Clinical Research, 2017/9


2732

Efectos del tratamiento osteopático global en sujetos con disfunción de la ATM
(Effects of comprehensive osteopathic treatment in patients with TMJ dysfunction)
Mejías López, G., Nuñez Prado, M. J., Jiménez De Ory, I., Rodriguez López, E. S.
European Journal Osteopathy & Related Clinical Research, 2017/6
Free full text

2733

La hipertensión arterial y la osteopatía: consideraciones generales
(High Blood Pressure and Osteopathy: General Considerations)
Ruiz Fernández, P. M., Rodríguez Blanco, C.
European Journal Osteopathy & Related Clinical Research, 2017/6
Free full text

2734

Neurobiology of Sexual Assault and Osteopathic Considerations for Trauma-Informed Care and Practice
Cuevas, K. M., Balbo, J., Duval, K., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/12
Free full text

2735


2736

Palpatory and Ultrasound Assessment of Cervical Dysfunctions and the Effect of Cervical High-Velocity, Low-Amplitude (HVLA) Technique
Flaum, T. B., Mirza, A., Rusnack, F. M-A., Apoznanski, T. E., Munarova, A., Mazzie, J., Terzella, M. J., Yao, S. C.
The AAO Journal, 2017/12
Free full text




2740

OMT for Patients With Multiple Sclerosis
Wolf, K., Krinard, T., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text


2742

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12

2743

Predictors of Osteopathic Medical Students' Readiness to Use Health Information Technology
Jacobs, R. J., Iqbal, H., Rana, A. M., Rana, Z., Kane, M. N.
The Journal of the American Osteopathic Association, 2017/12
Free full text


2745

Simulated learning activities as part replacement of clinical placements in osteopathy: A case study
Fitzgerald, K., Denning, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2017/12

2746

Let's get physical!
Hickner, J.
The Journal of Family Practice, 2017/12

2747

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text

2748

Osteopathic manipulative treatment for post mastectomy lymphedema: A case report
Goyal, M, Goyal, K, Narkeesh, K., Samuel, A. J., Arumugam, N.
International Journal of Osteopathic Medicine, 2017/12

2749

Osteopathic Manipulative Treatment for the Management of Adjacent Segment Pathology
Lewis, D. D., Summers, G. K.
The Journal of the American Osteopathic Association, 2017/12
Free full text


2751

Influence of perceived difficulty of cases on student osteopaths' diagnostic reasoning: a cross sectional study
Noyer, A. L., Esteves, J. E., Thomson, O. P.
Chiropractic & Manual Therapies, 2017/12
Free full text

2752

What are the risks of manual treatment of the spine? A scoping review for clinicians
Swait, G., Finch, R.
Chiropractic & Manual Therapies, 2017/12
Free full text

2753

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text

2754

Defining Osteopathic Continuing Medical Education
Loveless, B.
The Journal of the American Osteopathic Association, 2017/12
Free full text



2757

Complementary and alternative therapies in dentistry and characteristics of dentists who recommend them
Baatsch, B., Zimmer, S., Rodrigues Recchia, D., Bussing, A.
Complementary Therapies in Medicine, 2017/12

2758



2760

Challenging Case of Parotitis: A Comprehensive Approach
Patel, P., Scott, S., Cunningham, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text

2761

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text


2763

Descriptive study of interprofessional collaboration between physicians and osteopaths for the pediatric population in Quebec, Canada
Morin, C., Desrosiers, J., Gaboury, I.
BMC Health Services Research, 2017/11
Free full text


2765

Comparing the Effect of Osteopathic Manipulative Medicine Versus Concussion Education for the Acute Treatment of Mild Concussion Symptoms
Angelo, N., Zwibel, H., Leder, A., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11

2766

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2017/11

2767

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11


2769

Empathy in Residency Years
Impens, A. J., Henderson, K., Rizkalla, M. N., Ivlovic, K.
The Journal of the American Osteopathic Association, 2017/11

2770

Touro California Student-Run Free Clinic: An Investigation of Actual vs Target Patient Demographic and the Impact of Osteopathic Manipulative Medicine in the Vallejo, California, Community
Jamall, S., Ang, B., Kimpo, J. V., Liu, B., Donn, E., Szeto, H., Devanney, J., Pearce, M.
The Journal of the American Osteopathic Association, 2017/11

2771

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
The Journal of the American Osteopathic Association, 2017/11

2772

Evolving Practice Settings for Osteopathic Graduates: How Debt Influences Anticipated Career Path
Kunz, M., Richards, J., Scheckel, C., Newman, J., Poole, K., Mi, L.
The Journal of the American Osteopathic Association, 2017/11

2773

Osteopathic Manipulative Treatment Reduces Oxidative Stress Levels and Improves Relative Stiffness and Quality of Life in Parkinson Disease
Moriarty, S. A., Lu, V., Oommen, C., Bellavia, L. M., Lee, J. M., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11

2774

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text

2775

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text

2776

Evaluation of New Zealand osteopathy patients experiences of their treatment
Judkins, R., Vaughan, B., Mulcahy, J.
Complementary Therapies in Clinical Practice, 2017/11

2777

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text

2778

Condylar Decompression Technique for Infants
Pierce-Talsma, S., Pena, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text


2780

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text

2781

Entry of Medical School Graduates Into Family Medicine Residencies: 2016-2017
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text

2782

Results of the 2017 National Resident Matching Program(R) and the American Osteopathic Association Intern/Resident Registration Program
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text

2783

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text

2784

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10

2785

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

2786

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text


2788

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10

2789

Work related musculoskeletal injuries sustained by Australian osteopaths: qualitative analysis of effects on practitioner health, clinical practice, and patient care
McLeod, G. A., Annels, K., Cohen, J., Edwards, S., Hodgins, D., Vaughan, B.
Chiropractic & Manual Therapies, 2017/10
Free full text






2795

Osteopathic management of chronic constipation in women patients. Results of a pilot study
Belvaux, A., Bouchoucha, M., Benamouzig, R.
Clinics and Research in Hepatology and Gastroenterology, 2017/10








2803

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text

2804

An observational study of ultrasound to confirm cervical spine segmental positional rotation
Flaum, T. B., Rusnack, F. M., Mirza, A., Apoznanski, T. E., Munarova, A., Mazzie, J. P., Terzella, M.l J., Yao, S. C.
International Journal of Osteopathic Medicine, 2017/09/01/

2805

Mother Still
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

2806

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text

2807

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09






2813

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

2814

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

2815

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09

2816

What Osteopathic Physicians Do
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2017/09
Free full text


2818

Pennsylvania Otolaryngologists as a Model for the Implications of Practice Location of Osteopathic vs Allopathic Surgical Subspecialists
Griffith, S., Power, A., Strand, M.
The Journal of the American Osteopathic Association, 2017/09
Free full text



2821

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09


2823

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text

2824

Scheinselbstständigkeit in der osteopathischen Praxis
(False self-employment in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
Free full text

2825

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text


2827

Raum und Weite im Lernfeld Osteopathie
(Space and width in the learning field of osteopathy)
Brown, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09


2829

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09

2830

Clinical Preceptors' Perceptions of Empathy: The Empathy in Osteopathic Training and Education (EMOTE) Study
Davis, G. E., Hartwig, W. C., McTighe, A. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

2831

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

2832

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text

2833

Fundamentals for an Osteopathic Obesity Designed Study: The Effects of Education on Osteopathic Medical Students' Attitudes Regarding Obesity
Gayer, G. G., Weiss, J., Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

2834

In Reply to Buser and to Shannon
Cummings, M.
Academic Medicine, 2017/08
Free full text

2835

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text

2836

Diagnostic reliability of osteopathic tests: A systematic review
Basile, F., Scionti, R., Petracca, M.
International Journal of Osteopathic Medicine, 2017/08

2837

Corrigendum to “Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research“ [Musculoskelet. Sci. Pract. 27 165-175]
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/08


2839

Conservative management of a traumatic meniscal injury utilising osteopathy and exercise rehabilitation: A case report
Feehan, J., Macfarlane, C., Vaughan, B.
Complementary Therapies in Medicine, 2017/08

2840

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

2841

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text



2844

Efficacy of Osteopathic Manipulative Treatment Approach in the Patient with Pulmonary Fibrosis in Critical Care Outpatient Department
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Arumugam, N., Chatterjee, S., Sharma, S.
Indian Journal of Critical Care Medicine, 2017/07
Free full text

2845

The effectiveness of osteopathic manipulative treatment in an abnormal uterine bleeding related pain and health related quality of life (HR-QoL) - A case report
Goyal, K., Goyal, M., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S., Arumugam, N.
Journal of Bodywork and Movement Therapies, 2017/07

2846

Hypnosis and Osteopathic Manipulative Treatment for Visual Disorders During Pregnancy: A Case Report
Russo, G., Remonato, A., Remonato, R., Zanier, E.
Advances in Mind-Body Medicine, 2017/07

2847

Interexaminer reliability study of a standardized myofascial diagnostic technique of the superior thoracic inlet
Hutchinson, D., Hines, S., Vijayaraghavan, N., Sammond, A., Metzler-Wilson, K., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2017/07


2849

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text

2850

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

2851

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

2852

Osteopathic Approach to Anxiety
Blumer, T.., Blumer, J.
Osteopathic Family Physician, 2017/07
Free full text

2853

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text

2854

Assessment of Research Interests of First-Year Osteopathic Medical Students
Carter, L., McClellan, N., McFaul, D., Massey, B., Guenther, E., Kisby, G.
The Journal of the American Osteopathic Association, 2017/07
Free full text


2856

Effects of Osteopathic Manipulative Therapy on Pain and Mood Disorders in Patients With High-Frequency Migraine
D'Ippolito, M., Tramontano, M., Buzzi, M. G.
The Journal of the American Osteopathic Association, 2017/06
Free full text

2857

Osteopathic manipulative treatment in soccer players with chronic groin pain: a pilot study
Nolli, L., Baraggiolo, S., PaganiI, M, Origo, D., Bergna, A., Vismara, L.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2017/06



2860

(Osteopathic approaches for endometriosis)
Ott, S.
Osteopathische Medizin, 2017/06

2861

Efficacy of an eccentric osteopathic manipulation treatment in somatic tinnitus
Goyal, M., Sharma, S., Baisakhiya, N., Goyal, K.
Indian Journal of Otology, 2017/06


2863

Diaphragm postural function in injured subtalar joint
Urbaniak, M., Kisilewicz, A., Klich, S.
Physiotherapy Quarterly, 2017/06

2864

Schwindel bei Tubenkatarrh nach Otitis media
(Vertigo in tubal catarrh after otitis media)
Schneider, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06

2865

Use of the Fascial Distortion Model to Evaluate a Limp in a Child
James, S. J., Hudnall, J.
The Journal of the American Osteopathic Association, 2017/06
Free full text



2868

Reply to the letter to the editor: 'Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment'
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/06

2869

Osteopathic medical students entering family medicine and attitudes regarding osteopathic manipulative treatment: Preliminary findings of differences by sex
Baker, H. H., Linsenmeyer, M., Ridpath, L. C., Bauer, L. J., Foster, R. W.
The Journal of the American Osteopathic Association, 2017/06
Free full text

2870

Difference in R01 Grant Funding Among Osteopathic and Allopathic Emergency Physicians over the Last Decade
Antony, M., Savino, J., Ashurst, J.
Western Journal of Emergency Medicine, 2017/06
Free full text

2871

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06

2872

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text


2874

Osteopathische Behandlungen nach Karpaltunneloperation – eine randomisierte kontrollierte Studie
(Osteopathic treatments after carpal tunnel surgery - A randomized controlled trial)
Deutschmann, G., Porthun, J., Grabner, O., Leskowschek, H., Graff, W., Sammer, A., Safran, T.
Osteopathische Medizin, 2017/06

2875

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text

2876

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06


2878

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text


2880

Osteopathic manipulation of the ankle improves spinal flexibility in elite alpine skiers: a pilot study
Parisio, C., Vismara, L., Micotti, V., Cimolin, V., Aprile, D., Cavigioli, M., Panzeri, A., Manzotti, A., Galli, M., Capodaglio, P.
Gazzetta Medica Italiana Archivio Per Le Scienze Mediche, 2017/05

2881

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text

2882

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text

2883

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text

2884

A descriptive, cross-sectional study of medical student preferences for vodcast design, format and pedagogical approach
Pettit, R. K., Kinney, M., McCoy, L.
BMC Medical Education, 2017/05
Free full text

2885

Addition of Osteopathic Visceral Manipulation to OMT for Low Back Pain Decreases Pain and Increases Quality of Life
King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text

2886

Effects of Osteopathic Treatment on Postural Equilibrium Evaluated through a Stabilometric Platform: A Randomized and Controlled Study
Buscemi, A., Cannatella, M., Lutrario, P., Rapisarda, A., Di Gregorio, G., Coco, M.
Journal of Functional Morphology and Kinesiology, 2017/05
Free full text


2888

Osteopathic Manipulative Treatment During the Third Trimester of Pregnancy
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2017/05
Free full text

2889

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text

2890

Response to “Contribution of Osteopathic Training to the Primary Care Workforce“
Kozakowski, S. M., Travis, A., Bentley, A., Fetter, G.
Family Medicine, 2017/04
Free full text

2891

Contribution of Osteopathic Training to the Primary Care Workforce
Malouin, R. A., Keenum, A.
Family Medicine, 2017/04
Free full text

2892

Evidence-Based Redesign of the COMLEX-USA Series
Gimpel, J. R., Horber, D., Sandella, J. M., Knebl, J. A., Thornburg, J. E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

2893

A efetividade do tratamento osteopático na constipação intestinal: uma revisão sistemática
(Effectiveness of the ostheopatic treatment in intestinal constipation: A systematic review)
Rocha Do Vale, J., De Carvalho, H. F. B., Andrade, V. L. Â, Almeida, L. C.
GED - Gastrenterologia Endoscopia Digestiva, 2017/04

2894


2895

Residency Program Directors' Interview Methods and Satisfaction With Resident Selection Across Multiple Specialties
VanOrder, T., Robbins, W., Zemper, E.
The Journal of the American Osteopathic Association, 2017/04
Free full text


2897

Attitudes of Family Medicine Program Directors Toward Osteopathic Residents Under the Single Accreditation System
Hempstead, L. K., Shaffer, T. D., Williams, K. B., Arnold, L. C.
The Journal of the American Osteopathic Association, 2017/04
Free full text

2898


2899

Biological effects of direct and indirect manipulation of the fascial system. Narrative review
Parravicini, G., Bergna, A.
Journal of Bodywork and Movement Therapies, 2017/04


2901

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text


2903

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

2904

Can the Humanities Humanize Health Care?
Baltonado, J., Cymet, T.
The Journal of the American Osteopathic Association, 2017/04
Free full text

2905

Changes in Osteopathic Medical Education: The Journey Continues
McClain, E. K.
The Journal of the American Osteopathic Association, 2017/04
Free full text



2908

Opening the Doors of Medicine to Women
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/03
Free full text

2909

Use of the Spencer Technique on Collegiate Baseball Players: Effect on Physical Performance and Self-Report Measures
Curcio, J. E., Grana, M. J., England, S., Banyas, P. M., Palmer, B. D., Placke, A. E., Rieck, W. A., Jr., Eade
The Journal of the American Osteopathic Association, 2017/03
Free full text

2910

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text



2913

Osteopathic Manipulative Treatment in the Management of Isaacs Syndrome
Shanahan, L. K. T., Raines, S. G., Coggins, R. L., Moore, T., Carnes, M., Griffin, L.
The Journal of the American Osteopathic Association, 2017/03
Free full text

2914

A Qualitative, Interview-Based Study of the Health Policy Fellowship's Osteopathic Identity
Skinner, D., Franz, B.
The Journal of the American Osteopathic Association, 2017/03
Free full text

2915

Efficacy of Myofascial Unwinding and Myofascial Release Technique in a Patient with Somatic Symptoms - A Case Report
Goyal, M., Goyal, K., Bathla, M., Kanimozhi, D., Narkeesh, D.
Indian journal of Psychological Medicine, 2017/03
Free full text

2916

Impact of osteopathic therapy on proprioceptive balance and quality of life in patients with dizziness
Papa, L., Amodio, A., Biffi, F., Mandara, A.
Journal of Bodywork and Movement Therapies, 2017/03

2917

A mixed methods evaluation of a third wave cognitive behavioural therapy and osteopathic treatment programme for chronic pain in primary care (OsteoMAP)
Carnes, D., Mars, T., Plunkett, A., Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/03


2919



2921

Osteopathy for primary headache patients: a systematic review
Cerritelli, F., Lacorte, E., Ruffini, N., Vanacore, N.
Journal of Pain Research, 2017/03
Free full text

2922

A process approach in osteopathy: beyond the structural model
Lederman, E.
International Journal of Osteopathic Medicine, 2017/03

2923

Osteopathic manipulation as a complementary approach to Parkinson's disease: A controlled pilot study
Difrancisco-Donoghue, J., Apoznanski, T., De Vries, K., Jung, M. K., Mancini, J., Yao, S.
NeuroRehabilitation, 2017/03

2924

The risk associated with spinal manipulation: an overview of reviews
Nielsen, S. M., Tarp, S., Christensen, R., Bliddal, H., Klokker, L., Henriksen, M.
Systematic Reviews, 2017/03
Free full text





2929

History of Osteopathic Medicine: Still Relevant?
Orenstein, R.
The Journal of the American Osteopathic Association, 2017/03
Free full text


2931

Osteopathic Medical Student Practice of Osteopathic Manipulative Treatment During School Break
Pierce-Talsma, S., Hiserote, R. M., Lund, G.
The Journal of the American Osteopathic Association, 2017/03
Free full text

2932

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text

2933

Osteopathic treatment in a patient with left-ventricular assist device with left brachialgia: a case report
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Medical Case Reports Journal, 2017/02
Free full text


2935

Correlation Between United States Medical Licensing Examination and Comprehensive Osteopathic Medical Licensing Examination Scores for Applicants to a Dually Approved Emergency Medicine Residency
Kane, K. E., Yenser, D., Weaver, K. R., Barr, G. C. Jr., Goyke, T. E., Quinn, S. M., Worrilow, C. C., Burckhart, A. J., Leonetti, A. L., Yoshioka, I. E., Dusza, S. W., Kane, B. G.
The Journal of Emergency Medicine, 2017/02

2936

Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/02

2937

The strain - counter strain technique in the management of anterior interosseous nerve syndrome: A case report
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S.
Journal of Taibah University Medical Sciences, 2017/02
Free full text

2938

JAOA Peer Reviewers, 2016
listed, No authors
The Journal of the American Osteopathic Association, 2017/02
Free full text

2939

Pectus Excavatum: A Review of Diagnosis and Current Treatment Options
Abid, I., Ewais, M. M., Marranca, J., Jaroszewski, D. E.
The Journal of the American Osteopathic Association, 2017/02
Free full text

2940


2941

Somatic Dysfunction in the Diagnosis of Uncommon Ectopic Pregnancies: Surgical Correlation and Comparison With Related Pathologic Findings
Martingano, D., Canepa, H., Fararooy, S., Rybitskiy, D., Shahem, S., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2017/02
Free full text


2943

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/


2945

Osteopathic Philosophy and Manipulation Enhancement Program: Influence on Osteopathic Medical Students' Interest in Osteopathic Manipulative Medicine
Volokitin, M., Ganapathiraju, P. V.
The Journal of the American Osteopathic Association, 2017/01
Free full text



2948

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text

2949

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text

2950

Osteopathic Manipulative Treatment Limits Chronic Constipation in a Child with Pitt-Hopkins Syndrome
Aquino, A., Perini, M., Cosmai, S., Zanon, S., Pisa, V., Castagna, C., Uberti, S.
Case Reports in Pediatrics, 2017/01
Free full text

2951

Integration of osteopathic manual treatments in management of cervical dystonia with tremor: A case series
Halimi, M., Leder, A., Mancini, J. D.
Tremor and Other Hyperkinetic Movements, 2017/01
Free full text


2953

Osteopathie und Psyche
(Osteopathy and Psyche)
Tschinkel, M.
Unpublished MSc thesis, 2017/01
Free full text

2954

The role of gentle touch in perinatal osteopathic manual therapy
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Neuroscience and Biobehavioral Reviews, 2017/01

2955

Knee Pain in Adults with an Osteopathic Component
Datta, R., Burina, L., Romanelli, F., Flaum, T. B.
Osteopathic Family Physician, 2017/01
Free full text


2957

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text



2960

Effectiveness of Osteopathic Therapy in the Treatment of Oral Submucous Fibrosis
Goyal, M., Aggarwal, A., Goyal, K., Garg, P.
Contemporary Clinical Dentistry, 2017/01
Free full text


2962

Osteopathie, Krankheit und Gesundheit
(Osteopathy, disease and health)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01


2964

How Osteopathy Could Help Obstetrics in Diagnosis and Therapy. Preliminary Report About Safety and Efficacy of Osteopathy in an Obstetrics Department in Italy
Siccardi, M., Valle, C., Di Matteo, F., Perlo, B., Pratticò, M., Angius, V., Bianco, G., Damonte, V., Giusto, S., Palezzato, E., Tabò, M., Brichetto, C., Valle, P., Zolezzi, A., Parodi, G., Airaudi, G.
Journal of Perinatal Medicine, 2017/01

2965

Osteopathic Manipulative Treatment of Primary Dysmenorrhea and Related Factors: A Randomized Controlled Trial
Zecchillo, D., Acquati, A., Aquino, A., Pisa, V., Uberti, S., Ratti, S.
International Journal of Medical Research & Health Sciences, 2017
Free full text



2968

Assessment of Hospital Staff's Knowledge of Osteopathic Manipulative Medicine: A Survey-Based Study
Smith-Kelly, J. B., Cardenas, A.
The Journal of the American Osteopathic Association, 2016/12
Free full text

2969

Examining Health Care Students' Attitudes toward E-Professionalism
Gettig, J. P., Noronha, S., Graneto, J., Obucina, L., Christensen, K. J., Fjortoft, N. F.
American Journal of Pharmaceutical Education, 2016/12
Free full text



2972

Reliability of Diagnosis and Clinical Efficacy of Cranial Osteopathy: A Systematic Review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
PLoS One, 2016/12
Free full text

2973

Somatic dysfunction: An osteopathic conundrum
Fryer, G.
International Journal of Osteopathic Medicine, 2016/12

2974

A Survey of Disaster Medical Education in Osteopathic Medical School Curricula
Parrillo, S. J., Christensen, D., Teitelbaum, H. S., Glassman, E. S.
Prehospital and Disaster Medicine, 2016/12
Free full text

2975

Efficacy of an Osteopathic Treatment Coupled With Lactation Consultations for Infants' Biomechanical Sucking Difficulties
Herzhaft-Le Roy, J., Xhignesse, M., Gaboury, I.
Journal of Human Lactation, 2016/12

2976

Osteopathic Manipulative Treatment for Somatic Dysfunction After Acute Severe Traumatic Brain Injury
McCallister, A., Brown, C., Smith, M., Ettlinger, H., Baltazar, G. A.
The Journal of the American Osteopathic Association, 2016/12
Free full text

2977

Effects of osteopathic manipulative treatment on hand function, disease symptoms and functional status in systemic sclerosis: a series of single-case studies in working women
O'Connor, S., Durand, M. J., Hudson, M., Baron, M., Gaudreault, N.
International Journal of Osteopathic Medicine, 2016/12

2978

Effectiveness of osteopathic manipulative treatment versus osteopathy in the cranial field in temporomandibular disorders - a pilot study
Gesslbauer, C., Vavti, N., Keilani, M., Mickel, M., Crevenna, R.
Disability and Rehabilitation, 2016/12


2980

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text

2981

Does replacing live demonstration with instructional videos improve student satisfaction and osteopathic manipulative treatment examination performance?
Seals, R., Gustowski, S. M., Kominski, C., Li, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text

2982

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text

2983

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text


2985

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: The PROMOTE Study Protocol
Hensel, K. L., Carnes, M. S., Stoll, S. T.
The Journal of the American Osteopathic Association, 2016/11
Free full text

2986

PROMOTE Study: Safety of Osteopathic Manipulative Treatment During the Third Trimester by Labor and Delivery Outcomes
Hensel, K. L., Roane, B. M., Chaphekar, A. V., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2016/11
Free full text





2991

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text

2992

Requirements for Certification in Surgery: A Comparison of the American Board of Surgery and the American Osteopathic Board of Surgery
Termuhlen, P. M., AH, O. Yurvati, Stella, J. J.
The Journal of the American Osteopathic Association, 2016/10
Free full text

2993

T4 syndrome – A distinct theoretical concept or elusive clinical entity? A case report
Hirai, P. M., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2016/10

2994

Using Patient Perspective Sessions to Increase Empathy and Recall in Preclinical Medical Students
Hendriksz, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text


2996

Multimodal compared to pharmacologic treatments for chronic tension-type headache in adolescents
Przekop, P., Przekop, A., Haviland, M. G.
Journal of Bodywork and Movement Therapies, 2016/10

2997

Osteopathic manipulative treatment in neurological diseases: Systematic review of the literature
Cerritelli, F., Ruffini, N., Lacorte, E., Vanacore, N.
Journal of the Neurological Sciences, 2016/10

2998

Manual therapy and OMT may be of benefit in the management of somatosensory tinnitus
King, H. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text

2999

Can postural manual osteopathic intervention improve temporo-mandibular joint (TMJ) opening in a client with scoliosis?
Bétournay, M., Desgagnes, A., Tran-Nguyen, B.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text


3001

Efficacy of an osteopathic treatment for biomechanical suckling dysfunctions in newborn: A randomised controlled trial
Herzhaft-LeRoy, J., Gaboury, I., Xhignesse, M.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text


3003

A.T. Still’s osteopathic lesion theory and evidence-based models supporting the emerged concept of somatic dysfunction
Liem, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text


3005

Manual Therapy in the Treatment of Idiopathic Scoliosis. Analysis of Current Knowledge
Czaprowski, D.
Ortopedia, Traumatologia, Rehabilitacja, 2016/10
Free full text






3011

Effect of Medical Education on Empathy in Osteopathic Medical Students
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text

3012

Correlation Between Standardize Patients' Perceptions of Osteopathic Medical Students and Students' Self-Rated Empathy
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text

3013

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text

3014

The use of critical reflection to foster reflective practice in student osteopaths
McLeod, G. A.
Unpublished PhD thesis, 2016/09
Free full text

3015

Manual therapy and cervical artery dysfunction: Identification of potential risk factors in clinical encounters
Vaughan, B., Moran, R., Tehan, P., Fryer, G., Holmes, M., Vogel, S., Taylor, A.
International Journal of Osteopathic Medicine, 2016/09



3018

Spine Tango registry data collection in a conservative spinal service: a feasibility study
Morris, S., Booth, J., Hegarty, J.
European Spine Journal, 2016/09

3019

The Attitudes of Physicians, Nurses, Physical Therapists, and Midwives Toward Complementary Medicine for Chronic Pain: A Survey at an Academic Hospital
Aveni, E., Bauer, B., Ramelet, A. S., Kottelat, Y., Decosterd, I., Finti, G., Ballabeni, P., Bonvin, E., Rodondi, P. Y.
Explore (NY), 2016/09

3020

Lumbalgie bei Uterusdeszensus
(Low back pain in uterine descent)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09




3024

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

3025


3026

Osteopathy for Endometriosis and Chronic Pelvic Pain - a Pilot Study
Sillem, M., Juhasz-Boss, I., Klausmeier, I., Mechsner, S., Siedentopf, F., Solomayer, E.
Geburtshilfe Frauenheilkunde, 2016/09

3027

Berufsgesetz Osteopathie
(Occupational law for osteopathy)
Newiger, C.
Osteopathische Medizin, 2016/09

3028




3031

Osteopathic Manipulative Treatment in Pediatric and Neonatal Patients and Disorders: Clinical Considerations and Updated Review of the Existing Literature
Bagagiolo, D., Didio, A., Sbarbaro, M., Priolo, C. G., Borro, T., Farina, D.
American Journal of Perinatology, 2016/09

3032

Preliminary development of a complex intervention for osteopathic management of dysfunctional breathing
Benjamin, J. G., Bacon, C. J., Verhoeff, W. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/09

3033

R18 - Osteopathy for Post-Mastectomy Pain Syndrome (PMPS) in early breast cancer (EBC) patients: a pilot study in an Italian Oncology Unit
Putignano, F., Bidin, L., Belfiglio, B., Bordoni, F., Seghini, P., Cavanna, L.
Annals of Oncology, 2016/09


3035

Tensegrity and manual therapy practice: a qualitative study
Hohenschurz-Schmidt, D. J., Esteves, J. E., Thomson, O. P.
International Journal of Osteopathic Medicine, 2016/09



3038

Case report of osteopathic treatment of insomnia and traumatic anhidrosis
Nobles, T., Bach, A., Boesler, D.
International Journal of Osteopathic Medicine, 2016/09

3039

The potential of osteopathic manipulative treatment in antimicrobial stewardship: A narrative review
Noll, D. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

3040

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

3041

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text

3042

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text

3043

Benefits of Craniosacral Therapy in Patients with Chronic Low Back Pain: A Randomized Controlled Trial
Castro-Sánchez, A. M., Lara-Palomo, I. C., Matarán-Peñarrocha, G. A., Saavedra-Hernández, M., Pérez-Mármol, J. M., Aguilar-Ferrándiz, M. E.
The Journal of Alternative and Complementary Medicine, 2016/08

3044

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text

3045

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text

3046

Manual evaluation of the diaphragm muscle
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Journal of Chronic Obstructive Pulmonary Disease, 2016/08
Free full text

3047

The effectiveness of complementary manual therapies for pregnancy-related back and pelvic pain A systematic review with meta-analysis
Hall, H., Cramer, H., Sundberg, T., Ward, L., Adams, J., Moore, C., Sibbritt, D., Lauche, R.
Medicine (Baltimore), 2016/08
Free full text

3048

The paradox of sham therapy and placebo effect in osteopathy: A systematic review
Cerritelli, F., Verzella, M., Cicchitti, L., D', Alessandro, G., Vanacore, N.
Medicine (Baltimore), 2016/08
Free full text

3049

Osteopathic Manual Treatment for Amyotrophic Lateral Sclerosis: A Feasibility Pilot Study
Maggiani, A., Tremolizzo, L., Della Valentina, A., Mapelli, L., Sosio, S., Milano, V., Bianchi, M., Badi, F., Lavazza, C., Grandini, M., Corna, G., Prometti, P., Lunetta, C., Riva, N., Ferri, A., Lanfranconi, F., Me, Study
The Open Neurology Journal, 2016/08
Free full text

3050



3052

Health literacy screening of patients attending a student-led osteopathy clinic: A pilot investigation
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Complementary Therapies in Clinical Practice, 2016/08

3053

Quantitative Description of Medical Student Interest in Neurology and Psychiatry
Ramos, R. L., Cuoco, J. A., Guercio, E., Levitan, T.
The Journal of the American Osteopathic Association, 2016/07
Free full text



3056

The tongue after whiplash: case report and osteopathic treatment
Bordoni, B., Marelli, F., Morabito, B.
International Medical Case Reports Journal, 2016/07
Free full text



3059

Exploration of clinical changes following a novel mobilisation technique for treatment of chronic low back pain: A single cohort design
Hanson, G. C., Jones, B., Bacon, C. J., Moran, R. W.
Journal of Bodywork and Movement Therapies, 2016/07


3061

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text

3062

Osteopathic manipulative therapy is feasible and safe after abdominal surgery
King, H. H.
The Journal of the American Osteopathic Association, 2016/07
Free full text

3063

The Use of COMLEX-USA and USMLE for Residency Applicant Selection
Sandella, J. M., Gimpel, J. R., Smith, L. L., Boulet, J. R.
Journal of Graduate Medical Education, 2016/07
Free full text


3065

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text

3066

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text

3067

Management of Cesarean Deliveries and Cesarean Scars With Osteopathic Manipulative Treatment: A Brief Report
Martingano, D.
The Journal of the American Osteopathic Association, 2016/07
Free full text

3068

Osteopathic Approach to the Diagnosis of Appendiceal Mucinous Cystadenocarcinoma Mimicking Primary Ovarian Malignant Neoplasm
Martingano, D., Gurm, H., Oliff, A., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2016/07
Free full text

3069

Pseudoischialgie bei Dysfunktion der Fibula
(Pseudo sciatica in dysfunction of the fibula)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07


3071

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06

3072

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text


3074

Response of Tinnitus to Osteopathic Manipulation
Kurisu, M., Alexander, J., Fleming, J., King, H.
Journal of Integrative and Complementary Medicine, 2016/06



3077

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06

3078

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text

3079

Osteopatia e lombalgia
(Osteopathy and low back pain)
de Oliveira Meirelles, F.
Unpublished MSc thesis, 2016/06
Free full text

3080

Osteopathic manipulative treatment in gynecology and obstetrics: A systematic review
Ruffini, N., D'Alessandro, G., Cardinali, L., Frondaroli, F., Cerritelli, F.
Complementary Therapies in Clinical Practice, 2016/06


3082

Randomised controlled pilot trial on feasibility, safety and effectiveness of osteopathic MANipulative treatment following major abdominal surgery (OMANT pilot trial)
Probst, P., Büchler, E., Doerr-Harim, C., Knebel, P., Thiel, B., Ulrich, A., Diener, M. K.
International Journal of Osteopathic Medicine, 2016/06


3084

(Manual medicine and osteopathic methods on the growing spine)
Kayser, R., Harke, G.
Der Orthopäde, 2016/06


3086

Osteopathic medical students' perception of teaching effectiveness of their primary care clinical preceptors
Ojano Sheehan, O., Brannan, G., Dogbey, G.
International Journal of Osteopathic Medicine, 2016/06

3087

State of affairs of osteopathy in the Benelux: Benelux Osteosurvey 2013
van Dun, P. L. S., Nicolaie, M. A., Van Messem, A.
International Journal of Osteopathic Medicine, 2016/06


3089

Eye contact, appetite, and vomiting improved in children with autism spectrum disorder after visceral osteopathic technique
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text

3090

Significant Benefit Shown After Lumbar Disk Surgery Rehabilitation by Inclusion of Osteopathic Intervention
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text

3091

Postural Balance and Gait Improved With an Osteopathic Intervention in a Special Needs Population
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text

3092

Non-specific mechanisms in orthodox and CAM management of low back pain (MOCAM): theoretical framework and protocol for a prospective cohort study
Bradbury, K., Al-Abbadey, M., Carnes, D., Dimitrov, B. D., Eardley, S., Fawkes, C., Foster, J., Greville-Harris, M., Harvey, J. M., Leach, J., Lewith, G., MacPherson, H., Roberts, L., Parry, L., Yardley, L., Bishop, F. L.
BMJ Open, 2016/05

3093

Proposed Amendments to the AOA Constitution, Bylaws, and Code of Ethics
listed, No authors
The Journal of the American Osteopathic Association, 2016/05
Free full text


3095

Osteopathic considerations in obstructive pulmonary disease: A systematic review of the evidence
Raguckas, C., Ference, J., Gross, G. A.
Osteopathic Family Physician, 2016/05
Free full text

3096

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

3097

Premedical Students’ Attitudes Toward Primary Care Medicine
Beverly, E. A., Wietecha, D. A., Nottingham, K., Rush, L. J., Law, T. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

3098

ENGAGE Initiative: Showcasing Osteopathic Scholarly Activity
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/05
Free full text

3099

Preparation Strategies of Osteopathic Medical Students for the COMLEX-USA Level 2-PE
Sandella, J. M., Peters, A., Smith, L. L., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text

3100

Advising Needs of Osteopathic Medical Students Preparing for the Match
Speicher, M. R., Pradhan, S. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text

3101

Program Characteristics Influencing Allopathic Students' Residency Selection
Stillman, M. D., Miller, K. H., Ziegler, C. H., Upadhyay, A., Mitchell, C. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

3102

Effect of a Mandatory Third-Year Osteopathic Manipulative Treatment Course on Student Attitudes
Heineman, K. L., Lewis, D. D., Finnerty, E. P., Crout, S. V., Canby, C.
The Journal of the American Osteopathic Association, 2016/04
Free full text

3103

The patient experience of osteopathic healthcare
Orrock, P. J.
Manual Therapy, 2016/04

3104

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text

3105

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

3106

Perceptions of US and Australian Medical Students and Instructors About Clinical Professional Attire: LAPEL Study
Bramstedt, K. A., Colaco, C. M. G., de Silva, E., Rehfield, P. L., Blumenthal-Barby, J. S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

3107

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

3108

Osteopathic Manipulative Treatment improves gait pattern and posture in adult patients with Prader–Willi syndrome
Vismara, L., Cimolin, V., Galli, M., Grugni, G., Ancillao, A., Capodaglio, P.
International Journal of Osteopathic Medicine, 2016/03

3109

Osteopathy – a complex business
Vogel, S.
International Journal of Osteopathic Medicine, 2016/03

3110

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03







3117

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text

3118

Resolution of Concussion Symptoms After Osteopathic Manipulative Treatment: A Case Report
Guernsey, D. T., Leder, A., Yao, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text


3120

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03



3123

The Glymphatic-Lymphatic Continuum: Opportunities for Osteopathic Manipulative Medicine
Hitscherich, K., Smith, K., Cuoco, J. A., Ruvolo, K. E., Mancini, J. D., Leheste, J. R., Torres, G.
The Journal of the American Osteopathic Association, 2016/03
Free full text

3124

Knowing hands converse with an expressive body - An experience of osteopathic touch
Consedine, S., Standen, C., Niven, E.
International Journal of Osteopathic Medicine, 2016/03



3127

Letter to the Editor Regarding “A global view of osteopathy – Mirror or echo chamber”
King, H. H.
International Journal of Osteopathic Medicine, 2016/03

3128

Targeting Patient Subgroups With Chronic Low Back Pain for Osteopathic Manipulative Treatment: Responder Analyses From a Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text


3130

Recovery From Chronic Low Back Pain After Osteopathic Manipulative Treatment: A Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text

3131

Understanding clinical reasoning in osteopathy: a qualitative research approach
Grace, S., Orrock, P., Vaughan, B., Blaich, R., Coutts, R.
Chiropractic & Manual Therapies, 2016/03
Free full text


3133

Osteopathie bei Infantiler Cerebralparese
(Osteopathy for Infant Cerebral Palsy)
Budroni, J.
Unpublished MSc thesis, 2016/03
Free full text

3134

Resolution of New Daily Persistent Headache After Osteopathic Manipulative Treatment
Alexander, J.
The Journal of the American Osteopathic Association, 2016/03
Free full text

3135

Constipation: A review with osteopathic consideration
Cole, S., Moore, C., Shah, P.
Osteopathic Family Physician, 2016/03


3137

Schlafstörungen und Epiphyse
(Sleep disorders and pineal gland)
Clostermann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

3138

Klinische Effektivität einer osteopathischen Behandlung bei Migräne
(Clinical effectiveness of osteopathic treatment for migraines)
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Osteopathische Medizin, 2016/03

3139

Osteopathic approach to chronic constipation in Prader–Willi Syndrome: A case report
Smith, L., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2016/03

3140

Concussions and Osteopathic Manipulative Treatment: An Adolescent Case Presentation
Castillo, I., Wolf, K., Rakowsky, A.
The Journal of the American Osteopathic Association, 2016/03
Free full text

3141

Osteopathic manipulative treatment for older patients: A national survey of osteopathic physicians
Channell, M. K., Wang, Y., McLaughlin, M. H., Ciesielski, J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2016/03
Free full text

3142

Research Into Osteopathic Manipulative Medicine: Steps on the Evidence Pyramid
Ching, L. M.
The Journal of the American Osteopathic Association, 2016/03
Free full text

3143

Osteopaths' clinical reasoning during consultation with patients experiencing acute low back pain: A qualitative case study approach
Roots, S. A., Niven, E., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/03

3144

Abdominal Trigger Points and Psychological Function
Reeves, R. R., Ladner, M. E.
The Journal of the American Osteopathic Association, 2016/02
Free full text

3145

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text

3146

Factors Modifying Burnout in Osteopathic Medical Students
Lapinski, J., Yost, M., Sexton, P., LaBaere, R. J.
Academic Psychiatry, 2016/02



3149

Osteopathic Physicians on the Editorial Boards of Major Medical Journals Over the Past 30 Years
Ashurst, J. V., Galuska, M.
The Journal of the American Osteopathic Association, 2016/02
Free full text

3150

Burnout Among Osteopathic Residents: A Cross-sectional Analysis
Chan, A. M., Cuevas, S. T., Jenkins, J.
The Journal of the American Osteopathic Association, 2016/02
Free full text

3151

Use of complementary and alternative medicine (CAM) by parents in their children and adolescents with epilepsy - Prevelance, predictors and parents' assessment
Hartmann, N., Neininger, M. P., Bernhard, M. K., Syrbe, S., Nickel, P., Merkenschlager, A., Kiess, W., Bertsche, T., Bertsche, A.
European Journal of Paediatric Neurology, 2016/01

3152

Modern Still Life
Pennekamp, A.
The Journal of the American Osteopathic Association, 2016/01
Free full text



3155

Die Faszien im Alter
(Fascia in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

3156

Prevalence and characteristics of women who consult with osteopathic practitioners during pregnancy; a report from the Australian Longitudinal Study on Women's Health (ALSWH)
Frawley, J., Sundberg, T., Steel, A., Sibbritt, D., Broom, A., Adams, J.
Journal of Bodywork and Movement Therapies, 2016/01


3158

Bluthochdruck im Alter
(Hypertension in old age)
Seidler, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

3159

General Movements in preterm infants undergoing craniosacral therapy: a randomised controlled pilot-trial
Raith, W., Marschik, P. B., Sommer, C., Maurer-Fellbaum, U., Amhofer, C., Avian, A., Lowenstein, E., Soral, S., Muller, W., Einspieler, C., Urlesberger, B.
BMC Complementary and Alternative Medicine, 2016/01
Free full text


3161

Evaluating medical student engagement during virtual patient simulations: a sequential, mixed methods study
McCoy, L., Pettit, R. K., Lewis, J. H., Allgood, J. A., Bay, C., Schwartz, F. N.
BMC Medical Education, 2016/01
Free full text

3162

Muscle energy technique improves chronic lateral epicondylitis
Koh, C., III, Seffinger
The Journal of the American Osteopathic Association, 2016/01
Free full text

3163

An indication of current views of Australian general practitioners towards chiropractic and osteopathy: a cross-sectional study
Engel, R. M., Beirman, R., Grace, S.
Chiropractic & Manual Therapies, 2016/01
Free full text

3164

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

3165

Management of Acute Isolated Soleal Vein Thrombosis in a Pregnant Patient With an Osteopathic Approach to Evaluation
Martingano, D., Eisenberg, J., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text


3167

An osteopathic approach to the treatment of ovarian cancer
Martingano, D., Cannon, M., Williams, S., Stoner, A.
Osteopathic Family Physician, 2016/01
Free full text

3168

Gamification and Multimedia for Medical Education: A Landscape Review
McCoy, L., Lewis, J. H., Dalton, D.
The Journal of the American Osteopathic Association, 2016/01
Free full text


3170

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text

3171

Multicenter Osteopathic Pneumonia Study in the Elderly: Subgroup Analysis on Hospital Length of Stay, Ventilator-Dependent Respiratory Failure Rate, and In-hospital Mortality Rate
Noll, D. R., Degenhardt, B. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text

3172

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text



3175

GME Graduate Retention Rates: A Single Institution Study
Frieswyk, T. J.
Unpublished PhD thesis, 2015/12
Free full text

3176

Assessment in the final year clinical practicum of an Australian osteopathy program
Vaughan, B., Morrison, T.
International Journal of Osteopathic Medicine, 2015/12


3178

Effect of Select Osteopathic Manipulative Treatment Techniques on Patients With Acute Rhinosinusitis
Nishida, Y., Sopchak, M. M., Jackson, M. R., Andersonning, T. R., Leikert, E. P., Goldman, S. I., Jarski, R. W.
The AAO Journal, 2015/12





3183

Osteopathic manipulative treatment for chronic nonspecific neck pain: A systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
International Journal of Osteopathic Medicine, 2015/12

3184

A National Study of Primary Care Provided by Osteopathic Physicians
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2015/12
Free full text


3186

The anatomy, biological plausibility and efficacy of visceral mobilization in the treatment of pelvic floor dysfunction
Horton, R. C.
Journal of Pelvic, Obstetric Gynaecological Physiotherapy, 2015/12
Free full text

3187

Intra-oral osteopathic technique for chronic temporomandibular disorders
Frederikson, H.
Unpublished MSc thesis, 2015/12
Free full text


3189

Scimitar syndrome: A rare explanation for a common symptom with an osteopathic approach
Rivera, N. T., Martin, R. B., Gordon, M.l B., Rajter, J.-J., Bray, N.
International Journal of Osteopathic Medicine, 2015/12

3190

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text




3194

Achilles Tendon Disorders
Saini, S. S., Reb, C. W., Chapter, M., Daniel, J. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text

3195

Incorporating Osteopathic Curriculum Into a Family Medicine Residency
Hempstead, L. K., Harper, D. M.
Family Medicine, 2015/11

3196

Development of Peer Tutoring Services to Support Osteopathic Medical Students’ Academic Success
Swindle, N., Wimsatt, L.
The Journal of the American Osteopathic Association, 2015/11
Free full text

3197

Incidence of Somatic Dysfunction in Healthy Newborns
Waddington, E. L., Snider, K. T., Lockwood, M. D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2015/11
Free full text



3200

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11

3201

Adverse Events Due to Chiropractic and Other Manual Therapies for Infants and Children: A Review of the Literature
Todd, A. J., Carroll, M. T., Robinson, A., Mitchell, E. K. L.
Journal of Manipulative and Physiological Therapeutics, 2015/11

3202

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text

3203

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text

3204

Feasibility of Using Ultrasonography to Establish Relationships Among Sacral Base Position, Sacral Sulcus Depth, Body Mass Index, and Sex
Lockwood, M. D., Kondrashova, T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/11
Free full text


3206

Patients' expectations of osteopathic care: a qualitative study
Cross, V., Leach, C. M., Fawkes, C. A., Moore, A. P.
Health Expectations, 2015/10
Free full text

3207

Quantification of Motion Palpation
Kasparian, H., Signoret, G., Kasparian, J.
The Journal of the American Osteopathic Association, 2015/10
Free full text

3208


3209

Look but ... please don't touch!
De-Giorgio, F., Panarella, L., Miscusi, M., d', Aloja, E., Spagnolo, A. G., Pascali, V. L., Vetrugno, G.
Medicine, Science and the Law, 2015/10
Free full text

3210

Antwort von Prof. Fuessl.
[Reply from Prof. Fuessl]
MMW - Fortschritte der Medizin, 2015/10


3212

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text

3213

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text






3219

Analysis of provider specialties in the treatment of patients with clinically diagnosed back and joint problems
Wilson, F. A., Licciardone, J. C., Kearns, C. M., Akuoko, M.
Journal of Evaluation in Clinical Practice, 2015/10




3223

Perceived teaching quality between near-peer and academic tutors in an osteopathic practical skills class
Vaughan, B., Macfarlane, C.
International Journal of Osteopathic Medicine, 2015/09






3229

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09

3230

Kinesiologisches Taping in der Osteopathie
(Kinesiology taping in osteopathy)
Seifert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
Free full text

3231

Approaching the Single Accreditation System: Curricular Variation in Allopathic, Osteopathic, and Dually Accredited Family Medicine Residency Programs
Mims, L. D., Wannamaker, L. R., Bressler, L. C.
Journal of Graduate Medical Education, 2015/09
Free full text





3236

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09

3237

Management of mood disorders by osteopaths in New Zealand: A survey of current clinical practice
Kovanur Sampath, K., Roy, D. E.
International Journal of Osteopathic Medicine, 2015/09


3239

Interventions for preventing and treating low-back and pelvic pain during pregnancy
Liddle, S. D., Pennick, V.
Cochrane Database of Systematic Reviews, 2015/09
Free full text

3240

Improving our impact and developing high-level clinical expertise
Moran, R.
International Journal of Osteopathic Medicine, 2015/09
Free full text

3241

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

3242

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09

3243

Effect of Table Trainer-to-Student Ratios on Outcome in Student Assessments of Cervical Muscle Energy Techniques
Snider, K. T., Dowling, D. J., Seffinger, M. A., Channell, M. K., Yao, S. C., Gustowski, S. M., Johnson, J. C., Pryor, M. J.
The Journal of the American Osteopathic Association, 2015/09
Free full text

3244

Der Zehengang
(Toe walking)
Guerassimiouk, D., Goussel, W., Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

3245

Basic Mechanisms of Osteopathic Manipulative Treatment: A Must Read
Patterson, M. M.
The Journal of the American Osteopathic Association, 2015/09
Free full text

3246

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text

3247

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text

3248

Modeled Osteopathic Manipulative Treatments: A Review of Their in Vitro Effects on Fibroblast Tissue Preparations
Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/08
Free full text

3249

Accuracy of Anterior Superior Iliac Spine Symmetry Assessment by Routine Structural Examination
Lee, A. S., Pyle, C. W., Redding, D.
The Journal of the American Osteopathic Association, 2015/08
Free full text

3250

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text

3251

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text

3252

Im Gespräch mit … Jane Eliza Stark
(In dialog with Jane Eliza Stark)
Höppner, J.P., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07

3253

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text


3255

Effects of Osteopathic Manipulative Treatment on Diabetic Gastroparesis
Van Ravenswaay, V. J., Hain, S. J., Grasso, S., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2015/07
Free full text


3257

Entzündungsreaktionen aus Sicht der Osteopathie
(Inflammatory reactions from an osteopathic point of view)
Sarzeaud, R., Thon, N., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
Free full text


3259

Immediate changes in electroencephalography activity in individuals with nonspecific chronic low back pain after cranial osteopathic manipulative treatment: study protocol of a randomized, controlled crossover trial
Martins, W. R., Diniz, L. R., Blasczyk, J. C., Lagoa, K. F., Thomaz, S., Rodrigues, M. E., de Oliveira, R. J., Bonini-Rocha, A. C.
BMC Complementary and Alternative Medicine, 2015/07
Free full text

3260

Assessing the immediate effect of osteopathic manipulation on sports related concussion symptoms
Chappell, C., Dodge, E., Dogbey, G. Y.
Osteopathic Family Physician, 2015/07
Free full text

3261

Lass die Natur ihre Arbeit machen
(Let nature do its job)
Deslee, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07

3262

Strömung
(Flow)
Geyer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07

3263

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07


3265

Allied Health practitioners' role in the Chronic Disease Management program: The experience of osteopathic practitioners
Orrock, P. J., Lasham, K., Ward, C.
International Journal of Osteopathic Medicine, 2015/06



3268

Role of osteopathic manipulative treatment in the management of stiff person syndrome
Rajaii, R. M., Cox, G. J., Schneider, R. P.
The Journal of the American Osteopathic Association, 2015/06
Free full text

3269

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text


3271

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

3272

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

3273

Oral cancer knowledge, behavior, and attitude among osteopathic medical students
McCready, Z. R., Kanjirath, P., Jham, B. C.
Journal of Cancer Education, 2015/06

3274

Relationship between somatic dysfunction of the lumbosacral joint and changes in the gait pattern
Croonenborghs, H., Peeters, L., De Schepper, J.
International Journal of Osteopathic Medicine, 2015/06

3275

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06

3276

Learning Environment, Preparedness and Satisfaction in Osteopathy in Europe: The PreSS Study
Luciani, E., van Dun, P. L., Esteves, J. E., Lunghi, C., Petracca, M., Papa, L., Merdy, O., Jakel, A., Cerritelli, F.
PLoS One, 2015/06
Free full text

3277

The effect of osteopathic manipulative treatment on length of stay in posterolateral postthoracotomy patients: A retrospective case note study
Fleming, R. K., Snider, K. T., Blanke, K. J., Johnson, J. C.
International Journal of Osteopathic Medicine, 2015/06

3278

Proposed Amendments to the AOA Constitution
listed, No authors
The Journal of the American Osteopathic Association, 2015/06
Free full text

3279

A global view of osteopathic practice – mirror or echo chamber?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2015/06





3284

Impact of osteopathic manipulative therapy on quality of life of patients with deep infiltrating endometriosis with colorectal involvement: results of a pilot study
Darai, C., Deboute, O., Zacharopoulou, C., Laas, E., Canlorbe, G., Belghiti, J., Zilberman, S., Ballester, M., Darai, E.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2015/05

3285

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text

3286

Systematic Review Challenges Efficacy of Pediatric OMT
Martincik, L., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text

3287

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05

3288

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text

3289

Lymphatic pump treatment as an adjunct to antibiotics for pneumonia in a rat model
Hodge, L. M., Creasy, C., Carter, K., Orlowski, A., Schander, A., King, H. H.
The Journal of the American Osteopathic Association, 2015/05
Free full text

3290

Variations in the diagnosis and treatment of somatic dysfunction between 4 osteopathic residency programs
Hon, G. A., Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/05
Free full text

3291

The extent of familial hypercholesterolemia instruction in US schools and colleges of medicine, pharmacy, and osteopathic medicine
Withycombe, B., Winden, J. C., Hassanyn, R., Duell, P. B., Ito, M. K.
Journal of Clinical Lipidology, 2015/05

3292

A multicenter, randomized, controlled trial of osteopathic manipulative treatment on preterms
Cerritelli, F., Pizzolorusso, G., Renzetti, C., Cozzolino, V., D'Orazio, M., Lupacchini, M., Marinelli, B., Accorsi, A., Lucci, C., Lancellotti, J., Ballabio, S., Castelli, C., Molteni, D., Besana, R., Tubaldi, L., Perri, F. P., Fusilli, P., D'Incecco, C., Barlafante, G.
PLoS One, 2015/05
Free full text

3293

Student perceptions of gamified audience response system interactions in large group lectures and via lecture capture technology
Pettit, R. K., McCoy, L., Kinney, M., Schwartz, F. N.
BMC Medical Education, 2015/05
Free full text


3295

The meaning of fascia in a changing society
Adstrum, N. S.
Unpublished PhD thesis, 2015/04

3296

Transitions in osteopathic medical education
Cymet, T. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3297

Challenges of teaching live and distance audiences simultaneously
Davis, S. S., Hurtubise, L.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3298

Comparison of COMLEX-USA scores, medical school performance, and preadmission variables between women and men
Dixon, D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3299

Evolution of AOA specialty board certification
Scheinthal, S., Wieting, J. M., Elko, E., Bowling, J., Gonzalez, F., Librizzi, R., Murcek, B., Simms, B.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3300

Relationship between residency placement and clerkship site enrollment: a retrospective analysis
Elliott, S. P., Goldstein, L. B., Meinberg, D., Jeger, A. M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3301

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3302

President's message
Morrone, W.
Journal of Addictive Diseases, 2015/04

3303

Wie können wir unsere Wahrnehmung verbessern?
(How can we improve our perception?)
Marris, T., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

3304

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

3305

Was nimmt mein Osteopath wahr?
(What does my osteopath perceive?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

3306

Sutherland
Bordoni, B., Zanier, E.
Advances in Mind-Body Medicine, 2015/04

3307

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3308

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3309

Can osteopathic manipulative treatment modify the posture in elderly people? – A single-case study
Pellerin, F., Papin-Richard, E., Guihéneuc, P., Niel, S., Guihard, G.
Journal of Bodywork and Movement Therapies, 2015/04

3310

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04


3312

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3313

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3314

„Meine Mitte ist verschoben!“
(“My center is shifted!“)
Weese, P.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

3315

Osteopathic manipulative treatment and pain in preterms: study protocol for a randomised controlled trial
Cerritelli, F., Cicchitti, L., Martelli, M., Barlafante, G., Renzetti, C., Pizzolorusso, G., Lupacchini, M., D'Orazio, M., Marinelli, B., Cozzolino, V., Fusilli, P., D'Incecco, C.
Trials, 2015/04
Free full text


3317

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text


3319

Clinical effectiveness of osteopathic treatment in chronic migraine: 3-Armed randomized controlled trial
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Complementary Therapies in Medicine, 2015/04

3320

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3321

Osteopathic postdoctoral training institutions' 2014 annual report
Biszewski, M., Ball, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3322

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3323

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3324

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

3325

Recognizing the Value of Manual Therapy Interventions in Women's Health: An Interim Report
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text


3327

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text

3328

Dramatic Reduction in Menstrual Pain After Osteopathic Manipulative Therapy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text

3329

OMT—and Placebo—Shown Effective in Reducing Pain During Pregnancy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text



3332

Application of osteopathic manipulative technique in the treatment of back pain during pregnancy
Majchrzycki, M., Wolski, H., Seremak-Mrozikiewicz, A., Lipiec, J., Marszalek, S., Mrozikiewicz, P. M., Klejewski, A., Lisinski, P.
Ginekologia Polska, 2015/03

3333

In reply to brock and scott
Kauffman, M.
Academic Medicine, 2015/03
Free full text

3334

Adapting and feasibility testing pre-registration e-learning resources for Professionalism in Osteopathy in the UK
Browne, F., Rolfe, K., Currie, A., Walker, T., Roff, S.
International Journal of Osteopathic Medicine, 2015/03

3335

The accuracy of osteopathic manipulations of the lumbar Spine: A Pilot study
Frantzis, E., Druelle, P., Ross, K. E., McGill, S.
International Journal of Osteopathic Medicine, 2015/03


3337

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03


3339


3340

Osteopathic manipulative treatment use in the emergency department: a retrospective medical record review
Ault, B., Levy, D.
The Journal of the American Osteopathic Association, 2015/03
Free full text

3341

Osteopathic Considerations in the Management of Migraine in Pregnancy
Soshnick, S., Mezzone, C., Yao, S., Abu-Sbaih, R.
Osteopathic Family Physician, 2015/03
Free full text

3342

Osteopathic medical students' understanding of the Patient Protection and Affordable Care Act: a first step toward a policy-informed curriculum
Beverly, E. A., Skinner, D., Bianco, J. A., Ice, G. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text

3343

Effectiveness of osteopathic manipulative treatment for carpal tunnel syndrome: a pilot project
Burnham, T., Higgins, D. C., Burnham, R. S., Heath, D. M.
The Journal of the American Osteopathic Association, 2015/03
Free full text

3344

Evidence-based medicine and osteopathic medicine: no paradox
Noll, D. R.
The Journal of the American Osteopathic Association, 2015/03
Free full text



3347

Osteopathic graduates perceptions of stress and competence – A longitudinal study
Subramaniam, P., Eaton, S.A., Cranfield, J., Mulcahy, J., McLaughlin, P., Morrison, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2015/03

3348

Postoperative singultus: an osteopathic approach
Petree, K., Bruner, J.
The Journal of the American Osteopathic Association, 2015/03
Free full text


3350

Research in the osteopathic medical profession: roadmap to recovery-conundrums in osteopathic research require consensus and collaboration
Walkowski, S. A., Eland, D. C., Hain, S., Byron, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text

3351

Osteopathic manipulative treatment for self-reported fatigue, stress, and depression in first-year osteopathic medical students
Wiegand, S., Bianchi, W., Quinn, T. A., Best, M., Fotopoulos, T.
The Journal of the American Osteopathic Association, 2015/02
Free full text

3352

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text


3354

Use of complementary health approaches among children aged 4-17 years in the United States: National Health Interview Survey, 2007-2012
Black, L. I., Clarke, T. C., Barnes, P. M., Stussman, B. J., Nahin, R. L.
National Health Statistics Reports, 2015/02
Free full text




3358

Resolution of dacryostenosis after osteopathic manipulative treatment
Apoznanski, T. E., Abu-Sbaih, R., Terzella, M. J., Yao, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text

3359

Relationship of admissions variables and college of osteopathic medicine variables to performance on COMLEX-USA level 3
Baker, H. H., Shuman, V. L., Ridpath, L. C., Pence, L. L., Fisk, R. M., Jr., Boisvert
The Journal of the American Osteopathic Association, 2015/02
Free full text

3360

Promoting optimal breastfeeding through the osteopathic therapeutic cycle
Cornall, D.
Unpublished PhD thesis, 2015/02
Free full text

3361

Impact of the Single Accreditation Agreement on GME Governance and the Physician Workforce
Buser, B. R.
The Journal of the American Osteopathic Association, 2015/02
Free full text


3363

Pain: Alternative to a Narco-Epidemic
Moreau, M.
Unpublished Dissertation, 2015/01

3364

Osteopathic Manipulative Treatment Improves Clinical Response and Lowers Relapse Rates Among Patients With Chronic Low Back Pain
Brohard, J. N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01
Free full text

3365

Osteopathic Manipulative Treatment Is Effective for Nonspecific Low Back Pain
O'Donnell Rosendahl, N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01


3367

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: the PROMOTE study
Hensel, K. L., Buchanan, S., Brown, S. K., Rodriguez, M., Cruser d, A.
American Journal of Obstetrics & Gynecology, 2015/01
Free full text

3368

Osteopathische Sterbebegleitung
(Osteopathic terminal care)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
Free full text

3369

A pilot study on spatial changes in the maxilla caused by osteopathic therapy
Walter, C., Lechner, K. H., Karl, M.
Quintessence International, 2015/01


3371

Veränderungen im Alter
(Changes in old age)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

3372

Use of a novel assay to measure pre- to posttraining palpatory skills of first-year osteopathic medical students
Loh, M. S., Gevitz, N., Gilliar, W. G., Iacono, L. M., Jung, M. K., Krishnamachari, B., Amsler, K.
The Journal of the American Osteopathic Association, 2015/01
Free full text


3374

Aufrecht im Alter
(Upright in old age)
Eix, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01


3376

Kann die Arbeit mit dem Liquor älteren Patienten helfen?
(Can working with cerebrospinal fluid help elderly patients?)
Grundberg, S., Höflehner-Schnürch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01


3378

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01


3380

Osteopathy decreases the severity of IBS-like symptoms associated with Crohn's disease in patients in remission
Piche, T., Pishvaie, D., Tirouvaziam, D., Filippi, J., Dainese, R., Tonohouhan, M., DeGalleani, L., Nebot-Vivinus, M. H., Payrouse, J. L., Hebuterne, X.
European Journal of Gastroenterology & Hepatology, 2014/12




3384

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text

3385

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12


3387

The role of clinicians in osteopathic research
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/12





3392

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text

3393

A prodromal, musculoskeletal presentation of Parkinson's disease: A case report
Simpson, P. A.
International Journal of Osteopathic Medicine, 2014/12


3395

Use of real-time physiologic parameter assessment to augment osteopathic manipulative treatment training for first-year osteopathic medical students
Heath, D. M., Makin, I. R., Pedapati, C., Kirsch, J.
The Journal of the American Osteopathic Association, 2014/12
Free full text

3396

Osteopathic treatment in patients with primary dysmenorrhoea: A randomised controlled trial
Schwerla, F., Wirthwein, P., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2014/12

3397

Experiential Learning: An Irreplaceable Tool in Osteopathic Student Education
Bikman, T. J., Ford, J., Schmidt, D., Ridpath, L.
The Journal of the American Osteopathic Association, 2014/12


3399

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text

3400

Piriformis Syndrome: A Case Study
Lee, J. M., McCaffrey, K.
The AAO Journal, 2014/11
Free full text

3401

Effects of Osteopathic Manipulative Treatment (OMT) in Lowering Perceived Stress in Medical, Dental, and Pharmacy Student Populations
Frye, K. L., Williams, C. J., Johnson, B. N., Quinn, T. A., Fotopoulos, T. J.
The AAO Journal, 2014/11
Free full text

3402


3403

Osteopathic emergency medicine programs infrequently publish in high-impact emergency medicine journals
Baskin, S. M., Lin, C., Carlson, J. N.
Western Journal of Emergency Medicine, 2014/11
Free full text







3410

Professionalism score and academic performance in osteopathic medical students
Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text


3412

Observational study fails to demonstrate the effectiveness of OMT in decreasing low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text


3414

Osteopathic manipulative treatment for postural orthostatic tachycardia syndrome
Goodkin, M. B., Bellew, L. J.
The Journal of the American Osteopathic Association, 2014/11
Free full text


3416

The Effect of Optimally Timed Osteopathic Manipulative Treatment on Length of Hospital Stay in Moderate and Late Preterm Infants: Results from a RCT
Pizzolorusso, G., Cerritelli, F., Accorsi, A., Lucci, C., Tubaldi, L., Lancellotti, J., Barlafante, G., Renzetti, C., D', Incecco, C., Perri, F. P.
Evidence-based Complementary and Alternative Medicine, 2014/11
Free full text



3419

A modified Delphi consensus study to identify UK osteopathic profession research priorities
Rushton, A. B., Fawkes, C. A., Carnes, D., Moore, A. P.
Manual Therapy, 2014/10

3420

Die Bedeutung der Faszien im Hochleistungssport
(The importance of fascia in high-performance sports)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text


3422

Osteopathic Manipulative Treatment Induces Enhanced Intracellular Immune Response
Blumer, J.
The Journal of the American Osteopathic Association, 2014/10
Free full text

3423

OMT Is Efficacious for Patients With High Baseline Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/10
Free full text

3424

Als Osteopath bei den Olympischen Sommerspielen
(At the Summer Olympics as an Osteopath)
Maurer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10


3426

Response to letter to the editor
Bolino, G., Mangiulli, T.
Medicine, Science and the Law, 2014/10
Free full text


3428

Onset of complications following cervical manipulation due to malpractice in osteopathic treatment: a case report
Cicconi, M., Mangiulli, T., Bolino, G.
Medicine, Science and the Law, 2014/10

3429

Valuable information about current clinical practice
Vaughan, B., Thomson, O.
Medicine, Science and the Law, 2014/10
Free full text


3431

Der Muskelfaserriss
(The torn muscle fiber)
Taenzer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10

3432

Changes in rat spinal cord gene expression after inflammatory hyperalgesia of the joint and manual therapy
Ruhlen, R. L., Singh, V. K., Pazdernik, V. K., Towns, L. C., Snider, E. J., Sargentini, N. J., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/10
Free full text


3434

Myers' response to Tozzi's editorial
Myers, T.
Journal of Bodywork and Movement Therapies, 2014/10

3435

Achillodynie
(Achillodynia)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text



3438

Deformations experienced in the human skin, adipose tissue, and fascia in osteopathic manipulative medicine
Chaudhry, H., Bukiet, B., Ji, Z., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2014/10
Free full text



3441

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

3442

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

3443

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text

3444

The runner's kidney: A case report
Lalonde, F.
International Journal of Osteopathic Medicine, 2014/09/01/

3445

The runner's kidney: A case report
Lalonde, F.
International Journal of Osteopathic Medicine, 2014/09/01/

3446

Pilot trial of osteopathic manipulative therapy for patients with frequent episodic tension-type headache
Rolle, G., Tremolizzo, L., Somalvico, F., Ferrarese, C., Bressan, L. C.
The Journal of the American Osteopathic Association, 2014/09
Free full text

3447

Relationships between the Comprehensive Osteopathic Medical Achievement Test (COMAT) subject examinations and the COMLEX-USA Level 2-Cognitive Evaluation
Li, F., Kalinowski, K. E., Song, H., Bates, B. P.
The Journal of the American Osteopathic Association, 2014/09
Free full text

3448

Benchmarking the strategies for assessing clinical reasoning in osteopathic curricula
Moore, K., Grace, S., Orrock, P., Coutts, R., Blaich, R., Vaughan, B.
International Journal of Osteopathic Medicine, 2014/09

3449

Osteopaths' professional views, identities and conceptions – A qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/09

3450

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09

3451

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09

3452

Results, solutions, and learning: The continuing maturation of osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2014/09

3453

Adverse events in pediatric osteopathy
Kales, S.
Unpublished MSc thesis, 2014/09
Free full text




3457

Pierre robin sequence in a neonate with suckling difficulty and weight loss
Summers, J., Ludwig, J., Kanze, D.
The Journal of the American Osteopathic Association, 2014/09
Free full text

3458

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text

3459

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text

3460

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text


3462

H-reflex responses to High-Velocity Low-Amplitude manipulation in asymptomatic adults
Groisman, S., Silva, L., Rocha, N., Hoff, F., Rodrigues, M. E., Ehlers, J. A., Diniz, L. R.
International Journal of Osteopathic Medicine, 2014/09


3464

Primary reasons for osteopathic consultation: a prospective survey in Quebec
Morin, C., Aubin, A.
PLoS One, 2014/09
Free full text

3465

A degree of difference: the origins of osteopathy and the first use of the “DO“ designation
Stark, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text


3467

Nonmedical Use of Stimulants Among Medical Students
Wasserman, J. A., Fitzgerald, J. E., Sunny, M. A., Cole, M., Suminski, R. R., Dougherty, J. J.
The Journal of the American Osteopathic Association, 2014/08
Free full text

3468

Use of osteopathic manipulative treatment to manage recurrent bouts of singultus
Seidel, B., Desipio, G. B.
The Journal of the American Osteopathic Association, 2014/08
Free full text

3469

Multitasking behaviors of osteopathic medical students
Shah, A. V., Mullens, D. J., Van Duyn, L. J., Januchowski, R. P.
The Journal of the American Osteopathic Association, 2014/08
Free full text

3470


3471

Osteopathic manipulative treatment for nonspecific low back pain: a systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
BMC Musculoskeletal Disorders, 2014/08
Free full text


3473

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text

3474

Quality of life in patients referring to private osteopathic clinical practice: A prospective observational study
Cerritelli, F., Verzella, M., Barlafante, G.
Complementary Therapies in Medicine, 2014/08

3475

Burnout among osteopathic otolaryngology residents: identification during formative training years
Yost, M. G., Johnson, J. C., Johns, M. M., Burchett, K. D.
The Journal of the American Osteopathic Association, 2014/08
Free full text

3476

Cost-effectiveness of manual therapy for the management of musculoskeletal conditions: a systematic review and narrative synthesis of evidence from randomized controlled trials
Tsertsvadze, A., Clar, C., Court, R., Clarke, A., Mistry, H., Sutcliffe, P.
Journal of Manipulative and Physiological Therapeutics, 2014/07
Free full text

3477

Response: observational study demonstrates that OMT is associated with reduced analgesic prescribing and fewer missed work days
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text

3478

Im Gespräch mit … Gert Roncada
(In dialog with Gert Roncada)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07

3479

Impact of osteopathic treatment on pain in adult patients with cystic fibrosis--a pilot randomized controlled study
Hubert, D., Soubeiran, L., Gourmelon, F., Grenet, D., Serreau, R., Perrodeau, E., Zegarra-Parodi, R., Boutron, I.
PLoS One, 2014/07
Free full text




3483

Association between cervical and thoracic somatic dysfunction among second-year osteopathic medical students
Brindise, J. P., Nelson, K. E., Kappler, R. E.
The Journal of the American Osteopathic Association, 2014/07
Free full text

3484

Osteopathische Annäherung an die Arteriosklerose
(Osteopathic approach to arteriosclerosis)
Elferink, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07

3485

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text

3486

Mountaineering-induced bilateral plantar paresthesia
Henderson, K. K., Parker, J., Heinking, K. P.
The Journal of the American Osteopathic Association, 2014/07
Free full text

3487

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text

3488

Perception-based effects of clinical exposure to osteopathic manipulative treatment on first- and second-year osteopathic medical students
Vazzana, K. M., Yao, S. C., Jung, M. K., Terzella, M. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text

3489

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text

3490

Osteopathic Manipulative Treatment in Vestibular Neuritis: A Case Report
Ross, B. S., Johnson, V. M.
The AAO Journal, 2014/06
Free full text

3491

Treatment of Common Fibular (Peroneal) Nerve Palsy With Osteopathic Manipulative Medicine: A Case Study
Jahnke, B. M., Hopson, P., Worden, K.
The AAO Journal, 2014/06
Free full text


3493

Comparison of Patient Records From the Still-Hildreth Sanatorium With Published Reports
Ching, L. M., Shaw, H. H.
The AAO Journal, 2014/06
Free full text

3494

Is There a Place for Osteopathy in Parkinson Disease Management? A Retrospective Case Control Study
Catanzaro, M. P., Vazzana, K. M., Chen, A., Mancini, J. D., Yao, S. C.
The AAO Journal, 2014/06
Free full text

3495

The Role of Osteopathic Manipulative Medicine in the Treatment of Dacryostenosis
Apoznanski, T. E., Abu-Sbaih, R., Yao, S. C.
The AAO Journal, 2014/06
Free full text

3496

Diagnostic reasoning in osteopathy – A qualitative study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/06

3497

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06




3501

Assessing palpation thresholds of osteopathic medical students using static models of the lumbar spine
Snider, E. J., Pamperin, K., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/06
Free full text

3502

Traumatic Groin Injury in a Football Player: A Case Report
Tsukanov, D., Dowling, D. J., Weiss, L.
The AAO Journal, 2014/06
Free full text

3503

Management of Levator Ani Syndrome With Osteopathic Manipulative Treatment: A Case Study
Yoshida, M., Derenge, D., Worden, K.
The AAO Journal, 2014/06
Free full text

3504

Osteopathic manipulative treatment for inpatients with pulmonary exacerbations of cystic fibrosis: effects on spirometry findings and patient assessments of breathing, anxiety, and pain
Swender, D. A., Thompson, G., Schneider, K., McCoy, K., Patel, A.
The Journal of the American Osteopathic Association, 2014/06
Free full text

3505

Application of osteopathy in the cranial field to treat left superior homonymous hemianopsia
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2014/06


3507

Effect of a general osteopathic treatment on body satisfaction, global self perception and anxiety: A randomized trial in asymptomatic female students
Dugailly, P.M., Fassin, S., Maroye, L., Evers, L., Klein, P., Feipel, V.
International Journal of Osteopathic Medicine, 2014/06

3508

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06

3509

Osteopathic approach to sacroiliac dysfunction in a patient with steroid myopathy: case report and literature review
Kohns, D. J., Fitch, D. S.
The Journal of the American Osteopathic Association, 2014/06
Free full text

3510

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text

3511

Predictive relationship of osteopathic manual medicine grades and COMLEX-USA Level 1 total scores and osteopathic principles and practice subscores
Lewis, D. D., Johnson, M. T., Finnerty, E. P.
The Journal of the American Osteopathic Association, 2014/06
Free full text

3512

Effectiveness of osteopathic manipulative therapy for managing symptoms of irritable bowel syndrome: a systematic review
Muller, A., Franke, H., Resch, K.L., Fryer, G.
The Journal of the American Osteopathic Association, 2014/06

3513

Effect of osteopathic manipulative treatment on middle ear effusion following acute otitis media in young children: a pilot study
Steele, K. M., Carreiro, J. E., Viola, J. H., Conte, J. A., Ridpath, L. C.
The Journal of the American Osteopathic Association, 2014/06
Free full text

3514

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text



3517

The Journal of the American Osteopathic Association: the next generation
Orenstein, R.
The Journal of the American Osteopathic Association, 2014/05
Free full text

3518

Response to Letter About “An Unexpectedly Progressed Lumbar Herniated Disk“
Lipton, J. A., McLeod, G. A.
The Journal of the American Osteopathic Association, 2014/05
Free full text

3519

OMT Improves Acute Hemodynamic Control in Pregnancy by Means of Improved Venous Return
Seffinger, M. A., Brohard, J. N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

3520

Two novel nonsurgical treatments of carpal tunnel syndrome
Schreiber, A. L., Sucher, B. M., Nazarian, L. N.
Physical Medicine and Rehabilitation Clinics of North America, 2014/05

3521

Osteopathy: helping pregnant women in pain
Randall, S.
The Practising Midwife, 2014/05

3522

Osteopathic graduate medical education: new research standards needed
Shulman, H. M., Cooper, K., Devine, W., Trzeciak, M., Burney, U., Chan, W. P., Gomez, A., Humpherys, J., Safavi, H., Yoshida, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

3523

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

3524

An Unexpectedly Progressed Lumbar Herniated Disk
Gilliss, A. C.
The Journal of the American Osteopathic Association, 2014/05
Free full text


3526

The DREEM, part 2: psychometric properties in an osteopathic student population
Vaughan, B., Mulcahy, J., McLaughlin, P.
BMC Medical Education, 2014/05
Free full text

3527

Somatic dysfunction and use of osteopathic manual treatment techniques during ambulatory medical care visits: a CONCORD-PBRN study
Licciardone, J. C., Kearns, C. M., King, H. H., Seffinger, M. A., Crow, W. T., Zajac, P., Devine, W. H., Abu-Sbaih, R. Y., Miller, S. J., Berkowitz, M. R., Dyer, R., Heath, D. M., Treffer, K. D., Nevins, N. A., Aryal, S.
The Journal of the American Osteopathic Association, 2014/05
Free full text

3528

The DREEM, part 1: measurement of the educational environment in an osteopathy teaching program
Vaughan, B., Carter, A., Macfarlane, C., Morrison, T.
BMC Medical Education, 2014/05
Free full text

3529

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text

3530

Introducing an osteopathic approach into neonatology ward: the NE-O model
Cerritelli, F., Martelli, M., Renzetti, C., Pizzolorusso, G., Cozzolino, V., Barlafante, G.
Chiropractic & Manual Therapies, 2014/05
Free full text

3531

Investigation into factors influencing roles, relationships, and referrals in integrative medicine
Gray, B., Orrock, P.
The Journal of Alternative and Complementary Medicine, 2014/05
Free full text

3532

Effect of osteopathic manipulative therapy in the attentive performance of children with attention-deficit/hyperactivity disorder
Accorsi, A., Lucci, C., Di Mattia, L., Granchelli, C., Barlafante, G., Fini, F., Pizzolorusso, G., Cerritelli, F., Pincherle, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

3533

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text

3534

Strain counterstrain technique to decrease tender point palpation pain compared to control conditions: a systematic review with meta-analysis
Wong, C. K., Abraham, T., Karimi, P., Ow-Wing, C.
Journal of Bodywork and Movement Therapies, 2014/04

3535

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text



3538

Das fetale Alkoholsyndrom
(Fetal alcohol syndrome)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04

3539

The use of technology and perceptions of its effectiveness in training physicians
Mason, P. B., Turgeon, B. M., Cossman, J. S., Lay, D. M.
Medical Teacher, 2014/04

3540

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text

3541

Reevaluating osteopathic medical education for the 21st century and beyond
Shannon, S. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text



3544

Besserung der Symptome bei Multipler Sklerose
(Improvement of symptoms in multiple sclerosis)
Butenschön, W.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04


3546

Concurrent validity of the Osteopathic General Surgery In-Service Examination
Falcone, J. L., Rosen, M. E.
The Journal of the American Osteopathic Association, 2014/04
Free full text

3547

Approach to low back pain – osteopathy
Vaughan, B., Morrison, T., Buttigieg, D., Macfarlane, C., Fryer, G.
Australian Family Physician, 2014/04
Free full text

3548

Student- and faculty-reported importance of science prerequisites for osteopathic medical school: a survey-based study
Binstock, J., Junsanto-Bahri, T.
The Journal of the American Osteopathic Association, 2014/04
Free full text

3549

Unified graduate medical education accreditation: a better plow
Bulger, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text

3550

Do placebo effects associated with sham osteopathic procedure occur in newborns? Results of a randomized controlled trial
Martelli, M., Cardinali, L., Barlafante, G., Pizzolorusso, G., Renzetti, C., Cerritelli, F.
Complementary Therapies in Medicine, 2014/04

3551

Moving from EBM to EBOM: an osteopathic perspective on evidence-based medicine
Danto, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text

3552

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text

3553

Relationship between COMLEX-USA scores and performance on the American Osteopathic Board of Emergency Medicine Part I certifying examination
Li, F., Gimpel, J. R., Arenson, E., Song, H., Bates, B. P., Ludwin, F.
The Journal of the American Osteopathic Association, 2014/04
Free full text

3554

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text

3555

Osteopathic manipulative treatment as a useful adjunctive tool for pneumonia
Yao, S., Hassani, J., Gagne, M., George, G., Gilliar, W.
Journal of Visualized Experiments, 2014/04
Free full text


3557

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text

3558

Usefulness of Video Learning for Osteopathic Manipulative Medicine Techniques in the Classroom and Clinical Setting
Meghpara, M., Yao, S. C., Flaum, T. B., Caron, E., Terzella, M. J.
The AAO Journal, 2014/03
Free full text





3563

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03

3564

Factors important to applicants to osteopathic versus allopathic emergency medicine residency programs
St Amour, B. A.
Western Journal of Emergency Medicine, 2014/03
Free full text


3566

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text


3568

Preliminary findings on the use of osteopathic manipulative treatment: outcomes during the formation of the practice-based research network, DO-Touch.NET
Degenhardt, B. F., Johnson, J. C., Gross, S. R., Hagan, C., Lund, G., Curry, W. J.
The Journal of the American Osteopathic Association, 2014/03
Free full text

3569

Qualitative evaluation of osteopathic manipulative therapy in a patient with gastroesophageal reflux disease: a brief report
Diniz, L. R., Nesi, J., Curi, A. C., Martins, W.
The Journal of the American Osteopathic Association, 2014/03
Free full text

3570

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text

3571

Assessing criticality in student research reports: Preliminary results from a new educational card sorting activity
Abbey, H., Esteves, J. E., Vogel, S., Tyreman, S. J.
International Journal of Osteopathic Medicine, 2014/03

3572

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03


3574

Evidence of declining empathy in third year osteopathic medical students
Caruso, H. M., Bernstein, B.
International Journal of Osteopathic Medicine, 2014/03

3575

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03


3577

Osteopathic manipulative treatment in tarsal somatic dysfunction: a case study
Alsager, D. E.
The Journal of the American Osteopathic Association, 2014/03
Free full text

3578

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03

3579

Osteopathic manipulative therapy induces early plasma cytokine release and mobilization of a population of blood dendritic cells
Walkowski, S., Singh, M., Puertas, J., Pate, M., Goodrum, K., Benencia, F.
PLoS One, 2014/03
Free full text

3580

Vestibular dysfunction in patients with chronic pain or underlying neurologic disorders
Gilbert, J. W., Vogt, M., Windsor, R. E., Mick, G. E., Richardson, G. B., Storey, B. B., Herder, S. L., Ledford, S., Abrams, D. A., Theobald, M. K., Cunningham, D., Kelly, L., Herring, K. V., Maddox, M. L.
The Journal of the American Osteopathic Association, 2014/03
Free full text

3581

OMT associated with reduced analgesic prescribing and fewer missed work days in patients with low back pain: an observational study
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/02
Free full text

3582



3584

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text


3586

Correlation of the emergency medicine resident in-service examination with the American Osteopathic Board of Emergency Medicine Part I
Levy, D., Dvorkin, R., Schwartz, A., Zimmerman, S., Li, F.
Western Journal of Emergency Medicine, 2014/02
Free full text

3587

Should osteopathic students applying to allopathic emergency medicine programs take the USMLE Exam?
Weizberg, M., Kass, D., Husain, A., Cohen, J., Hahn, B.
Western Journal of Emergency Medicine, 2014/02
Free full text

3588

Osteopathic manipulative treatment in the management of biliary dyskinesia
Heineman, K.
The Journal of the American Osteopathic Association, 2014/02
Free full text

3589

Mini-medical school programs are an effective tool to introduce students to osteopathic medicine
Kaye, K. E., Berns, A. L., Cress, L. R., Nazar, A. M.
The Journal of the American Osteopathic Association, 2014/02
Free full text


3591

Transcending the International Osteopathic Identity: Cross-Sectional Analysis of Osteopathic Principles and Practice in Peru
Lim, L., Sergent, S., Gordon, T., Wiseman, K., Hawkins, J., Willyerd, G., Gorbis, S.
The Journal of the American Osteopathic Association, 2014/01

3592

Changes in Biomechanical Dysfunction With Osteopathic Manual Treatment in Patients With Chronic Low Back Pain According to Diabetes Mellitus Status
Panjwani, R., Kearns, C., Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/01

3593

Somatic dysfunction and fascia's gliding-potential
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text

3594

Effect of Osteopathic Manipulative Medicine Thoracic Cage Techniques on Parkinson Disease Patients
Vazzana, K. M., Hart, A., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2014/01

3595

No place like HOME
Pham, J. T.
The Journal of the American Osteopathic Association, 2014/01
Free full text

3596

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text

3597

OMT Relieves Severe Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

3598

Systematic Review Paints Incomplete Picture of OMT Research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text


3600

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01

3601

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

3602

Der lebendige Fuß des Menschen aus osteopathischer Sicht
(The living human foot from an osteopathic perspective)
Wales, A., Mitha, N., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

3603

Der Osteopath am Fuße des Patienten
(The osteopath at the foot of the patient)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01


3605

Die Mechanik des Fußes
(The mechanics of the foot)
Zwierzchowska, Z., Vieten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

3606


3607

Ein neuer Ansatz zur Behandlung von Haltungsstörungen
(A new approach to the treatment of postural disorders)
Beck, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

3608

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text


3610

Osteopathic Manual Treatment and Ultrasound Therapy for Chronic Low Back Pain: An Illustration of Osteopathic Semantic Confusion
Cymet, T. C.
The Journal of the American Osteopathic Association, 2014/01
Free full text




3614

Osteopathic manipulative treatment of congenital talipes equinovarus: a case report
Andreoli, E., Troiani, A., Tucci, V., Barlafante, G., Cerritelli, F., Pizzolorusso, G., Renzetti, C., Vanni, D., Pantalone, A., Salini, V.
Journal of Bodywork and Movement Therapies, 2014/01

3615

Effects of 7-Technique Osteopathic Manipulative Protocol on Patients With COPD
Carter Decker, J., Tylski, E., Stevens Coe, J., McClain, R., Gautam, D., McClain, E. K., Ogden, R., Kolo, G.
The Journal of the American Osteopathic Association, 2014/01

3616

Awareness of Hereditary Cancer in Osteopathic Physicians
Cohn, J. E., Soshnick, S., Blazey, W., Koehler, S., Laurent, B., Chan, V., Jung, M.K., Tegay, D., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2014/01

3617

Efficacy of Osteopathic Manipulative Treatment on Pulmonary Function in Healthy Adult Male Subjects
Hines, P. J., Heinking, K., Henderson, K.
The Journal of the American Osteopathic Association, 2014/01

3618

Effect of Osteopathic Manipulative Treatment on Blood Lactate Clearance After High Intensity Exercise
Khuc, B. M., Mendez, J., Wong, T. S., Hiserote, R. M.
The Journal of the American Osteopathic Association, 2014/01



3621

Prevention curricula assessment of osteopathic medical schools in the United States
Dombrowski, H. T., Vincent, O. D., Wiley, C. L.
International Journal of Osteopathic Medicine, 2013/12

3622

Patient perception of osteopathic training in the UK and patient reported experience
Drysdale, I. P., Hinkley, H., Rolfe, K. J.
International Journal of Osteopathic Medicine, 2013/12

3623

Script concordance test: Insights from the literature and early stages of its implementation in osteopathy
Esteves, J. E., Bennison, M., Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12

3624

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12

3625

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12

3626

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12

3627

Emotional processing and its relationship to chronic low back pain
Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12

3628

Introduction to the special issue on osteopathic education
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2013/12

3629

OMT especially recommended for severe low back pain
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/12

3630

The OSCE in a pre-registration osteopathy program: Introduction and psychometric properties
Vaughan, B., Florentine, P.
International Journal of Osteopathic Medicine, 2013/12


3632

Acute improvement in hemodynamic control after osteopathic manipulative treatment in the third trimester of pregnancy
Hensel, K. L., Pacchia, C. F., Smith, M. L.
Complementary Therapies in Medicine, 2013/12
Free full text

3633

On the oft-debated question of what it means to be an osteopathic physician
Benzoni, T.
The Journal of the American Osteopathic Association, 2013/12
Free full text

3634

Preventive osteopathic manipulative treatment and stress fracture incidence among collegiate cross-country athletes
Brumm, L. F., Janiski, C., Balawender, J. L., Feinstein, A.
The Journal of the American Osteopathic Association, 2013/12
Free full text

3635

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text

3636

Use of OMT to Treat Patient with Ramsay Hunt Syndrome and HIV: A Case Study
Baker, J. P.
The AAO Journal, 2013/12
Free full text

3637

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text

3638

Potential New Dimensions in Dermatology: The Osteopathic Approach to Cutaneous Disease
Michunovich, A. M., Stern, R.
The AAO Journal, 2013/12
Free full text


3640

Lymphatic Pump Treatment Repeatedly Enhances the Lymphatic and Immune Systems
Schander, A., Padro, D., King, H. H., Downey, H. F., Hodge, L. M.
Lymphatic Research and Biology, 2013/12

3641

Osteopathic graduate medical education: a way forward
Terry, R.
The Journal of the American Osteopathic Association, 2013/12
Free full text

3642

Assessing undergraduate osteopaths in the identification of patients' excess body weight
Bright, P., Wasik, C.
International Journal of Osteopathic Medicine, 2013/12

3643

Patients' expectations of private osteopathic care in the UK
Chippendale, E.
International Journal of Osteopathic Medicine, 2013/12

3644










3653

Prevalence of visits to five types of complementary and alternative medicine practitioners by the general population: a systematic review
Cooper, K. L., Harris, P. E., Relton, C., Thomas, K. J.
Complementary Therapies in Clinical Practice, 2013/11

3654

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text

3655

Tobacco dependence curricula in US osteopathic medical schools: a follow-up study
Griffith, B. N., Montalto, N. J., Ridpath, L., Sullivan, K.
The Journal of the American Osteopathic Association, 2013/11
Free full text

3656

Role of osteopathic structural diagnosis and osteopathic manipulative treatment for diabetes mellitus and its complications
Johnson, A. W., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2013/11
Free full text

3657

Pursuit of Complementary and Alternative Medicine Treatments in Adolescents With Cerebral Palsy
Majnemer, A., Shikako-Thomas, K., Shevell, M. I., Poulin, C., Lach, L., Schmitz, N., Law, M., Group the, Q.
Journal of Child Neurology, 2013/11

3658

Effect of selected manual therapy interventions for mechanical neck pain on vertebral and internal carotid arterial blood flow and cerebral inflow
Thomas, L. C., Rivett, D. A., Bateman, G., Stanwell, P., Levi, C. R.
Physical Therapy, 2013/11
Free full text

3659

Don't Throw the Baby Out With the Bath Water
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text

3660

Systematic Review of OMTh for Lower Urinary Tract Symptoms in Women Shows Benefit
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text

3661

Systematic Review of CAM Approaches to Otitis Media: The Otolaryngology Perspective
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text


3663

Influence of Manual Therapy on Functional Mobility After Joint Injury in a Rat Model
Ruhlen, R. L., Snider, E. J., Sargentini, N. J., Worthington, B. D., Singh, V. K., Pazdernik, V. K., Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/10
Free full text

3664

Response to “Letter to the Editor Regarding ‘The Somatic Connection: Manual Therapy Is Beneficial for Cervical Radiculopathy””
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text





3669

Gesichtsfeldeinschränkung nach Unfall
(Visual field impairment after accident)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10


3671

Pattern and predictors of complementary and alternative medicine (CAM) use among pediatric patients with epilepsy
Doering, J. H., Reuner, G., Kadish, N. E., Pietz, J., Schubert-Bast, S.
Epilepsy & Behavior, 2013/10

3672

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text

3673


3674

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text

3675

Retrospective medical record review of an osteopathic manipulative medicine hospital consultation service
Snider, K. T., Snider, E. J., DeGooyer, B. R., Bukowski, A. M., Fleming, R. K., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/10
Free full text


3677

Patients' appraisals of public and private healthcare: a qualitative study of physiotherapy and osteopathy
Bradbury, K. J., Bishop, F. L., Yardley, L., Lewith, G.
Journal of Health Psychology, 2013/10

3678

Osteopathic manipulative treatment (OMT) during labor facilitates a natural, drug-free childbirth for a primigravida patient: A case report
Smallwood, C. R., Borgerding, C. J., Cox, M. S., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2013/09





3683

Thoracic and abdominal lymphatic pump techniques inhibit the growth of S. pneumoniae bacteria in the lungs of rats
Creasy, C., Schander, A., Orlowski, A., Hodge, L. M.
Lymphatic Research and Biology, 2013/09
Free full text

3684

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text

3685


3686

Osteopathic Management of a Family with Inherited Cervical Dystonia
Mancini, J. D., Burns, D. K.
The AAO Journal, 2013/09
Free full text

3687

Usefulness of Video Learning for Osteopathic Manipulative Medicine (OMM) Techniques in the Educational and Clinical Setting
Meghpara, M. K., Terzella, M. J., Flaum, T. B., Jung, M.K., Yao, S. C.
The AAO Journal, 2013/09
Free full text

3688

Frequency of counterstrain tender points in osteopathic medical students
Snider, K. T., Glover, J. C., Rennie, P. R., Ferrill, H. P., Morris, W. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text



3691

Offer and use of complementary and alternative medicine in hospitals of the French-speaking part of Switzerland
Carruzzo, P., Graz, B., Rodondi, P. Y., Michaud, P. A.
Swiss Medical Weekly, 2013/09
Free full text

3692

Osteopath is incorrect term for osteopathic physicians
Kaufman, B.
American Family Physician, 2013/08
Free full text

3693

Evaluation of the acceptability of Peer Physical Examination (PPE) in medical and osteopathic students: a cross sectional survey
Consorti, F., Mancuso, R., Piccolo, A., Consorti, G., Zurlo, J.
BMC Medical Education, 2013/08
Free full text

3694

A profile of osteopathic practice in Australia 2010-2011: a cross sectional survey
Burke, S. R., Myers, R., Zhang, A. L.
BMC Musculoskeletal Disorders, 2013/08

3695

Interventions for preventing and treating pelvic and back pain in pregnancy
Pennick, V., Liddle, S. D.
Cochrane Database of Systematic Reviews, 2013/08
Free full text

3696

One of ours
Burhop, J.
The Journal of the American Osteopathic Association, 2013/08
Free full text

3697

Relighting the fire in our bellies
Cain, R. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text

3698

The effect of OMT on postoperative medical and functional recovery of coronary artery bypass graft patients
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/08
Free full text

3699

Conservative approach to tardive dyskinesia-induced neck and upper back pain
Reifsnyder, J. W., Tettambel, M. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text

3700

Mathematical analysis of the flow of hyaluronic acid around fascia during manual therapy motions
Roman, M., Chaudhry, H., Bukiet, B., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2013/08
Free full text

3701

Effects of Osteopathic Manipulative Treatment on Self-Perceived Stress in First-Year Osteopathic Medical Students
Bianchi, W., Cooper, M., Roberts, C., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

3702

Portfolios in Osteopathic Medical Education: A Qualitative Pilot Study
Miner, A., Pierce, L. J., Sidhu, K., Menini, T.
The Journal of the American Osteopathic Association, 2013/08

3703

Reducing Medical Student Fatigue With Osteopathic Manipulative Treatment
Wiegand, S., Jordan, L., Van Tiem, M., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

3704

Peripheral Skin Blood Flow Changes After Different Controlled Cervical Osteopathic Mobilizations: A Pilot Study
Zegarra Parodi, R., Kvam, V., Park, P., Shurtz, N. R., Webb, S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/08

3705

Further Demonstration of the Benefit of Osteopathic Manipulative Therapy in Pediatric Care
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text

3706

Osteopathic Manipulative Therapy Affects the Position of Internal Organs in Humans
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text

3707

Osteopathic Manipulative Treatment Is Efficacious for Management of Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text

3708



3710

Okulomotorik und visuelle Teilleistungsstörungen
(Oculomotor and partial visual impairment)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

3711

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text

3712

Osteopathic Training for MDs
Fredericks, T. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text

3713

Osteopathic manipulative treatment for facial numbness and pain after whiplash injury
Genese, J. S.
The Journal of the American Osteopathic Association, 2013/07
Free full text


3715

Fascia's function: classical osteopathic perspectives and current research compared
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2013/07
Free full text

3716

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07

3717

Osteopathic manipulative treatment for pediatric conditions: a systematic review
Posadzki, P., Lee, M. S., Ernst, E.
Pediatrics, 2013/07


3719

Efficacy of osteopathy and other manual treatment approaches for malocclusion – A systematic review of evidence
Andresen, T., Bahr, C., Ciranna-Raab, C.
International Journal of Osteopathic Medicine, 2013/06

3720


3721

Item development for a questionnaire investigating patient self reported perception, satisfaction and outcomes of a single osteopathy in the cranial field (OCF) treatment
Mulcahy, J., Vaughan, B., Boadle, J., Klas, D., Rickson, C., Woodman, L.
International Journal of Osteopathic Medicine, 2013/06

3722

Osteopathie als Kunst?
(Osteopathy as art?)
Novy, R., Sommerfeld, P.
Osteopathische Medizin, 2013/06

3723

Compliance with clinical guidelines for whiplash improved with a targeted implementation strategy: a prospective cohort study
Rebbeck, T., Macedo, L. G., Maher, C. G.
BMC Health Services Research, 2013/06
Free full text

3724

Osteopathic treatment of patients with long-term sequelae of whiplash injury: effect on neck pain disability and quality of life
Schwerla, F., Kaiser, A. K., Gietz, R., Kastner, R.
The Journal of Alternative and Complementary Medicine, 2013/06


3726

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text

3727

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text

3728

Osteopathic manual treatment in patients with diabetes mellitus and comorbid chronic low back pain: subgroup results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2013/06
Free full text


3730

Distance learning and osteopathic manipulative medicine
Blumer, J. U.
The AAO Journal, 2013/06
Free full text

3731

Relief of persistent jaw pain with the use of osteopathic manipulative medicine
Lipton, J. A., Covington, J. D.
The AAO Journal, 2013/06
Free full text

3732

Osteopathic evaluation of somatic dysfunction and craniosacral strain pattern among preterm and term newborns
Pizzolorusso, G., Cerritelli, F., D', Orazio, M., Cozzolino, V., Turi, P., Renzetti, C., Barlafante, G., D', Incecco, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

3733

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

3734

Complementary and alternative medicine for pediatric otitis media
Levi, J. R., Brody, R. M., McKee-Cole, K., Pribitkin, E., O'Reilly, R.
International Journal of Pediatric Otorhinolaryngology, 2013/06

3735

Patients' expectations of private osteopathic care in the UK: a national survey of patients
Leach, C. M., Mandy, A., Hankins, M., Bottomley, L. M., Cross, V., Fawkes, C. A., Fiske, A., Moore, A. P.
BMC Complementary Medicine and Therapies, 2013/05
Free full text

3736

Use of the SMART Balance Master to quantify the effects of osteopathic manipulative treatment in patients with dizziness
Fraix, M., Gordon, A., Graham, V., Hurwitz, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text

3737

He walked with confidence into the wilderness of life: a tribute to Philip E. Greenman, DO (1928-2013)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text


3739

The effect of osteopathic manipulative treatment on postoperative medical and functional recovery of coronary artery bypass graft patients
Wieting, J. M., Beal, C., Roth, G. L., Gorbis, S., Dillard, L., Gilliland, D., Rowan, J.
The Journal of the American Osteopathic Association, 2013/05
Free full text

3740

Back to back: postnatal osteopathic care
Johnson, C.
The Practising Midwife, 2013/05


3742

Manual Therapy May Benefit Women With Primary Dysmenorrhea
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3743

Severity of Irritable Bowel Syndrome Symptoms Is Reduced by Osteopathy
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3744

Response
Suminski, R. R., Wasserman, J. A., Guillory, V. J., Hendrix, D., May, L. E.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3745

Osteopathic intervention in chronic non-specific low back pain: a systematic review
Orrock, P. J., Myers, S. P.
BMC Musculoskeletal Disorders, 2013/04
Free full text

3746

Osteopathic postdoctoral training institutions and academic sponsorship
Biszewski, M.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3747

Osteopathic graduate medical education 2013
DeRosier, A., Lischka, T. A., Martinez, B.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3748

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3749

Bibliometric measures and National Institutes of Health funding at COMs, 2006-2010
Gugliucci, A.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3750

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text

3751

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3752

Impact indices shed false light
McDonald, R. G.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3753

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3754

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3755

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

3756


3757

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text


3759

Evaluation of behavioural and gastrointestinal symptoms in autistic children after visceral osteopathic treatment
Castellarin, I. B., Drysdale, I. P., Patel, V.
International Journal of Osteopathic Medicine, 2013/03

3760

Is osteopathic manipulative treatment effective in migraine?
Cerritelli, F., Caprari, E., Di Vincenzo, M., Ginevri, L. R., Messi, G., Renzetti, C., Cozzolino, V., Frattesi, C., Barlafante, G., Foschi, N.
International Journal of Osteopathic Medicine, 2013/03

3761

Osteopathic principles in the modern world
Cotton, A.
International Journal of Osteopathic Medicine, 2013/03

3762

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03

3763

Profiling osteopathic practice in the UK using standardised data collection
Fawkes, C. A., Leach, J. M. C., Mathias, S., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

3764

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03


3766

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03

3767

The Biopsychosocial model: Redefining osteopathic philosophy?
Penney, J. N.
International Journal of Osteopathic Medicine, 2013/03

3768

An historical perspective on principles of osteopathy
Stark, J. E.
International Journal of Osteopathic Medicine, 2013/03

3769

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

3770

Clinical reasoning and therapeutic approaches of experienced osteopaths
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

3771

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03





3776

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Minotti, D. E., Gatchel, R. J., Kearns, C. M., Singh, K. P.
Annals of Family Medicine, 2013/03
Free full text

3777

Special issue: Osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2013/03


3779

Effect of osteopathic manipulative treatment on incidence of postoperative ileus and hospital length of stay in general surgical patients
Baltazar, G. A., Betler, M. P., Akella, K., Khatri, R., Asaro, R., Chendrasekhar, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text

3780

Somatic hygiene: osteopathic manipulative medicine as preventive treatment
Bowers, R. J.
The Journal of the American Osteopathic Association, 2013/03
Free full text

3781

Osteopathic manipulative treatment for colonic inertia
Cohen-Lewe, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text

3782

Osteopathic manipulative treatment for Lyme disease-induced Bell’s palsy: A case study
Baker, J. P., Baker, C. D.
The AAO Journal, 2013/03
Free full text


3784

Osteopathic manipulative treatment of pes anserine bursitis using the triple technique: A case report
Chmielewski, R., Peña, N., Capalbo, G.
The AAO Journal, 2013/03
Free full text


3786




3789

‘POSTE’ study (Patients OSTeopathic Experience): A UK national survey of patients: Part III
Drysdale, I. P., Rolfe, K. J., Hinkley, H.
International Journal of Osteopathic Medicine, 2013/03

3790

Patients' expectations of private osteopathic care in the UK: A national survey of patients
Leach, J. M. C., Mandy, A., Cross, V., Fawkes, C. A., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03


3792

OMT: Reducing Pain and Changing International Patient Perception
Lim, L., Gordon, T., Sergent, S., Hawkins, J., Simon, J., Bajoka, B., Favazza, L., Wiseman, K., Schrotenboer, A., Cameroamortegui, F., Willyerd, G., Gorbis, S.
The Journal of the American Osteopathic Association, 2013/03

3793

Achieving Effective and Efficient Musculoskeletal Pain Relief Through TCM and OMM
Moy, C., Yu, J., Chiu, R., Hwang, Y. C., Lin, W., Lin, S.L., Burns, J., Lin, A.
The Journal of the American Osteopathic Association, 2013/03

3794

Referrals to chiropractors and osteopaths: a survey of general practitioners in rural and regional New South Wales, Australia
Wardle, J. L., Sibbritt, D. W., Adams, J.
Chiropractic & Manual Therapies, 2013/02
Free full text

3795

How patients choose osteopaths: a mixed methods study
Bishop, F. L., Bradbury, K., Hj Jeludin, N. N., Massey, Y., Lewith, G. T.
Complementary Therapies in Medicine, 2013/02

3796

Strain-counterstrain to treat restrictions of the mobility of the cervical spine in patients with neck pain: a sham-controlled randomized trial
Klein, R., Bareis, A., Schneider, A., Linde, K.
Complementary Therapies in Medicine, 2013/02
Free full text


3798

Predictors of scoring at least 600 on COMLEX-USA Level 1: successful preparation strategies
Vora, A., Maltezos, N., Alfonzo, L., Hernandez, N., Calix, E., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2013/02
Free full text

3799

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text

3800

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text


3802

Fracture healing with osteopathy in traditional Mongolian medicine
Zhao, N., Wang, M., Li, X.
Journal of Traditional Chinese Medicine, 2013/02
Free full text

3803

Headache in children: update on complementary treatments
Schetzek, S., Heinen, F., Kruse, S., Borggraefe, I., Bonfert, M., Gaul, C., Gottschling, S., Ebinger, F.
Neuropediatrics, 2013/02
Free full text

3804

Exercise Shown Effective for Management of Neck Pain—Who Needs OMT?
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text

3805

Frozen Shoulder Treatment—Different Strokes for Different Folks
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text

3806

Trauma: Betrachtung aus osteopathischer Sicht
(Trauma: Viewed from an osteopathic perspective)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01

3807

Polytrauma durch Motorradunfall
(Polytrauma due to motorcycle accident)
Koop, J. P.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01

3808

Osteopathic Fascial Manipulation Reduces Low Back Pain and Increases Kidney Mobility
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/01
Free full text





3813

Osteopathic manipulative treatment (OMT) for lower urinary tract symptoms (LUTS) in women
Franke, H., Hoesele, K.
Journal of Bodywork and Movement Therapies, 2013/01

3814

A new look for the Journal of the American Osteopathic Association
Berneath Lang, D., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2013/01
Free full text

3815

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text


3817

2012 student research abstracts and poster competitions
Neufeld, K. S.
The Journal of the American Osteopathic Association, 2013/01
Free full text


3819

A comparative study of cervical hysteresis characteristics after various osteopathic manipulative treatment (OMT) modalities
Barnes, P. L., Laboy, F., Noto-Bell, L., Ferencz, V., Nelson, J., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2013/01

3820

Manual therapy for childhood respiratory disease: a systematic review
Pepino, V. C., Ribeiro, J. D., Ribeiro, M. A., de Noronha, M., Mezzacappa, M. A., Schivinski, C. I.
Journal of Manipulative and Physiological Therapeutics, 2013/01


3822

Use of OMT in Recreational Runners as Preventive Medicine
Daly, J., Zhu, C., Hanna, J.
The Journal of the American Osteopathic Association, 2013/01

3823

Die Gesundheit im Trauma entdecken
(Discovering health within trauma)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01

3824

Survey of Patient Knowledge of Osteopathic Physicians and Osteopathic Manipulative Treatment
Snell, P. D., AbdurRaqeeb, O. A., Smith, T. L., Huckabee, M. M., Keenum, A.
The Journal of the American Osteopathic Association, 2013/01


3826

A six year head-to-head comparison of osteopathic and allopathic applicants to a university-based, allopathic general surgery residency
Schlitzkus, L. L., Clark, C. J., Agle, S. C., Schenarts, P. J.
Journal of Surgical Education, 2012/12-11
Free full text

3827

Manual therapy for chronic obstructive airways disease: a systematic review of current evidence
Heneghan, N. R., Adab, P., Balanos, G. M., Jordan, R. E.
Manual Therapy, 2012/12
Free full text


3829

Osteopathic diagnosis and treatment of sacral fracture: A case study
Dean, A. L.
The AAO Journal, 2012/12
Free full text


3831

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12

3832

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12



3835

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12

3836

Methods of assessment used by osteopathic educational institutions
Vaughan, B., Sullivan, V., Gosling, C., McLaughlin, P., Fryer, G., Wolff, M., Gabb, R.
International Journal of Osteopathic Medicine, 2012/12


3838

Manipulative therapies for infantile colic
Dobson, D., Lucassen, P. L., Miller, J. J., Vlieger, A. M., Prescott, P., Lewith, G.
Cochrane database of systematic reviews, 2012/12
Free full text

3839

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text

3840

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text

3841

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text

3842

OCC: will it never end?
Sylvara, J. T.
The Journal of the American Osteopathic Association, 2012/12
Free full text

3843

Establishing the content validity of palpatory examination for the assessment of the lumbar spine using ultrasonography: a pilot study
Shaw, K. A., Dougherty, J. J., Treffer, K. D., Glaros, A. G.
The Journal of the American Osteopathic Association, 2012/12
Free full text

3844

Depression, somatization, and somatic dysfunction in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Gatchel, R. J., Kearns, C. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2012/12
Free full text

3845

Touch - more than a basic science
Lalonde, F.
The Journal of the American Osteopathic Association, 2012/12
Free full text

3846

Manipulation of the coccyx with anesthesia for the management of coccydynia
Emerson, S. S., Speece III., A. J.
The Journal of the American Osteopathic Association, 2012/12
Free full text

3847




3850

Isolated calcaneofibular ligament injuries treated with osteopathic manipulative treatment: A case series
Olds, K., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/12

3851

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text

3852

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text

3853

Bibliometric measures and National Institutes of Health funding at colleges of osteopathic medicine, 2006-2010
Suminski, R. R., Hendrix, D., May, L. E., Wasserman, J. A., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/11
Free full text

3854

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text

3855

Complementary and Alternative Therapies in Surgical Care
Bjerså, K.
Unpublished PhD thesis, 2012/11
Free full text

3856

Osteopathic manipulative treatment: much more than simply a “hands-on“ phenomenon
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text










3866

(Osteopathic treatment of patients with shoulder pain. A randomized controlled study)
Hinse, T., Klosterkamp, M.
Unpublished D.O. thesis, 2012/10








3874

The immediate effects of sigmoid colon manipulation on pressure pain thresholds in the lumbar spine
McSweeney, T. P., Thomson, O. P., Johnston, R.
Journal of Bodywork and Movement Therapies, 2012/10
Free full text

3875

971 Neonatology-Osteopathy (Ne-O) Study: RCT on the Effect of Osteopathic Manipulative Treatment on Los
Accorsi, A., Lucci, C., Pizzolorusso, G., Tubaldi, L., Cerritelli, F., Perri, F. P.
Archives of Disease in Childhood, 2012/10

3876

Osteopathic manipulative treatment in obese patients with chronic low back pain: a pilot study
Vismara, L., Cimolin, V., Menegoni, F., Zaina, F., Galli, M., Negrini, S., Villa, V., Capodaglio, P.
Manual Therapy, 2012/10
Free full text


3878

Osteopathic manipulative treatment: novel application to dermatological disease
Campbell, S. M., Winkelmann, R. R., Walkowski, S.
Journal of Clinical and Aesthetic Dermatology, 2012/10

3879

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text

3880

Combined manual therapy techniques for the treatment of women with infertility: a case series
Kramp, M. E.
The Journal of the American Osteopathic Association, 2012/10
Free full text

3881

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text


3883

Consent in osteopathy: A cross sectional survey of patients' information and process preferences
Daniels, G., Vogel, S.
International Journal of Osteopathic Medicine, 2012/09


3885

Osteopathic education: Editorial call for papers
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2012/09











3896

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving the quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Gulisano, V., Orfei, S.
Clinical Cases in Mineral and Bone Metabolism, 2012/09
Free full text


3898

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text

3899

Advancing osteopathic medicine through research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2012/09
Free full text

3900

Associations of cytokine concentrations with key osteopathic lesions and clinical outcomes in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Bergamini, M. V.
The Journal of the American Osteopathic Association, 2012/09
Free full text

3901

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text

3902

Precompetition manipulative treatment and performance among Virginia Tech athletes during 2 consecutive football seasons: a preliminary, retrospective report
Brolinson, P. G., Smolka, M., Rogers, M., Sukpraprut, S., Goforth, M. W., Tilley, G., Doolan, K. P.
The Journal of the American Osteopathic Association, 2012/09
Free full text

3903

Neuropathy of the inferior alveolar nerve: A case report
Seals, R. A., Crow, T.
The AAO Journal, 2012/09
Free full text

3904

Assessing the effectiveness of OMT provided by predoctoral teaching fellows as measured by a visual analog pain scale
Sarkaria, J. A., Render, R. M., Lerma, C. M., Henley, N., Seffinger, M. A., Hruby, R. J.
The AAO Journal, 2012/09
Free full text

3905

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the USMLE
Lenchus, J. D.
The Journal of the American Osteopathic Association, 2012/08
Free full text


3907

Health-related Internet use among patients of osteopathic physicians
Cooley, D. L., Mancuso, A. M., Weiss, L. B., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text

3908

Osteopathy improves the severity of irritable bowel syndrome: a pilot randomized sham-controlled study
Florance, B. M., Frin, G., Dainese, R., Nebot-Vivinus, M. H., Marine Barjoan, E., Marjoux, S., Laurens, J. P., Payrouse, J. L., Hebuterne, X., Piche, T.
European Journal of Gastroenterology & Hepatology, 2012/08
Free full text

3909

Psoas syndrome: a frequently missed diagnosis
Tufo, A., Desai, G. J., Cox, W. J.
The Journal of the American Osteopathic Association, 2012/08
Free full text

3910

Preventative Osteopathic Manipulative Treatment and the Elderly Nursing Home Resident: A Pilot Study
Snider, K. T., Snider, E. J., Johnson, J. C., Hagan, C., Schoenwald, C.
The Journal of the American Osteopathic Association, 2012/08
Free full text

3911

Touch: vital to patient-physician relationships
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/08
Free full text

3912

Frequency of specific osteopathic manipulative treatment modalities used by candidates while taking COMLEX-USA Level 2-PE
Langenau, E. E., Dowling, D. J., Dyer, C., Roberts, W. L.
The Journal of the American Osteopathic Association, 2012/08
Free full text

3913

Neonatology-Osteopathy (NE-O) Study: A Randomized Controlled Trial on the Effect of Osteopathic Manipulative Treatment on Length of Stay
Accorsi, A., Lucci, C., Lancellotti, J., Pizzolorusso, G., Santini, N., Durastanti, C., Barlafante, G., Tubaldi, L., Perri, F. P., Cerritelli, F.
The Journal of the American Osteopathic Association, 2012/08


3915

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text

3916

Three-Dimensional Analysis of OMT in the Post–Total Arthroplasty Knee
Simela, A.
The Journal of the American Osteopathic Association, 2012/08

3917

Assessing Palpation Thresholds Using Static Lumbar Spine Models
Snider, E. J., Pamperin, K. L., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2012/08

3918

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text

3919

Acute Effects of Osteopathic Manipulative Treatment on Persistent Hindlimb Flexion
Winterson, B., McDevitt Ray, B., Assadollahzadeh, M., Chipman, M. A.
The Journal of the American Osteopathic Association, 2012/08

3920

Burnout Among Osteopathic Otolaryngology Residents: Identification, Prevention, and Treatment During Formative Training Years
Yost, M., Johnson, J. C., Burchett, K.
The Journal of the American Osteopathic Association, 2012/08


3922

Quels traitements pour les coliques du nourrisson?
(Which treatments for infantile colics?)
Bruyas-Bertholon, V., Lachaux, A., Dubois, J.P., Fourneret, P., Letrilliart, L.
La Presse Médicale, 2012/07-08


3924

Stressinkontinenz nach einer Geburt
(Stress incontinence after childbirth)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07


3926

We have met the enemy and he is us
Vanderburgh, A. J.
The Journal of the American Osteopathic Association, 2012/07
Free full text

3927

Increase of lower esophageal sphincter pressure after osteopathic intervention on the diaphragm in patients with gastroesophageal reflux
da Silva, R. C., de Sa, C. C., Pascual-Vaca, A. O., de Souza Fontes, L. H., Herbella Fernandes, F. A., Dib, R. A., Blanco, C. R., Queiroz, R. A., Navarro-Rodriguez, T.
Diseases of the Esophagus, 2012/07
Free full text

3928

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text

3929

Kreuzschmerzen während der Schwangerschaft
(Low back pain during pregnancy)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

3930

Osteopathic manipulative treatment to resolve head and neck pain after tooth extraction
Meyer, P. M., Gustowski, S. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

3931

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

3932

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

3933

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text

3934

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text


3936

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06



3939

Osteopathic physicians and international medical graduates in the rural primary care physician workforce
Fordyce, M. A., Doescher, M. P., Chen, F. M., Hart, L. G.
Family Medicine, 2012/06

3940

Assessment of the influence of osteopathic myofascial techniques on normalization of the vocal tract functions in patients with occupational dysphonia
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Malinska, J., Golusinski, W., Sliwinska-Kowalska, M.
International Journal of Occupational Medicine and Environmental Health, 2012/06

3941

Osteopathic manipulative medicine for carpal tunnel syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text

3942

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text

3943

Rigor in medical writing: quoting accurately
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text

3944

Osteopathic manipulative treatment in pregnant women
Lavelle, J. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text

3945

Empathy in osteopathic medical students: a cross-sectional analysis
Kimmelman, M., Giacobbe, J., Faden, J., Kumar, G., Pinckney, C. C., Steer, R.
The Journal of the American Osteopathic Association, 2012/06
Free full text


3947

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text

3948

Letter About “Thanks, but No Thanks: How Denial of Osteopathic Service in the World Wars Shaped the Profession–1”
Stiger, J.
The Journal of the American Osteopathic Association, 2012/05
Free full text

3949

Thanks but no thanks: how denial of osteopathic service in the world wars shaped the profession
Schriner, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text

3950

Efficacy of osteopathic manipulative treatment for low back pain in euhydrated and hypohydrated conditions: a randomized crossover trial
Parker, J., Heinking, K. P., Kappler, R. E.
The Journal of the American Osteopathic Association, 2012/05
Free full text

3951

Iliacus tender points in young adults: a pilot study
Liu, Y., Palmer, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text



3954

Im Gespräch mit … Lorenz Wilkens
(In dialog with Lorenz Wilkens)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04

3955

Assessment of Low Back and Pelvic Pain after applying the Pelvis Global Manipulation Technique in Patients with Primary Dysmenorrhea: A Pilot Study
Molins-Cubero, S., Boscá-Gandia, J. J., Rus-Martinez, M. A.
European Journal Osteopathy & Related Clinical Research, 2012/04
Free full text

3956

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text

3957

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text



3960

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text


3962

Redirect terminology debate toward improved definition of osteopathic medicine
Ching, L. M.
The Journal of the American Osteopathic Association, 2012/03
Free full text











3973

Osteopathie in Belgien
(Osteopathy in Belgium)
van Dun, P. L. S.
Osteopathische Medizin, 2012/03


3975

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03

3976

Chiropractic or Osteopathic Manipulation for Children in the United States: An Analysis of Data from the 2007 National Health Interview Survey
Ndetan, H., Evans, M. W., Hawk, C., Walker, C.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text

3977

Stress reduction with osteopathy assessed with GDV electrophotonic imaging: effects of osteopathy treatment
Korotkov, K., Shelkov, O., Shevtsov, A., Mohov, D., Paoletti, S., Mirosnichenko, D., Labkovskaya, E., Robertson, L.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text

3978

Selected fascial aspects of osteopathic practice
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2012/03
Free full text

3979

The Neural Basis of the Osteopathic Lesion
Korr, I. M.
The AAO Journal, 2012/03
Free full text

3980

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text

3981

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text

3982

Anterior hip pain – Have you considered femoroacetabular impingement?
Chakraverty, J. K., Snelling, N. J.
International Journal of Osteopathic Medicine, 2012/03

3983

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03

3984

Osteopathic manipulative treatment effectiveness in severe chronic obstructive pulmonary disease: a pilot study
Zanotti, E., Berardinelli, P., Bizzarri, C., Civardi, A., Manstretta, A., Rossetti, S., Fracchia, C.
Complementary Therapies in Medicine, 2012/02-04
Free full text

3985

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the United States Medical Licensing Examination
Hasty, R. T., Snyder, S., Suciu, G. P., Moskow, J. M.
The Journal of the American Osteopathic Association, 2012/02
Free full text



3988

Osteopathie studieren – wieso, weshalb, warum?
(Why study osteopathy?)
Meyer, B., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02




3992

A randomized, controlled trial of osteopathic manipulative treatment for acute low back pain in active duty military personnel
Cruser d, A., Maurer, D., Hensel, K., Brown, S., White, K., Stoll, S.
Journal of Manual & Manipulative Therapy, 2012/02


3994

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text

3995

Oral health awareness for osteopathic medical students--a medical and dental collaborative effort
Rosenheck, A. H., Scott, G. J., Dombrowski, H. T., Cohen, H. V., York, J. A., Kleiman, A., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/02
Free full text

3996

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02


3998

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02





4003

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text

4004

Use of therapies other than disease-modifying agents, including complementary and alternative medicine, by patients with multiple sclerosis: a survey study
Stoll, S. S., Nieves, C., Tabby, D. S., Schwartzman, R.
The Journal of the American Osteopathic Association, 2012/01
Free full text

4005

Cranial osteopathic manipulative medicine's growing evidence base
King, H. H.
The Journal of the American Osteopathic Association, 2012/01
Free full text


4007

Effect of OMT on Heart Rate in Normotensive and Prehypertensive Individuals
Siu, V. N., Cooper, A., Rezk, M., Terzella, M., Yao, S. C., Gilliar, W.
The Journal of the American Osteopathic Association, 2012/01

4008

Towards a more international community in osteopathy
Moran, R. W.
International Journal of Osteopathic Medicine, 2011/12

4009

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12

4010

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text

4011

Background and methodology of the Osteopathic Survey of Health Care in America 2010 (OSTEOSURV 2010)
Licciardone, J. C., Kearns, C. M., Ruggiere, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text

4012

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text

4013



4015

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12



4018

Manipulative Methods of Dr. A.T. Still
Archer, J.
The AAO Journal, 2011/12
Free full text



4021

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text




4025

Time to direct COM candidates away from the MCAT?
Kauffman, M.
The Journal of the American Osteopathic Association, 2011/11
Free full text

4026

Sociodemographic and geographic characteristics associated with patient visits to osteopathic physicians for primary care
Licciardone, J. C., Singh, K. P.
BMC Health Services Research, 2011/11
Free full text

4027

Exploring the impact of osteopathic treatment on cranial asymmetries associated with nonsynostotic plagiocephaly in infants
Lessard, S., Gagnon, I., Trottier, N.
Complementary Therapies in Clinical Practice, 2011/11
Free full text


4029

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text

4030

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text

4031

Atmung und obere Thoraxöffnung
(Breathing and upper thoracic opening)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10

4032

Promoting safe and efficacious vaccines for adults
Grogg, S. E.
The Journal of the American Osteopathic Association, 2011/10
Free full text




4036

Support for women in osteopathic medicine who breastfeed: a call for action
Pieh-Holder, K. L.
The Journal of the American Osteopathic Association, 2011/10
Free full text

4037

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text

4038

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09

4039

The effect of strain counterstrain (SCS) on forearm strength compared to sham positioning
Wong, C. K., Moskovitz, N., Fabillar, R.
International Journal of Osteopathic Medicine, 2011/09

4040

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text

4041

Ultrasonography-guided osteopathic manipulative treatment for a patient with thoracic outlet syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 2011/09
Free full text

4042

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text







4049

Call for papers: An invitation to contribute to a special issue on osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2011/09

4050

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Melnick, A.
The Journal of the American Osteopathic Association, 2011/09
Free full text





4055

Eating our seed corn, again!
Berkowitz, M. R.
The AAO Journal, 2011/09
Free full text


4057


4058

Técnica articular para disfunción de malar en eversión
(Articular technique for zygoma in eversion dysfunction)
Antolinos Campillo, P. J., Baño Alcaraz, A., Pascual-Vaca, J. O.
Osteopatía Científica, 2011/09

4059


4060

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09



4063

Criterios de calidad en investigación osteopática (III)
(Quality criteria for osteopathic research (III))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/09

4064

Research and treatment bulletin 1/2011
Blanchard, P.
International Journal of Osteopathic Medicine, 2011/09

4065

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Perrotta, A. L.
The Journal of the American Osteopathic Association, 2011/09
Free full text

4066

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?
Shaw, H. H.
The Journal of the American Osteopathic Association, 2011/08
Free full text

4067

A Possible Contribution of Osteopathic Medicine in the Management of Children Affected by ADD/ADHD
Accorsi, A., Chiara, L., Di Mattia, L., Granchelli, C., Cozzolino, V., Cerritelli, F., Pizzolorusso, G., Barlafante, G.
The Journal of the American Osteopathic Association, 2011/08

4068

What Drew You to Osteopathic Medicine? A Survey of Osteopathic Medical Students From 10 Schools
Draper, B. B., Johnson, J. C., Chamberlain, N.
The Journal of the American Osteopathic Association, 2011/08

4069

Evaluation of Osteopathic Manipulative Medicine Pretreatment for the Prevention of Acute Mountain Sickness
Li, R.C., Hwang, J., Shultz, L., Burns, J. M., Garcia-Russell, N.
The Journal of the American Osteopathic Association, 2011/08

4070

Osteopathic Medical Students' Attitude Toward Complementary and Alternative Medicine
Shubrook, J. H., Kanadiya, M. K.
The Journal of the American Osteopathic Association, 2011/08

4071

Improving Resident Research Projects by Providing a Focused Research Infrastructure and Training on Evidence-Based Practice
Weiss, L. B., Filipetto, F. A., Zipp, C. P., Gupta, A. K., Switala, C. A.
The Journal of the American Osteopathic Association, 2011/08

4072


4073

Lymphstau im linken Bein
(Lymphatic congestion in the left leg)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07

4074

Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes
Langenau, E. E., Sandella, J. M.
The Journal of the American Osteopathic Association, 2011/07
Free full text


4076

Lymphsystem und osteopathische Forschung
(Lymphatic system and osteopathic research)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07

4077

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text



4080


4081

An investigation into the transition from student to practising osteopath
Davidson, Y. M.
Unpublished MSc thesis, 2011/07
Free full text


4083

A review of the breastfeeding literature relevant to osteopathic practice
Cornall, D.
International Journal of Osteopathic Medicine, 2011/06


4085

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06

4086

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06

4087

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06

4088

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text

4089

Effects of comprehensive osteopathic manipulative treatment on balance in elderly patients: a pilot study
Lopez, D., King, H. H., Knebl, J. A., Kosmopoulos, V., Collins, D., Patterson, R. M.
The Journal of the American Osteopathic Association, 2011/06
Free full text


4091

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text


4093

Effect of osteopathic manipulative treatment on gastrointestinal function and length of stay of preterm infants: an exploratory study
Pizzolorusso, F., Turi, P., Barlafante, G., Cerritelli, F., Renzetti, C., Cozzolino, V., D'Orazio, M., Fusilli, P., Carinci, F., D'Incecco, C.
Chiropractic & Manual Therapies, 2011/06
Free full text

4094

Osteopathic manipulative treatment in patients with low back pain
Licciardone, J. C.
Clinical Rheumatology, 2011/06



4097

The effectiveness of osteopathic treatment in women with endometriosis-related pain
Schneider-Milo, U.
Unpublished MSc thesis, 2011/06
Free full text


4099

Diagnostic Palpation in Osteopathic Medicine: A Putative Neurocognitive Model of Expertise
Esteves, J. E. d. J.
Unpublished PhD thesis, 2011/06
Free full text



4102

Patients’ perceptions of post-treatment experiences in osteopathy: A qualitative study using focus groups
Bright, P., Rajendran, D., Bettles, S., Carnes, D., Mullinger, B.
European Journal of Integrative Medicine, 2011/06
Free full text

4103

Osteopathic approach to a patient with chronic fatigue syndrome
Chong, A., Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text

4104

Jenette “Nettie” Bolles: First woman to pioneer osteopathy
Blumer, J.
The AAO Journal, 2011/06
Free full text

4105

Flawed science is not evidence-based osteopathic medicine
Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text




4109

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text

4110

DOs should endorse an evidence-based national healthcare policy
Graham, J. D.
The Journal of the American Osteopathic Association, 2011/05
Free full text

4111

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?: a pilot study
Newberry, M. A., Bowen, G. S., Trubey, K., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2011/05
Free full text




4115

Are clinical protocols for osteopathic manipulative procedures truly “osteopathic“?
Kirsch, J. R.
The Journal of the American Osteopathic Association, 2011/05
Free full text

4116

One osteopathic physician's path through an ACGME-Accredited Residency
Patchett, D. C.
The Journal of the American Osteopathic Association, 2011/05
Free full text

4117

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text

4118

Tug technique de escafoides para escafoides en rotación externa
(The Tug navicular technique for externally rotated navicular bones)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05



4121

Criterios de calidad en investigación osteopática (II)
(Quality criteria in osteopathic research (II))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/05


4123

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4124

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4125

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4126

Psychosomatik des Kiefergelenks
(Psychosomatics of the temporomandibular joint)
Lieberman, J.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04

4127

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4128

Interprofessional education: cooperation among osteopathic medicine, pharmacy, and physician assistant students to recognize medical errors
Meszaros, K., Lopes, I. C., Goldsmith, P. C., Knapp, K. K.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4129

Osteopathic Issues Raised by the September 2010 JAOA
Patriquin, D. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4130

Understanding osteopathic medical school applicants and the class of 2014
Ramos, R. L., Zhou, C., Hasan, M., Herrera, S. J., Bono, N. A., Hallas, B. H.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4131

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4132

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4133

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

4134

Evaluation of colleges of osteopathic medicine: training for the evaluators
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text


4136

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04

4137

Osteopathic manipulative treatment is effective on pain control associated to spinal cord injury
Arienti, C., Dacco, S., Piccolo, I., Redaelli, T.
Spinal Cord, 2011/04
Free full text

4138

An Osteopathic Approach to Chronic Sinusitis
Lee-Wong, M., Karagic, M., Doshi, A., Gomez, S., Resnick, D.
Journal of Allergy & Therapy, 2011/04
Free full text

4139

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03

4140

An evaluation of osteopathic school programs designed to promote rural location by graduates
Whitacre, B. E., Pace, V., Hackler, J. B., Janey, M., Landgraf, C. E., Pettit, W. J.
International Journal of Osteopathic Medicine, 2011/03

4141

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text

4142

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text

4143

Impact of osteopathic manipulative treatment on secretory immunoglobulin a levels in a stressed population
Saggio, G., Docimo, S., Pilc, J., Norton, J., Gilliar, W.
The Journal of the American Osteopathic Association, 2011/03
Free full text

4144

Osteopathic manipulative treatment in developing countries: a call for education and research
Szkwarko, D.
The Journal of the American Osteopathic Association, 2011/03
Free full text

4145

Somatische Dysfunktion
(Somatic dysfunction)
Adler-Michaelson, P.
Osteopathische Medizin, 2011/03



4148

Osteopathie an Kliniken (Interviews)
(Osteopathy in hospitals)
Hogrefe, H.C., Graf, A., Bockius, D.
Osteopathische Medizin, 2011/03

4149

Muscle energy technique: An evidence-informed approach
Fryer, G.
International Journal of Osteopathic Medicine, 2011/03

4150

Efficacy of osteopathic manipulative treatment of female patients with migraine: results of a randomized controlled trial
Voigt, K., Liebnitzky, J., Burmeister, U., Sihvonen-Riemenschneider, H., Beck, M., Voigt, R., Bergmann, A.
The Journal of Alternative and Complementary Medicine, 2011/03
Free full text



4153

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text




4157

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03

4158

Research and treatment bulletin 2/2011
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2011/03


4160

New COMLEX-USA-to-USMLE conversion formula needed
Burmeister, J. D.
The Journal of the American Osteopathic Association, 2011/02
Free full text

4161

Manual therapy of the mandibular accessory ligaments for the management of temporomandibular joint disorders
Cuccia, A. M., Caradonna, C., Caradonna, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text


4163

Communication by degrees
Melnick, A.
The Journal of the American Osteopathic Association, 2011/02
Free full text

4164


4165

Management of Dupuytren contracture with ultrasound-guided lidocaine injection and needle aponeurotomy coupled with osteopathic manipulative treatment
Sampson, S., Meng, M., Schulte, A., Trainor, D., Montenegro, R., Aufiero, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text

4166

Low back pain, somatic dysfunction, and segmental bone mineral density T-score variation in the lumbar spine
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J.
The Journal of the American Osteopathic Association, 2011/02
Free full text

4167

Cranial osteopathy for children with cerebral palsy: a randomised controlled trial
Wyatt, K., Edwards, V., Franck, L., Britten, N., Creanor, S., Maddick, A., Logan, S.
Archives of Disease in Childhood, 2011/02
Free full text

4168

Osteopathy for musculoskeletal pain patients: a systematic review of randomized controlled trials
Posadzki, P., Ernst, E.
Clinical Rheumatology, 2011/02
Free full text

4169

Management of suppurative cervical lymphadenitis in a healthy 24-year-old man
Hernandez, M., Chowdhury, R., Woods, J., Cabrera, J., Hardigan, P. C.
The Journal of the American Osteopathic Association, 2011/01
Free full text

4170

Osteopathic manipulative treatment for the treatment of hospitalized premature infants with nipple feeding dysfunction
Lund, G. C., Edwards, G., Medlin, B., Keller, D., Beck, B., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text

4171

Student abstracts and poster competitions: encouraging research
Prinsen, J. K.
The Journal of the American Osteopathic Association, 2011/01
Free full text

4172

Relationship between encounter time and candidate performance on COMLEX-USA Level 2-PE
Sandella, J. M., Roberts, W. L., Langenau, E. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text

4173

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text

4174

Osteopathic manipulation as a complementary treatment for the prevention of cardiac complications: 12-Months follow-up of intima media and blood pressure on a cohort affected by hypertension
Cerritelli, F., Carinci, F., Pizzolorusso, G., Turi, P., Renzetti, C., Pizzolorusso, F., Orlando, F., Cozzolino, V., Barlafante, G.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text



4177

“D.O. or die“: identity negotiation among osteopathic medical students
Norander, S., Mazer, J. P., Bates, B. R.
Health Communication, 2011/01
Free full text

4178

Objective Measure of Effect of Osteopathic Manipulative Treatment on Balance
Gordon, A. N., Graham, V., Hurwitz, E., Fraix, M. P., Seffinger, M.
The Journal of the American Osteopathic Association, 2011/01


4180

Osteopathic Manipulative Medicine in the Andes Mountains of Peru
Harding, S. E., Morse, J. S., Berkowitz, M. R., Tidwell, C., Bishop, K., Tidewell, B., Cruz, M. L., Morris-Mitchell, M.
The Journal of the American Osteopathic Association, 2011/01

4181

OMM and TCM: Comparisons of Manipulative Treatment
Zhang, A., Chen, S., Yen, H.R.
The Journal of the American Osteopathic Association, 2011/01





4186

Women’s attitudes to and experiences of osteopathic care during pregnancy
Kurth, A.
Unpublished MSc thesis, 2011/01
Free full text

4187




4190

Criterios de calidad en investigación osteopática (I)
(Quality criteria for osteopathic research (I))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/01

4191

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011

4192

Osteopathic Treatment for Irritable Bowel Syndrome. A Systematic Review.
Müller, A.
Unpublished MSc thesis, 2011
Free full text


4194


4195

On the Role of the Glossary
Berkowitz, M. R.
The AAO Journal, 2010/12
Free full text

4196

An Osteopathic Approach to Hypothyroidism
Burns, D. K.
The AAO Journal, 2010/12
Free full text

4197

Atypical Pathologic Somatic Dysfunctions: Techniques Revisited
Miller, D. S.
The AAO Journal, 2010/12
Free full text



4200

`Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 2010/12
Free full text


4202

Osteopathic Medicine's Holistic Approach Is More Important Than Ever
Goldberg, P. M.
The Journal of the American Osteopathic Association, 2010/12
Free full text

4203

Progression through osteopathic training in Australia: The student experience
Hartup, J. K., Murphy, R. A., Plowman, L. M., Myers, R.
International Journal of Osteopathic Medicine, 2010/12

4204

Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways
Watson, L. A., Pizzari, T.
International Journal of Osteopathic Medicine, 2010/12


4206

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 2: Treatment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12

4207

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 1: Assessment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12

4208

It Means Just What I Choose It to Mean--Neither More nor Less
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/12
Free full text

4209

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text


4211

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text

4212

Integrating Osteopathic Principle into Daily Practice
Hruby, R. J.
The AAO Journal, 2010/12
Free full text


4214



4216

Medical business education in colleges of osteopathic medicine
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2010/11
Free full text

4217

American Osteopathic Association guidelines for osteopathic manipulative treatment (OMT) for patients with low back pain
Seffinger, M. A., Buser, B. R., Licciardone, J. C., Lipton, J. A., Lynch, J. K., Patterson, M. M., Snow, R., Troutman, M. E.
The Journal of the American Osteopathic Association, 2010/11
Free full text

4218

How the AOA established the first national guidelines for OMT
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2010/11
Free full text

4219

Reliability of bony anatomic landmark asymmetry assessment in the lumbopelvic region: application to osteopathic medical education
Stovall, B. A., Kumar, S.
The Journal of the American Osteopathic Association, 2010/11
Free full text

4220

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11










4230

Management of benign paroxysmal positional vertigo with the canalith repositioning maneuver in the emergency department setting
Burmeister, D. B., Sacco, R., Rupp, V.
The Journal of the American Osteopathic Association, 2010/10
Free full text

4231

Realigning the JAOA to sharpen our focus
Capobianco, P. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text

4232

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests over a 4-month period
Degenhardt, B. F., Johnson, J. C., Snider, K. T., Snider, E. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text

4233

Effects of rib raising on the autonomic nervous system: a pilot study using noninvasive biomarkers
Magoun Jr., H. I.
The Journal of the American Osteopathic Association, 2010/10
Free full text

4234

OMT relieves low back pain during pregnancy
Kleman, P. G.
The Journal of the American Osteopathic Association, 2010/10
Free full text

4235

Development, implementation, and outcomes of an initiative to integrate evidence-based medicine into an osteopathic curriculum
Laird, S., George, J., Sanford, S. M., Coon, S.
The Journal of the American Osteopathic Association, 2010/10
Free full text

4236

Soul sickness: a frequently missed diagnosis
Tobe, E. H.
The Journal of the American Osteopathic Association, 2010/10
Free full text

4237

Plagiozephalie bei frühgeborenem Mädchen
(Plagiocephaly in premature baby girl)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10


4239

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text

4240

Test-dependent osteopathic treatment of patients with tinnitus and craniomandibular dysfunctions (CMD): A pre-post pilot trial
Salomon, J., Kronau, S., Moshövel, N., Niggemeier, H., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09/


4242



4244

Dig on: A Case Study
Kolkhorst, A. B., Kary, D. J.
The AAO Journal, 2010/09
Free full text

4245

Attitudes and Confidence Levels of Fourth Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T., Best, M., Fotopoulos, T. J., Ball, L. D., Ruston, V. J.
The AAO Journal, 2010/09
Free full text


4247

Adverse events in manual therapy: A systematic review
Carnes, D., Mars, T. S., Mullinger, B., Underwood, M.
International Journal of Osteopathic Medicine, 2010/09

4248

Effect of osteopathic treatment on the gastrointestinal system function of autistic children
Castellarin, I. B., Hucklebridge, F., Patel, V. B., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2010/09

4249

Osteopathic treatment of patients with lower urinary tract symptoms and benign prostatic hyperplasia: A pre-post pilot trial
Conrad, U., Scheuer, K., Hebgen, E., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09

4250

Somatic dysfunctions in newborns: prevalence and interoperator correlation
Cozzolino, V., Boccuzzi, M., Evangelista, S., Germinario, G., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09

4251

Impact of OMT on reducing length of stay in a population of pre-term infants
Cozzolino, V., La Mola, E., Ciardelli, F., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09

4252

Investigating the role of vision and touch in the diagnosis of somatic dysfunction
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2010/09

4253

Development of a standardised data collection (SDC) tool to profile osteopathic practice in the United Kingdom
Fawkes, C. A., Leach, C. M. J., Mathias, S., Moore, A. P.
International Journal of Osteopathic Medicine, 2010/09

4254

The use of spinal and sacroiliac joint assessment and treatment procedures within the British osteopathic profession
Fryer, G., Johnson, J. C.
International Journal of Osteopathic Medicine, 2010/09

4255

Osteopathic manipulative treatment for chronic neck pain: A randomized placebo controlled trial on the effect on pain and disability
Mandara, A., Ceriani, A., Guzzetti, G., Gulisano, V., Fusaro, A., Bado, F.
International Journal of Osteopathic Medicine, 2010/09

4256

Osteopathy as a therapy during pregnancy: A randomised controlled trial
Nistler, G., Deutschmann, U., Lenz, D., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09

4257

8th International conference on advances in osteopathic research – ICAOR 2010
International Journal of Osteopathic Medicine, 2010/09


4259

Osteopathic treatment of women with primary dysmenorrhoea: A randomised controlled trial
Pinter-Haas, A., Schach-Hirte, A., Wirthwein, P., Metcalfe, D., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09

4260

Osteopathic treatment of women with voiding dysfunction: A randomized controlled trial
Ringkamp, C., Rodriquez, B., Alberts, K., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09

4261

Osteopathic treatment of patients with shoulder pain: A randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2010/09


4263

Adverse events and treatment reactions in osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2010/09

4264

Exploring European osteopathic identity: An analysis of the professional websites of European osteopathic organizations
Wagner, C., van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2010/09


4266

Training in osteopathic structural techniques from a student perspective: A survey of final year students
Zegarra-Parodi, R., Renard, E.O., Allamand, P.
International Journal of Osteopathic Medicine, 2010/09


4268

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text

4269

Técnica de lift-off para dorsales medias (T4-T10)
(Lift off technique in medium dorsal vertebrae (T4-T10))
Iglesias, J. G., del Cerro, L. P., Rodríguez Blanco, C.
Osteopatía Científica, 2010/09


4271

Investigación en osteopatía en el ámbito internacional
(Research in osteopathy at the international level)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/09

4272

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text

4273

A ‘system based’ approach to risk assessment of the cervical spine prior to manual therapy
Taylor, Alan J., Kerry, R.
International Journal of Osteopathic Medicine, 2010/09

4274

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07


4276

The Use of Osteopathic Manipulative Treatment in the Enhancement of Pulmonary Function in an Impoverished Urban Sector of Duran, Ecuador
Barnes, P. L., Dilzer, E. J., McAuley, D. A., Kuchera, M. L., Venditto, M. A.
The Journal of the American Osteopathic Association, 2010/08

4277

Establishment of DO-Touch.NET, an OMM Practice-Based Research Network
Degenhardt, B. F., Johnson, J. C., Hagan, C., Halma, K. D.
The Journal of the American Osteopathic Association, 2010/08

4278

Characterizing Osteopathic Manipulative Techniques Used in Treating Pneumonia During the MOPSE Study
Degenhardt, B. F., Johnson, J. C., Yang, Q., Pamperin, K. L., Noll, D. R.
The Journal of the American Osteopathic Association, 2010/08

4279

COMLEX Level 2-PE Performance Differences between Left-handed and Right-handed Candidates
Langenau, E. E., Dyer, C.
The Journal of the American Osteopathic Association, 2010/08

4280

A Study of 80 Healthy Subjects: Can OMM Effects and Outcomes Be Measured Objectively Using Pulmonary Function Tests?
Morine, E., Yao, S. C., Liu, T., Werley, J., Sheikh, M. W., Gilliar, W.
The Journal of the American Osteopathic Association, 2010/08

4281

The Effect of OMT on Blood Pressure in Nonhypertensive Subjects
Rezk, M., Siu, V. N., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2010/08

4282

Standardized Patients and Osteopathic Manipulative Treatment During COMLEX-USA Level 2-PE
Sandella, J. M., Pugliano, G.
The Journal of the American Osteopathic Association, 2010/08

4283

Der Gesichtsschädel
(Patient information: The viscerocranium)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

4284

Osteopathic manipulative treatment and vertigo: a pilot study
Fraix, M.
PM&R: The Journal of Injury, Function and Rehabilitation, 2010/07




4288

Research and osteopathy: an interview with Dr Gary Fryer by Helge Franke
Franke, H.
Journal of Bodywork and Movement Therapies, 2010/07
Free full text

4289

Characteristics of pediatric patients seen in medical school-based osteopathic manipulative medicine clinics
Lund, G., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/07
Free full text

4290

Defining osteopathic medicine: can you put your finger on it?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2010/07
Free full text

4291



4293

Idiopathische Trigeminusneuralgie
(Idiopathic trigeminal neuralgia)
Liem, T., Kühn, D.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

4294

No effect of osteopathic treatment on trunk morphology and spine flexibility in young women with adolescent idiopathic scoliosis
Hasler, C., Schmid, C., Enggist, A., Neuhaus, C., Erb, T.
Journal of Children's Orthopaedics, 2010/06
Free full text

4295

Anterior superior iliac spine asymmetry assessment on a novel pelvic model: an investigation of accuracy and reliability
Stovall, B. A., Bae, S., Kumar, S.
Journal of Manipulative and Physiological Therapeutics, 2010/06
Free full text

4296

The application of osteopathic treatments to pediatric sports injuries
Bolin, D. J.
Pediatric Clinics of North America, 2010/06
Free full text

4297

Evidence Does Not Grow Stale with Age
Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text

4298

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text

4299

Low Back Pain in Rowers
Fleming, R. K., Snider, K. T.
The AAO Journal, 2010/06
Free full text

4300

Principles of Osteopathy in the Battlefield
Kozminski, M.
The AAO Journal, 2010/06
Free full text

4301

Osteopathic Diagnosis and Treatment of Dorsalgia Caused by Disturbance of Proprioception in the Cervical Spine
Lepin, A. L., Mokhov, D. E., Novoseltsev, S. V.
The AAO Journal, 2010/06
Free full text


4303

Somatic Dysfunction Following Sigmoid Colon Resection for Diverticulitis: A Case Report
Ridgeway, V., Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text



4306

Teaching osteopathic students technique; using research to identify good teaching practice
Browning, S.
International Journal of Osteopathic Medicine, 2010/06

4307

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06



4310

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05



4313

Commentary on the globalization of osteopathic medicine
Qureshi, Y., Kusienski, A. M.
Osteopathic Family Physician, 2010/05

4314

Changes in US healthcare: our time is now, but for what?
Cain, R. A.
The Journal of the American Osteopathic Association, 2010/05
Free full text




4318

Osteopathic diagnosis of an acetabular injury
Morthland, T., Cote, N. S., Humphrey, J., Fulk, D.
The Journal of the American Osteopathic Association, 2010/05
Free full text


4320

Brief report of a clinical trial on the duration of middle ear effusion in young children using a standardized osteopathic manipulative medicine protocol
Steele, K. M., Viola, J., Burns, E., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text

4321


4322

The anachronistic fight for osteopathic distinctiveness
Shore, E. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text


4324

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text

4325

Osteopathic manual therapy versus conventional conservative therapy in the treatment of temporomandibular disorders: a randomized controlled trial
Cuccia, A. M., Caradonna, C., Annunziata, V., Caradonna, D.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text


4327

Störungsketten im Bindegewebe
(Patient information: Disruptive chains in the fascia)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04


4329

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

4330

Diagnosis and management of primary pulmonary leiomyosarcoma
Arnold III., L. M., Burman, S. D., H., O-Yurvati A.
The Journal of the American Osteopathic Association, 2010/04
Free full text

4331

Adding MI principles to your communication skills: an interview with Susan Butterworth, PhD
Butterworth, S.
The Journal of the American Osteopathic Association, 2010/04
Free full text

4332

Call to action: aggressively managing lipid levels
Carr, L. L.
The Journal of the American Osteopathic Association, 2010/04
Free full text

4333

Effect of pedal pump and thoracic pump techniques on intracranial pressure in patients with traumatic brain injuries
Cramer, D., Miulli, D. E., Valcore, J. C., Taveau, J. W., Do, N., Hutton, D. S., Sonti, G., Wogu, E., Boorman, C. F., Panchal, R. R.
The Journal of the American Osteopathic Association, 2010/04
Free full text

4334

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text

4335

Effect of osteopathy in the cranial field on visual function--a pilot study
Sandhouse, M. E., Shechtman, D., Sorkin, R., Drowos, J. L., Caban-Martinez III., A. J., Patterson, M. M., Shallo-Hoffmann, J., Hardigan, P., Snyder, A.
The Journal of the American Osteopathic Association, 2010/04
Free full text

4336

Musculoskeletal dysfunction and drop foot: diagnosis and management using OMM
Sucher, B. M.
The Journal of the American Osteopathic Association, 2010/04
Free full text


4338

An introduction to clinical research in osteopathic medicine
Earley, B. E., Luce, H.
Primary Care: Clinics in Office Practice, 2010/03
Free full text






4344

The Effect of Early Clinical Exposure on Future OMT Use
Dalprat, J., Thompson, C., Hruby, R.
The AAO Journal, 2010/03
Free full text





4349

Osteopathic Manipulative Treatment In the Emergency Department: A Two-Dimensional Curriculum
Mesisca, M., Hoffman, K., Fenati, G., Hruby, R. J.
The AAO Journal, 2010/03
Free full text

4350

(Comment on the letter to the editor)
Mayer, J.
Osteopathische Medizin, 2010/03

4351

Biomechanical Disorders in the Patients with Lumbar Discal Hernias and Their Osteopathic Correction
Novoseltsev, S. V., Vcherashny, D. B.
The AAO Journal, 2010/03
Free full text



4354




4357

Osteopathic neuromuscular re-abilitation
Lederman, E.
International Journal of Osteopathic Medicine, 2010/03

4358

Osteopathy 2.0: Osteopathy and the new web
Lucas, N. P.
International Journal of Osteopathic Medicine, 2010/03

4359


4360

The effect of Osteopathic Treatment on Chronic Constipation – A Pilot Study
Brugman, R., Fitzgerald, K., Fryer, G.
International Journal of Osteopathic Medicine, 2010/03

4361

AOA should support IOM report on resident work hours
Conklin, J. H.
The Journal of the American Osteopathic Association, 2010/03
Free full text

4362

Efficacy of osteopathic manipulation as an adjunctive treatment for hospitalized patients with pneumonia: a randomized controlled trial
Noll, D. R., Degenhardt, B. F., Morley, T. F., Blais, F. X., Hortos, K. A., Hensel, K., Johnson, J. C., Pasta, D. J., Stoll, S. T.
Osteopathic Medicine and Primary Care, 2010/03
Free full text

4363

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text

4364

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text

4365

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text

4366

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text


4368

Osteopathic medical education in 2010: another decade of growth
Shannon, S. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

4369

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

4370

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text

4371

Use of osteopathic manipulative treatment to manage compensated trendelenburg gait caused by sacroiliac somatic dysfunction
Gilliss, A. C., Swanson II., R. L., Janora, D., Venkataraman, V.
The Journal of the American Osteopathic Association, 2010/02
Free full text

4372

Performing arts medicine--instrumentalist musicians, Part II--examination
Dommerholt, J.
Journal of Bodywork and Movement Therapies, 2010/01



4375

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01

4376

Osteopathic Medicine and Primary Care: one journal, two audiences
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2010/01
Free full text

4377

Osteopathic manipulative treatment of back pain and related symptoms during pregnancy: a randomized controlled trial
Licciardone, J. C., Buchanan, S., Hensel, K. L., King, H. H., Fulda, K. G., Stoll, S. T.
American Journal of Obstetrics & Gynecology, 2010/01
Free full text





4382

Using Osteopathic Manipulations to Decrease the Incidence of Acute Mountain Sickness
Abo, B. N., Garcia-Russell, N., Hiserote, R. M., Wong, T., Hakopian, D. K., Burns, J. M., Ekholm, R. K.
The Journal of the American Osteopathic Association, 2010/01

4383


4384

The Efficacy of OMT by Osteopathic Medical Students on Musculoskeletal Pain and Somatic Findings
Hallas, S. J., Seffinger, M., Hurwitz, E.
The Journal of the American Osteopathic Association, 2010/01

4385

Osteopathic Manipulative Treatments in the Emergency Department: Osteopathic Emergency Physicians’ Perspectives
Holbrook, N. B., Fryer, G., Johnson, J. C., Holbrook, C.
The Journal of the American Osteopathic Association, 2010/01


4387

Anterior Cruciate Ligament Function in Osteopathic Medical Education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2010/01

4388

A Study to Investigate the Efficacy of a Novel Interactive Web-Based Virtual Clinical Scenario System (Virtual People Factory) in Medical Education
Surkunalingam, N., Walker, J., McCaskill, S., Taranto, C., Blanchard, C., Lind, D. S., Rossen, B., Lok, B.
The Journal of the American Osteopathic Association, 2010/01

4389

Das Fasziendistorsionsmodell nach Stephen Typaldos
(The Fascial Distortion Model According to Stephen Typaldos)
Fischer, T., Rossmy, C., Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01

4390

Gary Fryer –”...there is not much that we can say without any doubt.”
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01

4391

Effect of a novel osteopathic technique on the axial length of the eye
Huang, J. H.I.
Unpublished MSc thesis, 2010/01
Free full text

4392


4393

Has osteopathy a role to play in treatment of flu?
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text



4396

Osteopathic Treatment of Female Incontinence
Hösele, K.
Unpublished MSc thesis, 2010
Free full text


4398

Benchmarks for Training in Osteopathy
World Health, Organization
, 2010
Free full text

4399


4400

Perception of osteopathic medicine among allopathic physicians in the deep central southern United States
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text

4401

Keeping the osteopathic medical profession parallel and distinctive
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/12
Free full text

4402

Musculoskeletal dysfunction and drop foot: diagnosis and management using osteopathic manipulative medicine
Lavelle, J. M., McKeigue, M. E.
The Journal of the American Osteopathic Association, 2009/12
Free full text

4403

Reject influence of pharmaceutical industry
McPartland, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text

4404

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12

4405

Carpal tunnel syndrome: ultrasonographic imaging and pathologic mechanisms of median nerve compression
Sucher, B. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text


4407

Profile of members of the Australian Osteopathic Association: Part 2 - The patients
Orrock, P.
International Journal of Osteopathic Medicine, 2009/12



4410

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text

4411

There Are More Things in Heaven and Earth…
Ching, L. M.G.
The AAO Journal, 2009/12
Free full text


4413

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text





4418

Can intraocular pressure be influenced by osteopathic treatment?
van de Kraats, A.
Unpublished MSc thesis, 2009/12
Free full text

4419

Discrimination against DOs alive and well
Hoegerl, C.
The Journal of the American Osteopathic Association, 2009/12
Free full text


4421

Billing and coding for OMT
Doss, Y. L., Snider, K. T.
The Journal of the American Osteopathic Association, 2009/11
Free full text

4422

Osteopathic manipulative treatment in the management of notalgia paresthetica
Richardson, B. S., Way, B. V., Speece III., A. J.
The Journal of the American Osteopathic Association, 2009/11
Free full text


4424

Clearly distinct: outcomes of initiative to increase integration of osteopathic principles and practice at West Virginia School of Osteopathic Medicine
Steele, K. M., Baker, H. H.
The Journal of the American Osteopathic Association, 2009/11
Free full text

4425

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text

4426

Complementary and alternative health care use in young children with physical disabilities waiting for rehabilitation services in Canada
April, K. T., Feldman, D. E., Zunzunegui, M. V., Descarreaux, M., Grilli, L.
Disability and Rehabilitation, 2009/11




4430

Maintaining distinctiveness and affordability of osteopathic medical education
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/10
Free full text


4432

Personality types and performance: COMLEX-USA Level 2-CE
Getz, R., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2009/10
Free full text






4438

Biomedical research competencies for osteopathic medical students
Cruser, D. A., Dubin, B., Brown, S. K., Bakken, L. L., Licciardone, J. C., Podawiltz, A. L., Bulik, R. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text


4440

The immediate effect of individual manipulation techniques on pulmonary function measures in persons with chronic obstructive pulmonary disease
Noll, D. R., Johnson, J. C., Baer, R. W., Snider, E. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text




4444

The effects of osteopathic treatment on constipation in children with cerebral palsy: a pilot study
Tarsuslu, T., Bol, H., Simsek, I. E., Toylan, I. E., Cam, S.
Journal of Manipulative and Physiological Therapeutics, 2009/10
Free full text




4448

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

4449

Osteopathie für Pferd und Reiter
(Osteopathy for Horse and Rider)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10


4451

Akuter Bandscheibenvorfall
(Acute spinal disk herniation)
Klein, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

4452

Neue Sportosteopathieausbildung an der OSD
(New sports osteopathy education at OSD)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

4453

Manipulation vor dem Wettkampf?
(Manipulative treatment before the competition?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

4454

Osteopathie im Sport
(Osteopathy in sports)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

4455

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10



4458

Management of chronic posttraumatic headache: a multidisciplinary approach
Channell, M. K., Mueller, L. L., Hahn, R.
The Journal of the American Osteopathic Association, 2009/09
Free full text

4459

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

4460

Curricular analysis of competency-based osteopathic medical education: application of a matrix for quality enhancement to a standardized patient encounter example
Lockwood, M. D., Tucker-Potter, S., Sargentini, N. J.
The Journal of the American Osteopathic Association, 2009/09
Free full text

4461

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09

4462



4464

A case report of Osteopathic Manipulative Treatment in a 14 year-old girl with McCune-Albright Syndrome
Colonvega, M., Hensel, K., Minotti, D. II., Williams, S.
The AAO Journal, 2009/09
Free full text

4465

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

4466


4467

Interest in rural medicine among osteopathic residents and medical students
Colegrove, D. J., Whitacre, B. E.
Rural and Remote Health, 2009/09



4470

Inter-examiner reliability of palpation for tissue texture abnormality in the thoracic paraspinal region
Paulet, T., Fryer, G.
International Journal of Osteopathic Medicine, 2009/09

4471


4472

Principios de la osteopatía en la investigación
(Osteopathic principles in research)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/09


4474

Fibromyalgia Treatment Trial With Gabapentin and Osteopathic Manipulative Medicine
Bernard, N., Marske, C. S., Palacios, A., Preiss, B., Bhattacharya, S., Brown, M., Wheeler, C., Fatunde, T.
Journal of Osteopathic Medicine, 2009/08

4475

Impact of osteopathic manipulative treatment on cost of care for patients with migraine headache: a retrospective review of patient records
Schabert, E., Crow, W. T.
The Journal of the American Osteopathic Association, 2009/08
Free full text


4477

The Osteopathic Physician and End-of-Life Care
Hernandez, M. B., Ledbetter, S. L., Trevil, R., Perez, A. M., White, C.
The Journal of the American Osteopathic Association, 2009/08

4478

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text

4479

Osteopathic Physicians and HIV/STI Prevention: Are HIV Testing and Sexual History–Taking Part of Routine Patient Care?
Gongidi, P., Bowen, G. S., Fernandez, I. M.
The Journal of the American Osteopathic Association, 2009/08

4480

The use of osteopathic manipulative treatment as adjuvant therapy in patients with peripheral arterial disease
Lombardini, R., Marchesi, S., Collebrusco, L., Vaudo, G., Pasqualini, L., Ciuffetti, G., Brozzetti, M., Lupattelli, G., Mannarino, E.
Manual Therapy, 2009/08
Free full text

4481

Teaching Psychiatry in Osteopathic Medical Schools: A Survey of Current Curriculum and a Suggested Primary Care Approach
Lowe, M., Murphy, M.
The Journal of the American Osteopathic Association, 2009/08

4482

Creation of a Database Template for Performing a Retrospective Chart Review of an OMM Hospital Consultation Service
Snider, K. T., Snider, E. J., Bukowski, A. M., Johnson, J. C., DeGooyer, B. R.
The Journal of the American Osteopathic Association, 2009/08

4483

Retrospective Chart Review of the OMM Hospital Consultation Service at NRMC - Preliminary Results
Snider, K. T., Snider, E. J., DeGooyer, B. R., Johnson, J. C., Bukowski, A. M.
The Journal of the American Osteopathic Association, 2009/08

4484

MRI Assessment of Responses to Manipulative Treatment of Individuals With Low Back Pain
Walkowski, S. A., Eland, D. C., Clark, B. C., Conatser Jr., R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2009/08

4485

Spiritual and Religious Characteristics of Osteopathic Medical Students
Workman, G. M., Lee, M. M., Nichols, K. J., Workman, D. E., Christian, V. L., Orlinsky, D. E.
The Journal of the American Osteopathic Association, 2009/08

4486

Amelioration of Oxidative Stress and Motor Deficits With Osteopathic Manipulative Treatment in a Mouse Model for Human Parkinson Disease
Zakhary, S., Jose, R., Dileo, J., Ayubcha, D., Hallas, B. H., Torres, G., Leheste, J.
The Journal of the American Osteopathic Association, 2009/08

4487

The DO difference: an analysis of causal relationships affecting the degree-change debate
Bates, B. R., Mazer, J. P., Ledbetter, A. M., Norander, S.
The Journal of the American Osteopathic Association, 2009/07
Free full text

4488

Stop smoking, save money, get free OMM
Byrnes Jr., T. R.
The Journal of the American Osteopathic Association, 2009/07
Free full text

4489

Cranial palpation pressures used by osteopathy students
Kary, D.
The Journal of the American Osteopathic Association, 2009/07
Free full text

4490

Letter to the Editor (2) Regarding “Brachial Plexus Injuries in Neonates”
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2009/07
Free full text

4491

Survey results: OMT and CAM
Ramos, R. L., Sharma, S., Lipoff, D. M.
The Journal of the American Osteopathic Association, 2009/07
Free full text


4493

Brachial plexus injuries in neonates
Sucher, B. M.
The Journal of the American Osteopathic Association, 2009/07
Free full text

4494

The road to becoming an osteopathic physician is long for a good reason
Zubcevik, N.
The Journal of the American Osteopathic Association, 2009/07
Free full text

4495

Time for the osteopathic profession to take the lead in musculoskeletal research
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/07
Free full text

4496

Headache (chronic tension-type)
Krishnan, A., Silver, N.
BMJ Clinical Evidence, 2009/07
Free full text



4499

Osteopathische Behandlung akuter Erkrankungen
(Osteopathic Treatment of Acute Diseases)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

4500

Hand anlegen beim akuten Schulterschmerz?
(Lay a hand on acute shoulder pain?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07


4502

Sinusitis
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07


4504

The appropriate amount of force used must always be individualized for each patient during each treatment session
Abu-Sbaih, R.
The Journal of the American Osteopathic Association, 2009/07
Free full text

4505

Intent to “teach“ and pay to play in osteopathic medical education
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/06
Free full text

4506

Measuring awareness, interest, and involvement in the osteopathic community through board certification: a survey of DO residents in ACGME-accredited training programs
Scott, S. C., O'Connor, E. M., Marlow, R. A.
The Journal of the American Osteopathic Association, 2009/06
Free full text

4507

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text

4508

Monitoring self-reported adverse events: A prospective, pilot study in a UK osteopathic teaching clinic
Rajendran, D., Mullinger, B., Fossum, C., Collins, P., Froud, R.
International Journal of Osteopathic Medicine, 2009/06

4509

The effects of high-velocity low-amplitude thrust manipulation and mobilisation techniques on pressure pain threshold in the lumbar spine
Thomson, O. P., Haig, L., Mansfield, H.
International Journal of Osteopathic Medicine, 2009/06


4511

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text

4512

AM Last Page: Osteopathic medicine in the U.S.A
Cummings, M., Rohrer, J.
Academic Medicine, 2009/06
Free full text

4513

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text


4515

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text

4516

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text




4520

Scapular Glide: Functional relationships, dysfunction and treatment
Kary, D. J.
The AAO Journal, 2009/06
Free full text

4521

OMT as an adjunct therapy for post-traumatic headache in U.S. soldiers: A case series
Kozminski, M., Kozminski, T.
The AAO Journal, 2009/06
Free full text

4522

Osteopathic Manipulative Management in Sudden Infant Death Syndrome
MacDonald, R. C.
The AAO Journal, 2009/06
Free full text

4523

Osteopathic approach to the spleen
Peeters, L., Lason, G.
The AAO Journal, 2009/06
Free full text


4525

O efeito imediato da manipulação talocrural na estabilidade unipodal de tornozelo
(Immediate effects of talocrural manipulation on ankle monopodalic stability)
Xavier, M., Pires, V. A., Albertini, R. A., Arrieiro, A. N., Manuard, P., Almeida, L. C., de, Souza R. A.
Revista terapia manual, 2009/05-06

4526

Contraindications in Osteopathy
Gatterbauer, A.
Unpublished MSc thesis, 2009/05
Free full text

4527

Treatment approaches in osteopathy for the therapy of migraine
Michal, I.
Unpublished MSc thesis, 2009/05
Free full text



4530

The Changing Face of Medical Education: The Role of Religion, Integrative Medicine and Osteopathy
Grossoehme, D. H., Ragsdale, J., Dixon, C., Berz, K., Zimmer, M.
The Open Medical Education Journal, 2009/05
Free full text







4537

Osteopatía basada en la evidencia
(Evidence-based osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/05


4539

Intent to “teach“ and pay to play in osteopathic medical education
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/04
Free full text

4540

Estimating cost of care for patients with acute low back pain: a retrospective review of patient records
Crow, W. T., Willis, D. R.
The Journal of the American Osteopathic Association, 2009/04
Free full text


4542

Spinal and sacroiliac assessment and treatment techniques used by osteopathic physicians in the United States
Fryer, G., Morse, C. M., Johnson, J. C.
Osteopathic Medicine and Primary Care, 2009/04
Free full text



4545

La investigación, el desarrollo y la innovación en osteopatía
(Research, development and innovation in osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/04

4546

Osteopatía en un trastorno grave de la deglución
(Osteopathic medicine in severe swallowing dysfunction)
Velasco Roldán, O., Pascual-Vaca, J. O., Solana Díaz, M. T., Outón Ruíz, L., Sebastián Rausell, J. M.
Osteopatía Científica, 2009/04



4549

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text

4550

Prevention, diagnosis, and management of osteoporosis-related fracture
Fakih, M.
The Journal of the American Osteopathic Association, 2009/03
Free full text

4551

Don't neglect the “art“ of medicine
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/03
Free full text

4552

Dual and parallel postdoctoral training programs: implications for the osteopathic medical profession
Burkhart, D. N., Lischka, T. A.
The Journal of the American Osteopathic Association, 2009/03
Free full text

4553

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques
Noll, D. R.
The Journal of the American Osteopathic Association, 2009/03
Free full text

4554

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03

4555

Osteopathic medical education in 2009: sails set for improved healthcare?
Shannon, S. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text


4557

Introducing the new masterclass section
Moran, R.
International Journal of Osteopathic Medicine, 2009/03

4558

Evolution of colleges of osteopathic medicine: a discussion of the COCA's “substantive change“ policies
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text

4559

Profile of members of the Australian Osteopathic Association: Part 1 - The practitioners
Orrock, P.
International Journal of Osteopathic Medicine, 2009/03

4560

Therapeutic needling in osteopathic practice: An evidence-informed perspective
Rickards, L. D.
International Journal of Osteopathic Medicine, 2009/03

4561

A Case History of Recent Problem Breathing and Special OMT for the Heart
Chapello, I. A.
The AAO Journal, 2009/03
Free full text

4562

The Use Of Heel Lifts and Custom Orthotics In Reducing Self-Reported Chronic Musculoskeletal Pain Scores
Lipton, J. A., Flowers-Johnson, J., Bunnell, M. T., Carter, L.
The AAO Journal, 2009/03
Free full text


4564

Treatment of the monosymptomatic Nocturnal enuresis
Scheible, B.
Unpublished MSc thesis, 2009/03
Free full text

4565

Osteopathic Manipulative Treatment as Adjuvant Therapy in Peripheral Arterial Disease.
Lombardini, R., Collebrusco, L.
Manual Therapy, 2009/03
Free full text

4566

Anamnesegesteuerte Palpation
(Anamnesis-guided palpation)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03

4567

Palpation zwischen Struktur und Energie
(Palpation between Structure and Energy)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
Free full text

4568

New horizons for research and education in osteopathic manipulative medicine
Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2009/02
Free full text

4569

Brachial plexus injuries in neonates: an osteopathic approach
Mason, D. C., Ciervo, C. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text

4570

Professional satisfaction among new osteopathic family physicians: a survey-based investigation of residency-trained graduates
Simpson, C., Cutright, M., Heh, V., Simpson, M. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text

4571

Osteopathic Medicine and Primary Care looks forward to 2009
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/02
Free full text

4572

Osteopathie und (Hatha-)Yoga
(Osteopathy and (Hatha) yoga)
Liem, T.
Osteopathische Medizin, 2009/02



4575


4576

Osteopathy and pregnancy
Hyde, D.
The Practising Midwife, 2009/02


4578

Criteria to Determine Intervals of Treatment
Halasz, C.
Unpublished MSc thesis, 2009/02
Free full text


4580

Osteopathy - the way from therapy to prevention
May, M.
Unpublished MSc thesis, 2009/02
Free full text

4581

What do patients expect, who come to an osteopathic clinic?
Meuser, A.
Unpublished MSc thesis, 2009/02
Free full text




4585

Collaboration and excellence in osteopathic medical research
Manion, K. M.
The Journal of the American Osteopathic Association, 2009/01
Free full text

4586

An Analysis of the Use of Web-Based Materials by Medical Students and its Relationship to Learning Style
Halbert, C., Fresa-Dillon, K., Kriebel, R., Coughlin, P., Cuzzolino, R.
The Journal of the American Osteopathic Association, 2009/01

4587

A for-profit medical school
Mychaskiw, G., Wiltshire, W.
Academic Medicine, 2009/01
Free full text

4588

Performing Preclerkship Pelvic Examinations Improves Student Perceptions of Clerkship Preparedness
Lievens, A. M., May, L. E.
The Journal of the American Osteopathic Association, 2009/01

4589

Osteopathic Manipulative Medicine Efficacy on Pulmonary Function as Measured by Spirometry
Liu, T., Werley, J., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2009/01

4590

Salivary IgA Fluctuations in Response to Stress and Osteopathic Manipulative Treatment
Norton, J., Pilc, J., Saggio, G., Gilliar, W.
The Journal of the American Osteopathic Association, 2009/01




4594

Osteopathie bei Frühgeborenen
(Osteopathy with Premature Infants)
Lamberts, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01



4597

Muscle Impulse, A Muscle Energy Variant
van Buskirk, R. L.
The AAO Journal, 2008/12
Free full text

4598

Test-dependent osteopathic treatment of somatoform autonomic dysfunction of the cardiovascular system: A pre-post pilot trial
Zorgman, M., Sauerburger, S., Ruetz, M., Schwerla, F.
International Journal of Osteopathic Medicine, 2008/12

4599

Exploring the use of exercise therapy in UK osteopathic practice
Zamani, J., Vogel, S., Moore, A., Lucas, K.
International Journal of Osteopathic Medicine, 2008/12

4600

Service delivery characteristics of UK osteopaths – a cross sectional survey
Vogel, S., Herrick, R.
International Journal of Osteopathic Medicine, 2008/12

4601

Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with chronic rhino sinusitis (CRS)? A randomized controlled trial
Steinbauer, U., Roos, S., Amann, P., Schwerla, F., Resch, K.L.
International Journal of Osteopathic Medicine, 2008/12

4602

A randomised controlled trial on the effectiveness of osteopathic manipulative treatment of chronic low back pain
Mandara, A., Fusaro, A., Musicco, M., Bado, F.
International Journal of Osteopathic Medicine, 2008/12


4604

How do patients feel post-treatment? pilot study at a UK osteopathic teaching clinic of self-reported adverse events
Froud, R., Rajendran, D., Fossum, C., Collins, P., Mullinger, B.
International Journal of Osteopathic Medicine, 2008/12

4605

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12

4606

Multisensory integration in an osteopathic clinical examination setting
Esteves, J. E., Geake, J., Spence, C.
International Journal of Osteopathic Medicine, 2008/12

4607

Research underpins the evidence base for osteopathic medicine
Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12
Free full text

4608

Pilot clinical study of osteopathic manipulative treatment in pregnant patients with acute low back pain
Caragan, C., Tang, P.Y., Slack, M., Leiber, J. D., Koskinen, J., Zust, D., Cragun, T.
International Journal of Osteopathic Medicine, 2008/12

4609

Three pathways to a physician career: applicants to U.S. MD and DO schools and U.S. Citizen applicants to international medical schools
Jolly, P., Garrison, G., Boulet, J. R., Levitan, T., Cooper, R. A.
Academic Medicine, 2008/12


4611

Mathematical analysis of applied loads on skeletal muscles during manual therapy
Chaudhry, H., Bukiet, B., Findley, T.
The Journal of the American Osteopathic Association, 2008/12
Free full text

4612

Response: Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Fitzgerald, M.
The Journal of the American Osteopathic Association, 2008/12
Free full text

4613

Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Lanier, W. L.
The Journal of the American Osteopathic Association, 2008/12
Free full text





4618

La osteopatía como método científico
(Osteopathy as a scientific method)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2008/12

4619

COMLEX-USA and in-service examination scores: tools for evaluating medical knowledge among residents
Sevensma, S. C., Navarre, G., Richards, R. K.
The Journal of the American Osteopathic Association, 2008/12
Free full text


4621

Spinal and sacroiliac joint assessment and treatment within the American osteopathic profession
Fryer, G., Morse, C., Johnson, J. C.
International Journal of Osteopathic Medicine, 2008/12

4622

The introduction of a novel approach to the teaching and assessment of osteopathic manipulative medicine assessment skills
Fossum, C., Snider, E., Fryer, G., Gillette, N., Degenhardt, B.
International Journal of Osteopathic Medicine, 2008/12

4623

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12

4624

The hands of the osteopaths. Thinking fingers. Their special training
Hansak, S.
Unpublished MSc thesis, 2008/11
Free full text

4625

How often are thrust techniques used in practice
Pingitzer, T.
Unpublished MSc thesis, 2008/11
Free full text







4632



4634

Is Sacral Listening Applied in a Uniform Way?
Krapp, B.
Unpublished MSc thesis, 2008/11
Free full text

4635

Modern Reception of A.T.Still´s TRIUNE MAN in Germany
Kaiser, F.
Unpublished MSc thesis, 2008/11
Free full text


4637

Spastische Diparese
(Spastic paresis)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

4638

Diagnosis and management of piriformis syndrome: an osteopathic approach
Boyajian-O'Neill, L. A., McClain, R. L., Coleman, M. K., Thomas, P. P.
The Journal of the American Osteopathic Association, 2008/11
Free full text

4639

Functional gestational problems and osteopathy
Steinbauer, S.
Unpublished MSc thesis, 2008/11
Free full text

4640

Die drei Säulen der Y–Fuge der Säuglingshüfte
(The Three Pillars of the Hypsiloid Cartilage of the Hip of Infants)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

4641

Säuglinge sind Viszera
(Infants are Viscera)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

4642

Patient perception of osteopathic manipulative treatment in a hospitalized setting: a survey-based study
Pomykala, M., McElhinney, B., Beck, B. L., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2008/11
Free full text

4643

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques: a pilot crossover trial
Rivers, W. E., Treffer, K. D., Glaros, A. G., Williams, C. L.
The Journal of the American Osteopathic Association, 2008/11
Free full text




4647

Osteopathie bei chronischem Schmerz
(Osteopathy applied to chronic pain patients)
Deichmeier, A., von Fischern, F., Heinbücher, I.
Unpublished D.O. thesis, 2008/10











4658

Echinacea purpurea and osteopathic manipulative treatment in children with recurrent otitis media: a randomized controlled trial
Wahl, R. A., Aldous, M. B., Worden, K. A., Grant, K. L.
BMC Complementary and Alternative Medicine, 2008/10
Free full text

4659

Supporting and promoting osteopathic medicine through community-based family practice preceptorships: a survey-based study
Aguwa, M. I., Monson, C. L., Liechty, D. K., Fowler, L. V., Kost, M. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text

4660

Effectiveness of osteopathy in the cranial field and myofascial release versus acupuncture as complementary treatment for children with spastic cerebral palsy: a pilot study
Duncan, B., McDonough-Means, S., Worden, K., Schnyer, R., Andrews, J., Meaney, F. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text

4661

Legg reduction maneuver for patients with anterior shoulder dislocation
Dyck Jr., D. D., Porter, N. W., Dunbar, B. D.
The Journal of the American Osteopathic Association, 2008/10
Free full text


4663

Prevention, diagnosis, and management of osteoporosis-related fracture: a multifactoral osteopathic approach
Gronholz, M. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text

4664

The endocannabinoid system: an osteopathic perspective
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text



4667

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text

4668

Osteopathic Medicine and the Geriatric Patient
Hruby, R. J.
The AAO Journal, 2008/09
Free full text

4669

Valuing osteopathy: What are (our) professional values and how do we teach them?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09

4670

Whose values are we teaching? Deconstructing responsibilities and duties of teachers of osteopathy
Sommerfeld, P.
International Journal of Osteopathic Medicine, 2008/09

4671

Osteopathic support for a survivor of gastric cancer: A case report
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/09


4673

Aetiology of idiopathic scoliosis. Current biomedical research and osteopathic theories
Lüftinger, M.
Unpublished MSc thesis, 2008/09
Free full text

4674

The Meaning of Tensegrity Principles in Osteopathic Medicine
Pflüger, C.
Unpublished MSc thesis, 2008/09
Free full text


4676

Osteopathy with Enuresis
Kargl, D.
Unpublished MSc thesis, 2008/09
Free full text

4677


4678

Will the ‘real’ osteopathy please speak up?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/09
Free full text

4679

Commentary on ‘Is there a place for science in the definition of osteopathy’?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09

4680

Osteopathic Prevention Study in Achievement-orientaded Young Soccer Players
Angleitner, C.
Unpublished MSc thesis, 2008/09
Free full text

4681

Osteopathic certification evolving into a continuous certification model
Moskowitz, J. S.
The Journal of the American Osteopathic Association, 2008/09
Free full text


4683

Osteopathic manipulation: promise for infantile colic
Friedman, S. J.
The Journal of the American Osteopathic Association, 2008/09
Free full text

4684

Clinical and research protocol for osteopathic manipulative treatment of elderly patients with pneumonia
Noll, D. R., Degenhardt, B. F., Fossum, C., Hensel, K.
The Journal of the American Osteopathic Association, 2008/09
Free full text


4686

Effect of OMT in the Treatment of Initial Vascular Wall Alteration
Cerritelli, F., Carinci, F., Barlafante, G., Pizzolorusso, G., Turi, P., Cozzolino, V., Renzetti, C., Pizzolorusso, F., Orlando, F.
The Journal of the American Osteopathic Association, 2008/08

4687

Assessing Educational Impact of Osteopathic Pre-doctoral Teaching Fellows
Cross, B. M., Villanueva, R., Glover, J. C., Hiserote, R. M., Davis, G.
The Journal of the American Osteopathic Association, 2008/08

4688

The Value of Osteopathy in Anesthesiology: A Survey
Johansson, N. M., Yarmush, J., Guirguis, A., Apergis, M., Kalstein, A.
The Journal of the American Osteopathic Association, 2008/08

4689

The Use of Osteopathic Manipulation to Address Pulmonary Distress as Related to Asthma in Southwest Virginia
Latter, M. L.
The Journal of the American Osteopathic Association, 2008/08

4690

Efficacy of Manipulative Treatment for Acute Low Back Pain in Active Duty Military Personnel
Stoll, S. T., Maurer, D., Hensel, K., Cruser, D.
The Journal of the American Osteopathic Association, 2008/08

4691

Use of Ultrasonography in the Preclinical Education of Osteopathic Medical Students: A Pilot Study
Syperda, V. A., Trivedi, P. N., Melo, L. C., Freeman, M. L., Ledermann, E. J., Smith, T. M., Alben, J. O.
The Journal of the American Osteopathic Association, 2008/08

4692

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

4693

Einschneidende Rituale
(Drastic Rituals)
Knöppler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

4694


4695

Atopische Dermatitis: (osteopathische) Hand anlegen!
(Atopic dermatitis: (osteopathic) hands on!)
Oezbay, I., Reckwerth, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

4696

Osteopathic medicine and community health fairs: increasing public awareness while improving public health
Stamat, H. M., Injety, K. R., Liechty, D. K., Pohlod, C. A., Aguwa, M. I.
The Journal of the American Osteopathic Association, 2008/08
Free full text

4697

Evidence-based publications: balancing research mission and our community's needs
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2008/08
Free full text

4698

ED physicians beware when using OMT for patients with motor vehicle injuries
Fletcher, S. A.
The Journal of the American Osteopathic Association, 2008/08
Free full text


4700

Unterhautblutung
(Subcutaneous hemorrhage)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08


4702

Keeping the flames of OMM burning
Hogarty, D. C.
The Journal of the American Osteopathic Association, 2008/08
Free full text

4703

Osteopathic Manipulative Treatment for Postoperative Nausea and Vomiting
Schrick-Senasac, S. L., King, H. H.
The Journal of the American Osteopathic Association, 2008/08

4704

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text


4706

Eliminating bad, bad medicine: problems with P4P initiatives
McDonald, R.
The Journal of the American Osteopathic Association, 2008/08
Free full text




4710

Dangers of for-profit education: more than just words
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2008/08
Free full text


4712

Sistema estomatognático, osteopatía y postura
(The stomatognathic system, osteopathy and posture)
Oliva Pascual-Vaca, Á., Rodríguez Blanco, C.
Osteopatía Científica, 2008/08

4713

Election year's first shot over the bow: reforms needed
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2008/08
Free full text

4714

Increase efforts to promote primary care
Rapp, R. W.
The Journal of the American Osteopathic Association, 2008/08
Free full text

4715

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text

4716

Introducing osteopathic medical education in an allopathic residency
Rubeor, A., Nothnagle, M., Taylor, J. S.
The Journal of the American Osteopathic Association, 2008/08
Free full text

4717

Relationship of Osteopathic Manipulative Treatment During Labor and Delivery on Selected Maternal Morbidity Outcomes: A Randomized Controlled Trial
Keurentjes, A., Showalter, A., James, C., Vawter, A., Cross, B. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text



4720

Osteopathic treatment of patients with chronic non-specific neck pain: a randomised controlled trial of efficacy
Schwerla, F., Bischoff, A., Nurnberger, A., Genter, P., Guillaume, J.P., Resch, K.L.
Forschende Komplementärmedizin, 2008/07


4722

AOA is strong advocate for debt relief and primary care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2008/07
Free full text

4723

Inpatient osteopathic structural examinations: is “red tape“ getting in the way of personalized patient care?
Fennig Jr., G. A., Shubrook Jr., J. H.
The Journal of the American Osteopathic Association, 2008/07
Free full text

4724

Living in fast forward
Harper, D. L.
The Journal of the American Osteopathic Association, 2008/07
Free full text

4725

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text

4726

The osteopathic research center will remain key to osteopathic medical profession
Licciardone, J. C., King, H. H., Kearns, C. M.
The Journal of the American Osteopathic Association, 2008/07
Free full text

4727

Culture drives research funding
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2008/07
Free full text

4728

DOs need to define value of osteopathic medicine
Snow, R. J., Seffinger, M. A., McGill, S. L., Vincent, R. A.
The Journal of the American Osteopathic Association, 2008/07
Free full text

4729

Role of exercise therapy in osteopathic education, treatment and management
Zamani, J. M.
Unpublished PhD thesis, 2008/07
Free full text

4730


4731

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06

4732

An Osteopathic Approach to Visceral Disease: A Case of Recurrent Urinary Tract Infection
Lerma, C., Mesisca, M., Hruby, R. J.
The AAO Journal, 2008/06
Free full text

4733


4734

Due thanks, moving forward, and valuing the journey
Vogel, S.
International Journal of Osteopathic Medicine, 2008/06
Free full text

4735

Consistency of standing and seated posture of asymptomatic male adults over a one-week interval: A digital camera analysis of multiple landmarks
Pownall, P. J., Moran, R. W., Stewart, A. M.
International Journal of Osteopathic Medicine, 2008/06

4736

Educating osteopaths to be researchers - what role should research methods and statistics have in an undergraduate curriculum?
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2008/06
Free full text

4737

“Poiseuille’s Panacea”: a New Direction in Osteopathic Manipulation of the Thorax
McCombs, T. M., Towne, S., Treece, M.
The AAO Journal, 2008/06
Free full text


4739

Solitary fibrous pleural tumor
Jenkins, L. A., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2008/06
Free full text

4740

Saying what you mean and meaning what you say
Rogers, F. J.
The Journal of the American Osteopathic Association, 2008/06
Free full text

4741

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text

4742

AAO Convocation in Dallas, Texas
Beck, M.
Osteopathische Medizin, 2008/05



4745

Constraints to caring: service to medically indigent patients by allopathic and osteopathic physicians
Chirayath, H. T., Wentworth, A. L.
Journal of Health Care for the Poor and Underserved, 2008/05

4746

Excessive tuition does not equal excellent education
Andrews, C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text

4747

Modified Muncie technique: osteopathic manipulation for eustachian tube dysfunction and illustrative report of case
Channell, M. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text

4748

Immediate effects of osteopathic manipulative treatment in elderly patients with chronic obstructive pulmonary disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text

4749

Award-winning debt-management education
Goeppinger, K. H.
The Journal of the American Osteopathic Association, 2008/05
Free full text

4750

Mortgaging our future, foreclosing our profession
Kraus II., C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text

4751

Practice patterns of osteopathic physicians providing end-of-life care: a survey-based study
Mason, D. C., McElrath, S., Penn-Erskine, C., Kramer-Feeley, V., Pomerantz, S. C., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text

4752

Working to ease debt burdens
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/05
Free full text

4753

Osteopathische Diaphragmen und Wandlungsphasen
(Osteopathic diaphragms and transformation phases)
Wendling, D.
KIM - Komplementare und Integrative Medizin, Ärtztezeitschrift fur Naturheilverfahren, 2008/04

4754

The virtual haptic back: a simulation for training in palpatory diagnosis
Howell, J. N., Conatser, R. R., Williams II., R. L., Burns, J. M., Eland, D. C.
BMC Medical Education, 2008/04


4756

Expression of the endocannabinoid system in fibroblasts and myofascial tissues
McPartland, J. M.
Journal of Bodywork and Movement Therapies, 2008/04

4757

A randomized controlled trial of the effectiveness of osteopathy-based manual physical therapy in treating pediatric dysfunctional voiding
Nemett, D. R., Fivush, B. A., Mathews, R., Camirand, N., Eldridge, M. A., Finney, K., Gerson, A. C.
Journal of Pediatric Urology, 2008/04
Free full text

4758

Das komplexe regionale Schmerzsyndrom
(The complex regional pain syndrome)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04

4759

Karpaltunnelsyndrom
(Carpal tunnel syndrome)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04

4760

A.T. Still would not be proud
Fisher, C. M.
The Journal of the American Osteopathic Association, 2008/04
Free full text


4762

Spirituality and medicine: prevalence of spirituality-in-medicine instruction at osteopathic medical schools
McClain, E. K., McClain, R. L., Desai, G. J., Pyle, S. A.
The Journal of the American Osteopathic Association, 2008/04
Free full text

4763

Embrace evidence...with both eyes open
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/04
Free full text






4769

OSTEOPAThic Health outcomes in chronic low back pain: The OSTEOPATHIC Trial
Licciardone, J. C., King, H. H., Hensel, K. L., Williams, D. G.
Osteopathic Medicine and Primary Care, 2008/04

4770

Osteopathic manipulation & its use for low back pain
Wolf, C. J.
Missouri Medicine, 2008/03-04


4772

Migraine and OMT
Batchelor, K., Gamber, R.
The AAO Journal, 2008/03
Free full text

4773

Osteopathic Manipulative Treatment in Pregnancy and Augmentation of Labor: A Case Report
Jones, A. L., Lockwood, M. D.
The AAO Journal, 2008/03
Free full text

4774

Autistic Spectrum Disorder
Sorrell, M. A.
The AAO Journal, 2008/03
Free full text

4775

Towards an osteopathic understanding of evidence
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/03
Free full text




4779


4780

Osteopathic manipulative treatment (OMT) effects on mandibular kinetics: kinesiographic study
Monaco, A., Cozzolino, V., Cattaneo, R., Cutilli, T., Spadaro, A.
European Journal of Paediatric Dentistry, 2008/03
Free full text

4781

10 Years of research in the journal: What's next?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2008/03
Free full text

4782

Clinical inquiries. Is osteopathic manipulation effective for headaches?
Keays, A. C., Neher, J. O., Safranek, S., Webb, C. W.
The Journal of Family Practice, 2008/03

4783

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

4784

Pushing bodies through COMs
Lisowsky, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

4785

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03

4786

Osteopathic medical education in 2008: course corrections and new horizons
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/03
Free full text

4787

Medical education summits: building a solid foundation for the future of the osteopathic medical profession
Watson, D. K., Nichols, K. J.
The Journal of the American Osteopathic Association, 2008/03
Free full text


4789


4790

The Use of Visceral Techniques in the Osteopathic Practices in Austria
Stemeseder, H.
Unpublished MSc thesis, 2008/02
Free full text

4791

Die osteopathische Dysfunktion der Arterie
(Osteopathic Dysfunction of the Arteries)
Chauffour, P., Prat, E., Michaud, J.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02

4792

Touch – Perception – Communication In the Context of Osteopathic Treatment
Schuster, K.
Unpublished MSc thesis, 2008/02
Free full text

4793

Health economic evaluation - An option for osteopathy?
Perndl, M.
Unpublished MSc thesis, 2008/02
Free full text

4794

Effect of osteopathic treatment on premature infants with regulation problems
Rajchl, E.
Unpublished MSc thesis, 2008/02
Free full text

4795


4796

The Phenomenon Spondylolisthesis from an Osteopathic Point of View
Schiener, M.
Unpublished MSc thesis, 2008/02
Free full text


4798

Growing pains in children- can osteopathy improve the clinical picture?
Kramer, B.
Unpublished MSc thesis, 2008/02
Free full text

4799

The Integration of Clinical Reasoning in Osteopathy
Fink-Koller, B.
Unpublished MSc thesis, 2008/02
Free full text

4800

Arterienbehandlung bei Bluthochdruck
(Arterial treatment for hypertension)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02

4801

OMM education vs “real world“ medicine
Davidson, S. M.
The Journal of the American Osteopathic Association, 2008/02
Free full text


4803

Ignorance in high places
Ha, L.
The Journal of the American Osteopathic Association, 2008/02
Free full text


4805

Der Rhythmus des Blutflusses
(The Rhythm Of Perfusion)
Wyvekens, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02

4806

Revisiting Castlio and Ferris-Swift's experiments on direct splenic stimulation in patients with acute infectious disease
Noll, D. R., Johnson, J. C., Brooks, J. E.
The Journal of the American Osteopathic Association, 2008/02
Free full text

4807

Colleges of osteopathic McMedicine?
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2008/02
Free full text

4808

Debt control for young DOs
Wagner, E.
The Journal of the American Osteopathic Association, 2008/02
Free full text

4809

Doctors’ knowledge of osteopathy in the district of Bregenz
Seewald, S.
Unpublished MSc thesis, 2008/02
Free full text


4811

Slow-Thrust Technik
(Slow thrust technique)
Dräger, K.
Osteopathische Medizin, 2008/01

4812

Osteopathic manipulative medicine and the athlete
Gunnar Brolinson, P., McGinley, S. M., Kerger, S.
Current Sports Medicine Reports, 2008/01


4814

Palpatory diagnosis training on the virtual haptic back: performance improvement and user evaluations
Howell, J. N., Conatser, R. R., Williams, R. L., Burns, J. M., Eland, D. C.
The Journal of the American Osteopathic Association, 2008/01
Free full text

4815

Attitudes toward pay-for-performance initiatives among primary care osteopathic physicians in small group practices
Locke, R. G., Srinivasan, M.
The Journal of the American Osteopathic Association, 2008/01
Free full text


4817





4821

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text

4822

Who are our guests?
Sumesgutner, A.
Unpublished MSc thesis, 2007/12
Free full text

4823

OMT Homework
Clark, R. C.
The AAO Journal, 2007/12
Free full text


4825

Attitudes and Confidence Levels of Second-Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T. A., Fotopoulos, T. J., Best, M. A.
The AAO Journal, 2007/12
Free full text



4828

Self-reported health behaviors of osteopathic physicians
McNerney, J. P., Andes, S., Blackwell, D. L.
The Journal of the American Osteopathic Association, 2007/12
Free full text

4829

Osteopathic manipulative treatment for pandemic influenza: many questions, few answers
Sanderlin, B. W., Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2007/12
Free full text

4830

An investigation into the side of joint cavitation associated with cervical spine manipulation
Bolton, A., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/12

4831

Is there a place for science in the definition of osteopathy?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/12

4832

Using the concept of ideomotor therapy in the treatment of a patient with chronic neck pain: A single system research design
McCarthy, S., Rickards, L. D., Lucas, N. P.
International Journal of Osteopathic Medicine, 2007/12

4833


4834

Empathy as part of the perception process in osteopathy
Felder, R.
Unpublished MSc thesis, 2007/12
Free full text

4835

Relaxed Vision: A Clinical Study
Fitzinger, S.
Unpublished MSc thesis, 2007/12
Free full text

4836

Relationships between clinical rotation subscores, COMLEX-USA examination results, and school-based performance measures
Cope, M. K., Baker, H. H., Foster, R. W., Boisvert, C. S.
The Journal of the American Osteopathic Association, 2007/11
Free full text

4837

Applying osteopathic principles to formulate treatment for patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2007/11
Free full text

4838

Evolution of osteopathic graduate medical education: integration of osteopathic principles and practice in postdoctoral training
Lemley, W. W., Steele, K. M., Shires, W. E., McMahan, R. M.
The Journal of the American Osteopathic Association, 2007/11
Free full text

4839

Andrew Taylor Still (1828-1917): founder of osteopathic medicine
Tan, S. Y., Zia, J. K.
Singapore Medical Journal, 2007/11

4840

Using integrative therapies to treat women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2007/11
Free full text






4846




4849

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

4850

Behandlung eines Kindes mit Morbus Hirschsprung
(Treatment of a child with Hirschsprung's disease)
Helsmoortel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

4851

Masterkurs in Kirksville - ein Stimmungsbild
(Master course in Kirksville - an impression)
Kaiser, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10



4854

Spina bifida
Mückler, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10


4856

Nonprofit and for-profit COMs: investing in the future of osteopathic medicine
Ajluni, P. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text

4857

Lake Erie College of Osteopathic Medicine's preclinical problem-based learning pathway program: an alternative medical school curriculum design
Ferretti, S. M., Krueger, W. A., Gabel, L. L., Curry, J. J.
The Journal of the American Osteopathic Association, 2007/10
Free full text




4861

RVUCOM: striving to meet the needs of the osteopathic medical profession
Martin, R. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text


4863

Examining the Somatic Dysfunction: Lessons Learned in Practice
Danto, J. B., Danto, D. Z., Burns, A. T.
The AAO Journal, 2007/09
Free full text


4865


4866

Role of osteopathic manipulative treatment in altering pain biomarkers: a pilot study
Degenhardt, B. F., Darmani, N. A., Johnson, J. C., Towns, L. C., Rhodes, D. C., Trinh, C., McClanahan, B., DiMarzo, V.
The Journal of the American Osteopathic Association, 2007/09
Free full text

4867

Treatment of irritable bowel syndrome with osteopathy: results of a randomized controlled pilot study
Hundscheid, H. W., Pepels, M. J., Engels, L. G., Loffeld, R. J.
Journal of Gastroenterology and Hepatology, 2007/09
Free full text

4868

Three Shortcomings of Current Osteopathic Medical Education Curricula, a Student Perspective
Alvarez, R. A., Feitell, S., Jones, A. C., Landry, B. W., Mapley, A. C., Mason, C. R., Sarmiento, P. A., Schrick-Senasac, S. L.
Journal of Osteopathic Medicine, 2007/08

4869

Applicant Selection Criteria for Osteopathic Residency Programs
Ballam, G. O., Guillory, V. J.
Journal of Osteopathic Medicine, 2007/08

4870

Awareness of Health Disparities in Organ Donation among Osteopathic Medical Students
Burch, D. M., Gordon, A. R., Burnett, P. A.
The Journal of the American Osteopathic Association, 2007/08


4872

Attitudes towards Osteopathic Manipulation in Career Choices (ATOMICC)
Dunbar, B. D., Desai, G. J.
The Journal of the American Osteopathic Association, 2007/08

4873

Measuring pressures used by physicians and students for cervical diagnosis of segmental somatic dysfunction using the Iso-TOUCH® Palpation Monitor System
Jean, N. T., Kuchera, M. L., Schoenfeldt, B., Dombrowski, R. T., Vardy, T., Williams, L.
The Journal of the American Osteopathic Association, 2007/08

4874

Prolonged Effects of Maximal Effort Exercise (with Valsalva) and Osteopathic Manipulative Treatment in Women with Multiple Sclerosis
Kuchera, M. L., Vardy, T., Yates, H., Stouch, B., Johnson, J. C.
The Journal of the American Osteopathic Association, 2007/08

4875

A Pilot Clinical Trial of Osteopathic Manipulative Treatment During Third Trimester Pregnancy
Licciardone, J. C., Buchanan, S., Fulda, K., Hensel, K., King, H. H., Stoll, S. T.
The Journal of the American Osteopathic Association, 2007/08

4876

Teaching Palpatory Force to Osteopathic Medical Students
Marchioni, R. M., Badoolah, A. H., Caban-Martinez, A., Patterson, M. M.
The Journal of the American Osteopathic Association, 2007/08

4877

Foot Ankle Biomechanics: Effects of Manipulative Intervention on Plantar Fasciitis Subjects
Morton, A. L., McGrew, A., Burns, J. M., Karodogan, E., Conatser, R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2007/08

4878

Factors Contributing to Osteopathic Manipulation Usage at Army Family Medicine Residency Programs
Platz, K. E., Asplund, C. A.
The Journal of the American Osteopathic Association, 2007/08

4879

Treating the cause
Stimson, N.
British Dental Journal, 2007/08


4881

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

4882

SEE - Die SomatoEmotionale Entspannung nach Upledger
(SER - SomatoEmotional Release according to Upledger)
Landeweer, G. G., Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

4883

Orthopädie und Psyche nach Verkehrsunfall
(Orthopedics and psyche after traffic accident)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

4884

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

4885

Hope for larger study on otitis media
Galgano, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text

4886

Getting “beyond the barriers“ in reforming osteopathic medical education
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2007/07
Free full text

4887

Reported prevalence rates of somatic dysfunction raise an... Heel?
Kotoske, D. E.
The Journal of the American Osteopathic Association, 2007/07
Free full text

4888

Emphasizing research in osteopathic medical education
Martin, K. D.
The Journal of the American Osteopathic Association, 2007/07
Free full text

4889

COM Accreditation: the Flexner Report revisited
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2007/07
Free full text

4890

Study on recurrent otitis media: potential value vs actual value of OMT
Orenstein, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text

4891

Getting back to the country
Ortolon, K.
Texas Medicine, 2007/07

4892

Trichotillomania: a rare but serious disorder
Rodos, J. J.
The Journal of the American Osteopathic Association, 2007/07
Free full text

4893

Neuromusculoskeletal Causes of Back Pain in Competitive Figure Skaters
Goldman, S. I., Moyer, M.
The AAO Journal, 2007/06
Free full text

4894

Ehlers Danlos Syndrome: A Case Report
Kumar, A., Stoll, S. T., Hensel, K.
The AAO Journal, 2007/06
Free full text


4896

Is estimating USMLE performance useful?
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2007/06
Free full text

4897

An observational study of motion induced in the lumbar–pelvic complex during ‘harmonic’ technique: A preliminary investigation
Waugh, J. L., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/06

4898

Should your GP be an osteopath? Patients' views of an osteopathy clinic based in primary care
Westmoreland, J. L., Williams, N. H., Wilkinson, C., Wood, F., Westmoreland, A.
Complementary Therapies in Medicine, 2007/06
Free full text

4899

Researching osteopathy: Who is responsible?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/06

4900

The flawed cranial model
Maddick, A. F.
International Journal of Osteopathic Medicine, 2007/06

4901


4902

Optimising the psychological benefits of osteopathy
Williams, N. H.
International Journal of Osteopathic Medicine, 2007/06

4903

The effects of high-velocity, low-amplitude manipulation and muscle energy technique on suboccipital tenderness
Hamilton, L., Boswell, C., Fryer, G.
International Journal of Osteopathic Medicine, 2007/06



4906

Step forward to stop bird flu
Austin, D. L.
The Journal of the American Osteopathic Association, 2007/05
Free full text

4907

Repatriating DOs with MD-affiliated residencies
Forte, T. E.
The Journal of the American Osteopathic Association, 2007/05
Free full text

4908

Promoting an osteopathic medical research culture
Lee, R. P.
The Journal of the American Osteopathic Association, 2007/05
Free full text

4909

Competence levels in musculoskeletal medicine: a call to action
Ruane, J. J.
The Journal of the American Osteopathic Association, 2007/05
Free full text

4910

Irresistible indexes for somatic dysfunction
Sucher, B. M.
The Journal of the American Osteopathic Association, 2007/05
Free full text





4915

Epicondylitis humeri radialis
(Lateral epicondylitis)
Geldschläger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

4916

Tennisellbogen: Osteopathie statt Kortison!
(Tennis elbow: Osteopathy instead of cortisone!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04


4918

Der Ellbogen
(The elbow)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

4919

Treatment of Primary Raynaud`s Syndrome with Osteopathy
Kalcakosz-Takacs, T.
Unpublished MSc thesis, 2007/03
Free full text

4920

Infantile postural asymmetry and osteopathic treatment: A randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2007/03
Free full text

4921

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text

4922

Unexplained Subfertility and Osteopathic Treatment
Kapper, A.
Unpublished MSc thesis, 2007/03
Free full text


4924




4927

A Case Study on the Osteopathic Approach to Chronic Low Back Pain and Radiculopathy
Schmied, A.
Unpublished MSc thesis, 2007/03
Free full text

4928

The Influence of Osteopathic Treatment on Postpuncture Complaints
Stephanides, A.
Unpublished MSc thesis, 2007/03
Free full text



4931

The Effectiveness of Osteopathic Treatment in Perimenopause
Zanon, B.
Unpublished MSc thesis, 2007/03
Free full text


4933

Is Osteopathy research relevant? A challenge has been made
Lucas, N. P., Moran, R. W.
The AAO Journal, 2007/03
Free full text

4934

Management of Peptic Ulcer Disease Using Osteopathic Manipulation
Morris, H. D., Dickey, J. L.
The AAO Journal, 2007/03
Free full text

4935

Examination of Refraction in Myopia - An Osteopathic Treatment Approach
Bayer, C.
Unpublished MSc thesis, 2007/03
Free full text




4939

Does an osteopathic treatment influence the human voice?
Hempel, G.
Unpublished MSc thesis, 2007/03
Free full text

4940

The Influence of Osteopathy on ADHD
Hubmann, B.
Unpublished MSc thesis, 2007/03
Free full text


4942

Osteopathic medical education in 2007: plumbing the depths with the questions we ask
Shannon, S. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text

4943

Osteopathic treatment versus “relaxation“ for tension-type headache
Smitherman, T. A., Nicholson, R. A., Penzien, D. B.
Headache: The Journal of Head and Face Pain, 2007/03

4944

Practice patterns among osteopathic dermatologists in the United States
Yoo, J. Y., Lee, H., Kimball, A. B.
Journal of the American Academy of Dermatology, 2007/03

4945

Osteopathy in idiopathic sudden hearing loss
Staffa, U.
Unpublished MSc thesis, 2007/03
Free full text


4947

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03

4948

Beyond spinal manipulation
McClune, T.
International Journal of Osteopathic Medicine, 2007/03




4952

Osteopathic Treatment and Stress Incontinence, in Combination with Biofeedback
Brix, S.
Unpublished MSc thesis, 2007/03
Free full text





4957

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2007/02
Free full text

4958

Does Osteopathy Influence Diabetes Mellitus Type II?
Kiegerl, G.
Unpublished MSc thesis, 2007/01
Free full text

4959

A Questionnaire to evaluate the Professional Field of Osteopathy in Austria
Krönke, K.
Unpublished MSc thesis, 2007/01
Free full text

4960

Osteopathic Treatment During Transition of Perimenopause
Mückler, A.
Unpublished MSc thesis, 2007/01
Free full text

4961

Observation Cv4-technique - Hypertension Hypertension - Osteopathic Disfunctions
Schögler, M.
Unpublished MSc thesis, 2007/01
Free full text

4962

The heart - an expanded osteopathic approach
Wagner, G.
Unpublished MSc thesis, 2007/01
Free full text

4963

Osteopathy. Sensing and Philosophy
Weber, K.H.
Unpublished MSc thesis, 2007/01
Free full text


4965

Die Bewegungen der Viszera: Die Mobilität, Teil 2
(Visceral Movements: Mobility, Part 2)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01

4966

Mediastinum
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01




4970

Osteopathy and the Breech Presentation after 30 Weeks of Gestation
Georgiades, O.
Unpublished MSc thesis, 2007/01
Free full text

4971

Osteopathic degrees overseas
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2007/01
Free full text

4972

Along The Dura Mater in Patients with Multiple Sclerosis
Toth, A.
Unpublished MSc thesis, 2007/01
Free full text


4974

Teaching “doctoring“: a model curriculum for family medicine
Wilson, M. A., Blondefield, P. J.
The Journal of the American Osteopathic Association, 2007/01
Free full text



4977

Osteopathy and Tinnitus
Plamberger, M.
Unpublished MSc thesis, 2007
Free full text

4978

Approval of ACGME Training as an AOA-approved internship: history and review of current data
Bulger, J. B.
The Journal of the American Osteopathic Association, 2006/12
Free full text

4979

OMT for Post-mastectomy Lymphedema and Rib Pain: Case Report
Bradshaw, D., Snider, K.
The AAO Journal, 2006/12
Free full text

4980

The Use of OMT in Patients with Osteoarthritis: Case Report
Zaidi, T., Williams, S.
The AAO Journal, 2006/12
Free full text

4981

Do any treatments work for irritable bowel syndrome?
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/12




4985

Non-Operative Management of Spinal Stenosis
Greenman, P. E.
The AAO Journal, 2006/12
Free full text

4986

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text

4987

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11

4988

Interests in research electives among osteopathic medical students
Pheley, A. M., Lois, H., Strobl, J.
The Journal of the American Osteopathic Association, 2006/11
Free full text

4989

Teaching critical appraisal: a pilot randomized controlled outcomes trial in undergraduate osteopathic medical education
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/11
Free full text




4993

Nitric oxide and anandamide in OMT research
Stefano, G. B., Salamon, E. J.
The Journal of the American Osteopathic Association, 2006/10
Free full text



4996

Osteopathic reasoning for the treatment of low back pain
Rennie, P. R.
Manuelle Medizin, 2006/10


4998

Mechanisms of change: animal models in osteopathic medical research
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/10
Free full text




5002

Fußschmerzen bei einem Kleinkind
(Foot pain in a young child)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10



5005

Incidence of iatrogenesis associated with osteopathic manipulative treatment of pediatric patients
Hayes, N. M., Bezilla, T. A.
The Journal of the American Osteopathic Association, 2006/10
Free full text


5007

Larsen’s Syndrome - A Case Report
Burkett, D., Gamber, R. G.
The AAO Journal, 2006/09
Free full text


5009

A problem-based learning pathway for medical students: Improving the process through action research
Chegwidden, W. R.
Annals of the Academy of Medicine Singapore, 2006/09
Free full text

5010

One Heritage, Two Traditions; A Look to the Future
Steele, K. M.
The AAO Journal, 2006/09
Free full text

5011

Spinal manipulation in patients with disc herniation: A critical review of risk and benefit
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/09

5012

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text

5013

Infantile colic: A critical appraisal of the literature from an osteopathic perspective
Lim, K. W.
International Journal of Osteopathic Medicine, 2006/09

5014

Stretch reflex and Hoffmann reflex responses to osteopathic manipulative treatment in subjects with Achilles tendinitis
Howell, J. N., Cabell, K. S., Chila, A. G., Eland, D. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text

5015

Osteopathic medicine in transition: postmortem of the Osteopathic Medical Center of Texas
Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2006/09
Free full text

5016

Computer-assisted instruction: a survey on the attitudes of osteopathic medical students
Forman, L. J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text

5017



5019

Establishing a case for cause and effect
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text



5022

The Effects of OMT on Median Nerve Size and Function in Patients with Carpal Tunnel Syndrome
Feathers, T. A., Foley, W. M., Panzone, J., Lyons, J. B., Stewart, P. E., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/08


5024

Teaching Osteopathic Manipulative Treatment to Allopathic Family Medicine Residents: The Role of the Community Preceptor
Jorgensen, S., Quinlan, J., Soldo, T.
The Journal of the American Osteopathic Association, 2006/08

5025

Assessing the Effectiveness of OMT Provided by Undergraduate Teaching Fellows as Measured by a Visual Analog Pain Scale
Lerma, C. M., Render, R. M., Sarkaria, J. A., Homertgen, K. D., Hruby, R. J.
The Journal of the American Osteopathic Association, 2006/08

5026

AOA needs to reach out more
Tatum, W. O.
The Journal of the American Osteopathic Association, 2006/08
Free full text

5027

Improving Symptoms, Pain, Functioning, and Strength for Persons with Carpal Tunnel Syndrome
Meyer, P., Stoll, S. T., Cruser, D., White, H. D., Whitesell, R.
The Journal of the American Osteopathic Association, 2006/08

5028

Chronic Obstructive Pulmonary Disease (COPD): Immediate Effects of Osteopathic Manipulative Treatment on Exercise Tolerance and Dyspnea
Pickett, C., Stoll, S. T., Cruser, D., Cipher, D. J.
The Journal of the American Osteopathic Association, 2006/08

5029

AOA certifying boards are credible and capable
Reeves, R. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text

5030

Effectiveness of Osteopathic Manipulative Treatment for Parkinson Disease
Snider, T. C., La Croix, C., Nunnley, T., Colwell, S., Jones, L., Wilde, B., Lodge, K., Will, A., Shoup, D., Devine, W., Wechsler, N., Cooper, K., Baker, W. P.
The Journal of the American Osteopathic Association, 2006/08

5031

Osteopathic Manipulative Medicine for Carpal Tunnel Syndrome: Changes in Nerve Conduction
White, H. D., Stoll, S. T., Cruser, D., Whitesell, R., King, H. H.
The Journal of the American Osteopathic Association, 2006/08

5032

Blinding protocols, treatment credibility, and expectancy: methodologic issues in clinical trials of osteopathic manipulative treatment
Licciardone, J. C., Russo, D. P.
The Journal of the American Osteopathic Association, 2006/08
Free full text

5033

Funktionelle Technik
(Functional technique)
Johnston, W. L.
Osteopathische Medizin, 2006/08

5034

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08

5035

Funktionelle Technik in der Praxis
(Functional technique in practice)
Franke, H., Schmidt, S.
Osteopathische Medizin, 2006/08

5036

Changes in active mouth opening following a single treatment of latent myofascial trigger points in the masseter muscle involving post-isometric relaxation or strain/counterstrain
Blanco, C. R., de las Penas, C. F., Xumet, J. E., Algaba, C. P., Rabadan, M. F., de la Quintana, M. C.
Journal of Bodywork and Movement Therapies, 2006/07

5037

Worlds of Western medicine and Chinese medicine learning from each other
Wu, E.
The Journal of the American Osteopathic Association, 2006/07
Free full text

5038

“Circle turns round“ to “allopathic osteopathy“
Wisnioski, S. W.
The Journal of the American Osteopathic Association, 2006/07
Free full text

5039

Proof-of-concept learning: acrylic templates as empiric evidence
White, J. E.
The Journal of the American Osteopathic Association, 2006/07
Free full text

5040

Nervus vestibulocochlearis (VIII.)
(Vestibulocochlear nerve)
Toth, A. B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

5041

Future of osteopathic medicine depends on investing in graduate medical education
Tosca, M.
The Journal of the American Osteopathic Association, 2006/07
Free full text

5042

Tracing the decline of OMT in patient care
Richardson, M. E.
The Journal of the American Osteopathic Association, 2006/07
Free full text


5044



5046

Addressing substance abuse in medical school curricula
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2006/07
Free full text

5047

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

5048

Cochrane Library's summary of review on manipulative treatment misleading, cheats readers
Michaud, R. G.
The Journal of the American Osteopathic Association, 2006/07
Free full text

5049

OMT: evidence, research, and practice
McCombs, T. M.
The Journal of the American Osteopathic Association, 2006/07
Free full text

5050

The osteopathic approach in the treatment of asymmetric infant
Kollingbaum-Fabian, S.
Unpublished MSc thesis, 2006/07
Free full text

5051


5052

Suggestions and questions for osteopathic medical education
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2006/06
Free full text

5053

In a vacuum or in a s(l)ide show: OPP in osteopathic CME programming
Beaman, R. T.
The Journal of the American Osteopathic Association, 2006/06
Free full text

5054

Maintaining competence and leadership in manual medicine
Beal, M. C.
The Journal of the American Osteopathic Association, 2006/06
Free full text

5055

Sciatic Neuritis: A Research Study
Beal, M. C.
The AAO Journal, 2006/06
Free full text

5056

Competence levels in musculoskeletal medicine: comparison of osteopathic and allopathic medical graduates
Stockard, A. R., Allen, T. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text

5057

Crohn’s Disease: A Case Report including the most recent Theories and Treatment Principles
Mitchell, D., Dickey, J. L.
The AAO Journal, 2006/06
Free full text

5058

Sacroiliac Mechanics Revisited
Jordan, T. R.
The AAO Journal, 2006/06
Free full text

5059

Manipulation of Adhesive Capsulitis under Anesthesia
Hurrell, J., Speece, A. J., Williams, S. F.
The AAO Journal, 2006/06
Free full text

5060

Front-line osteopathic medicine
Hayes, D. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text

5061

Osteopathic manipulative treatment of a 27-year-old man after anterior cruciate ligament reconstruction
Gugel, M. R., Johnston, W. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text


5063

Osteopathic evaluation and manipulative treatment in reducing the morbidity of otitis media: a pilot study
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text

5064

Manipulative treatment for idiopathic impotence in a 24-year-old water polo player
Crow, W. T.
International Journal of Osteopathic Medicine, 2006/06

5065

Manual therapies
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/05

5066

Progressive idea for osteopathic medical education
Belsky, D. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text

5067

Relationships between scores on the COMLEX-USA Level 2-Performance Evaluation and selected school-based performance measures
Baker, H. H., Cope, M. K., Adelman, M. D., Schuler, S., Foster, R. W., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2006/05
Free full text

5068

Nonobstetric lacerations of the vagina
Sloin, M. M., Karimian, M., Ilbeigi, P.
The Journal of the American Osteopathic Association, 2006/05
Free full text

5069

Will the last DO turn off the lights?
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2006/05
Free full text

5070

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05


5072

Osteopathic manipulative treatment of a 26-year-old woman with Bell's palsy
Lancaster, D. G., Crow, W. T.
The Journal of the American Osteopathic Association, 2006/05
Free full text


5074

Osteopathic physicians and disaster relief
Kloss, B., Levy, M. J.
The Journal of the American Osteopathic Association, 2006/05
Free full text

5075


5076

A preliminary assessment of the impact of cranial osteopathy for the relief of infantile colic
Hayden, C., Mullinger, B.
Complementary Therapies in Clinical Practice, 2006/05
Free full text

5077

Survey on the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, J. R., Weidner, A. C.
The Journal of the American Osteopathic Association, 2006/05
Free full text

5078

Osteopathic manipulative treatment is for all DOs
Cummings, C. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text

5079

Continuity of thought and tradition in the discipline supported by ongoing AOA efforts
Crosby, J. B.
The Journal of the American Osteopathic Association, 2006/04
Free full text

5080

Let the beauty of the marketplace benefit healthcare
Bliss, G.
The Journal of the American Osteopathic Association, 2006/04
Free full text

5081


5082


5083

Alles Schrott?
(All scrap?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

5084

Whole person medicine: a definition articulated osteopathically
Rosen, M. E.
The Journal of the American Osteopathic Association, 2006/04
Free full text

5085

Altern und Osteopathie: Die Rolle von Beweisen
(Aging and Osteopathy: The Role of Evidence)
McGovern, R. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

5086

Polymyalgia rheumatica
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

5087

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

5088

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

5089

Credit where credit's due: forebears of the Osteopathic Research Center
Goldsmith, D. M.
The Journal of the American Osteopathic Association, 2006/04

5090

Recurring Limitations in OMT Research
Cardarelli, R.
The Journal of the American Osteopathic Association, 2006/03
Free full text

5091

Gross range of motion in the cervical spine: the effects of osteopathic muscle energy technique in asymptomatic subjects
Burns, D. K., Wells, M. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text

5092

Trunk and limb muscle activity during the application of a mobilisation type force to the vertebral column
Blaich, R., Ginn, K., Cathers, I., Lee, M.
International Journal of Osteopathic Medicine, 2006/03


5094

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain: A pilot study
Alvizatos, J., Lamaro, J., Fryer, G.
International Journal of Osteopathic Medicine, 2006/03


5096

Faith without works
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/03
Free full text

5097

Postmastectomy lymphedema: a call for osteopathic medical research
Ota, K. S.
The Journal of the American Osteopathic Association, 2006/03
Free full text

5098

Manipulation in the presence of cervical spinal cord compression: a case series
Murphy, D. R., Hurwitz, E. L., Gregory, A. A.
Journal of Manipulative and Physiological Therapeutics, 2006/03

5099

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text

5100

Patient perception of practitioner intention in osteopathy in the cranial field – A preliminary investigation
McFarlane, S., Standen, C., Roy, D.
International Journal of Osteopathic Medicine, 2006/03

5101

Intercostal rib release
McCarty, C. L.
The AAO Journal, 2006/03
Free full text



5104

Beyond OMT: time for a new chapter in osteopathic medicine?
Hansen, G. P.
The Journal of the American Osteopathic Association, 2006/03
Free full text

5105

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03

5106

Center or periphery? The future of osteopathic principles and practices
Gevitz, N.
The Journal of the American Osteopathic Association, 2006/03
Free full text

5107

Solving clinical problems osteopathically
Feeko, K. J.
The Journal of the American Osteopathic Association, 2006/03
Free full text

5108

The effect of different rates of application of a rib raising technique on cardiovascular and respiratory measures in asymptomatic individuals
Farthing, R., Gosling, C., Williams, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2006/03

5109

What If? Thomas L. Northup Lecture, 2005
Dowling, D. J.
The AAO Journal, 2006/03
Free full text

5110

In vitro biophysical strain model for understanding mechanisms of osteopathic manipulative treatment
Dodd, J. G., Good, M. M., Nguyen, T. L., Grigg, A. I., Batia, L. M., Standley, P. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text

5111

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text


5113

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text

5114

Osteopathic medical education in 2006: charting a course for the future
Shannon, S. C.
The Journal of the American Osteopathic Association, 2006/02
Free full text


5116

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text

5117

Matrix-Rhythmus-Therapie und osteopathischer Ansatz
(Matrix rhythm therapy and osteopathic approach)
Randoll, U. G., McCutcheon, R., Hennig, F. F.
Osteopathische Medizin, 2006/02

5118

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text

5119

(Osteopathic treatment of newborns with sucking dysfunction)
Mahdi, S.
Osteopathische Medizin, 2006/02
Free full text

5120

(Various approaches for the treatment of postpartal problems)
Ligner, B.
Osteopathische Medizin, 2006/02
Free full text

5121

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text




5125

Computer animation and improved student comprehension of basic science concepts
Thatcher, J. D.
The Journal of the American Osteopathic Association, 2006/01
Free full text

5126

Hüft-Operation und Demenz
(Hip surgery and dementia)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01

5127

Infantile postural asymmetry and osteopathic treatment: a randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2006/01
Free full text


5129

Plans for new conjoint certificate of added qualifications in hospice and palliative medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2006/01


5131

Die osteopathische Versorgung älterer Menschen
(Osteopathic treatment of the elderly)
McGovern, J. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01

5132

Navigation in neurologic localization: web site launch
Hoegerl, C.
The Journal of the American Osteopathic Association, 2006/01
Free full text


5134

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12

5135

Osteopathic manipulative treatment of somatic dysfunction among patients in the family practice clinic setting: a retrospective analysis
Licciardone, J. C., Nelson, K. E., Glonek, T., Sleszynski, S. L., Cruser, des Anges
The Journal of the American Osteopathic Association, 2005/12
Free full text


5137

Use of osteopathic manipulative treatment for iliotibial band friction syndrome
Pedowitz, R. N.
The Journal of the American Osteopathic Association, 2005/12
Free full text

5138


5139

Revisiting Castlio and Ferris-Swift's experiments testing the effects of splenic pump in normal individuals
Noll, D. R., Johnson, J. C.
International Journal of Osteopathic Medicine, 2005/12

5140

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text

5141

Osteopathic Care of Children: 2005 Scott Memorial Lecture
Steele, K. M.
The AAO Journal, 2005/12
Free full text


5143

To what should we attribute the effects of OMT?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/12


5145

The coming influenza pandemic: lessons from the past for the future
Patterson, M. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text

5146

Dynamic duo: Maine-Dartmouth Family Practice Residency program and University of New England College of Osteopathic Medicine
Perakis, C.
The Journal of the American Osteopathic Association, 2005/11
Free full text

5147

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text

5148

Osteopathic manipulative treatment out of a horse and buggy
Tessien, R. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text



5151

Manual techniques addressing the lymphatic system: origins and development
Chikly, B. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

5152

(The Effectiveness of Muscle Energy Technique (MET). A systematic review)
Bergold-Meier, S., Franke, H.
Unpublished D.O. thesis, 2005/10

5153

Systematic review of effects of manual therapy in infants with kinetic imbalance due to suboccipital strain (KISS) syndrome
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Journal of Manual and Manipulative Therapy, 2005/10

5154

Cost-effective osteopathic manipulative medicine: a literature review of cost-effectiveness analyses for osteopathic manipulative treatment
Gamber, R., Holland, S., Russo, D. P., Cruser d, A., Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2005/10
Free full text

5155

Surprised by surgery statistics
Kattner, K. A.
The Journal of the American Osteopathic Association, 2005/10
Free full text

5156

Increased lymphatic flow in the thoracic duct during manipulative intervention
Knott, E. M., Tune, J. D., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2005/10
Free full text




5160

Hemodynamic effects of osteopathic manipulative treatment immediately after coronary artery bypass graft surgery
Olivencia-Yurvati, A. H., Carnes, M. S., Clearfield, M. B., Stoll, S. T., McConathy, W. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text


5162

Missed opportunity for osteopathic medical education
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

5163

The “Big DO“
Werrell, B. H.
The Journal of the American Osteopathic Association, 2005/10
Free full text


5165

Jumping through hoops for osteopathic internships
Snyder, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

5166

Graduate medical education: accuracy of AOA's annual data-reporting mechanisms questioned
Cummings, M.
The Journal of the American Osteopathic Association, 2005/10
Free full text






5172

Andrew Taylor Still-Techniken
(Andrew Taylor Still techniques)
Bachand, P.
Osteopathische Medizin, 2005/10








5180

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10


5182

Bewegungsabhängige Schmerzen über dem Hüftgelenk
(Movement-dependent pain above the hip joint)
Profanter, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

5183

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

5184

Das Hüftgelenk
(The hip joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10


5186

Pelvic postural asymmetry revisited
Davidson, S. M., Juhl, J. H.
The Journal of the American Osteopathic Association, 2005/09
Free full text

5187

Headache pain
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2005/09
Free full text


5189

Management of neuropathic pain
Galluzzi, K. E.
The Journal of the American Osteopathic Association, 2005/09
Free full text

5190

Teacher, heal thyself
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/09

5191

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text

5192

Evidence base presented--and expanding--for investment in tobacco dependence curricula for osteopathic medical education
Montalto, N. J., Priester, T. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text

5193

Loyalty to the profession, not the AOA: evidence base necessary for member support of association policies
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text

5194

Attention applicants: please submit emotional intelligence scores
Sefcik, D. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text

5195

An osteopathic approach to treating women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2005/09
Free full text

5196

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text

5197

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text

5198

Lower Extremity Edema: A Case Report
DeLaughter, J. P., Gamber, R. G.
The AAO Journal, 2005/09
Free full text






5204

The short term effect of atlanto-axial high velocity low amplitude manipulation with cavitation on Edge Light Pupil Cycle Time
Gosling, C. M. R., Kinross, T., Gibbons, P., Holmes, M.
International Journal of Osteopathic Medicine, 2005/09

5205

The active knee extension test and Slump test in subjects with perceived hamstring tightness
Kuilart, K. E., Woollam, M., Barling, E., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09

5206

Osteopathy in the cranial field – moving towards evidence for causality and effectiveness
Moran, R. W.
International Journal of Osteopathic Medicine, 2005/09

5207

Osteopathic manipulative treatment for low back pain: a systematic review and meta-analysis of randomized controlled trials
Licciardone, J. C., Brimhall, A. K., King, L. N.
BMC Musculoskeletal Disorders, 2005/08
Free full text

5208

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text

5209

Medical students' perceptions of medical education research and their roles as participants
Forester, J. P., McWhorter, D. L.
Academic Medicine, 2005/08
Free full text

5210

A Pilot Clinical Trial of Osteopathic Manipulative Treatment in Pregnancy
Licciardone, J. C., Buchanan, S., Pim, K. H., Cruser, D., Stoll, S. T.
The Journal of the American Osteopathic Association, 2005/07

5211

Intraocular Pressure Correlated with Osteopathic Manipulative Treatment
Nye, Z. B., Nye, D. M., Multack, R. F., Glonek, T.
The Journal of the American Osteopathic Association, 2005/07

5212

The Impact of OMM on the Management of Tension Cephalgia
Patel, A. M., Desai, G. J.
The Journal of the American Osteopathic Association, 2005/07

5213



5215

CV4 technique as a tool to decrease psychological stress in osteopathic medical students
Shah, A., Donaldson, N., Campomanes, C., Barragan, H., Menini, T., Binkerd, J.
The Journal of the American Osteopathic Association, 2005/07

5216

Dreigliedrige Osteopathie
(Triune osteopathy)
Pöttner, M., Hartmann, C.
Osteopathische Medizin, 2005/07


5218

The Impact of Osteopathic Manipulative Treatment on Future Osteopathic Physicians
Williams, J., Howell, J. P.
The Journal of the American Osteopathic Association, 2005/07



5221

Störungen in der Entwicklung des kindlichen Kiefers
(Developmental Disorders of the Jaw in Children)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

5222

Osteopathie bei Kindern mit Asthma
(Osteopathy in children with asthma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

5223

Das Kiefergelenk
(The temporomandibular joint)
Terhorst, L., Sundermann, W.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

5224

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text

5225

Preoperative intravenous morphine sulfate with postoperative osteopathic manipulative treatment reduces patient analgesic use after total abdominal hysterectomy
Goldstein, F. J., Jeck, S., Nicholas, A. S., Berman, M. J., Lerario, M.
The Journal of the American Osteopathic Association, 2005/06
Free full text

5226

Cannabimimetic effects of osteopathic manipulative treatment
McPartland, J. M., Giuffrida, A., King, J., Skinner, E., Scotter, J., Musty, R. E.
The Journal of the American Osteopathic Association, 2005/06
Free full text

5227

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text

5228

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text


5230

Be Careful with this Kind of Case!
MacDonald, R. C.
The AAO Journal, 2005/06
Free full text

5231

Abreactions in Ligamentous Articular Strain
McMurrey, L., Williams, S. F.
The AAO Journal, 2005/06
Free full text

5232

Psychosocial factors in osteopathic practice: To what extent should they be assessed?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/06

5233

The UK BEAM trial – a review and discussion
Vogel, S., Dear, J., Evans, D. W.
International Journal of Osteopathic Medicine, 2005/06

5234

Dissection of the thoracic paraspinal region – implications for osteopathic palpatory diagnosis: A case study
Fryer, G., Johnson, J.
International Journal of Osteopathic Medicine, 2005/06

5235

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain: A pilot study
Fryer, G., Alvizatos, J., Lamaro, J.
International Journal of Osteopathic Medicine, 2005/06

5236

Promoting active engagement with osteopathic principles and practice in interns and residents
Cain, R. A.
The Journal of the American Osteopathic Association, 2005/05
Free full text

5237

IM ketorolac versus OMT: was agent at peak analgesic effect in JAOA study?
Coston, J. L., McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text

5238

Sources of bias in reviews of spinal manipulation for back pain
Canter, P. H., Ernst, E.
Wiener Klinische Wochenschrift, 2005/05

5239

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text

5240

Taking osteopathic distinctiveness seriously: historical and philosophical perspectives
Osborn, G. G.
The Journal of the American Osteopathic Association, 2005/05
Free full text

5241

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text






5247

Osteopathische Therapie bei Glaukom
(Osteopathic Therapy of Glaucoma)
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04

5248

Nystagmus
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04


5250


5251

Osteopathie gegen Schielen
(Osteopathy for strabismus)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04

5252


5253

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text

5254

Kudos on electronic-only COMLEX-USA
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text

5255

Faith versus evidence: the real question in osteopathic medicine?
Juhl, J. H., Ostrow, G. L.
The Journal of the American Osteopathic Association, 2005/03

5256

Pain management in end-of-life care
Leleszi, J. P., Lewandowski, J. G.
The Journal of the American Osteopathic Association, 2005/03
Free full text

5257

Same as it ever was
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2005/03
Free full text

5258

Still keeping the faith
Rubinstein, L.
The Journal of the American Osteopathic Association, 2005/03
Free full text

5259

“Hardship exception“ is necessary
Zawadzki, E.
The Journal of the American Osteopathic Association, 2005/03

5260

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament: part 2. Effect of sex differences and manipulative “priming“
Sucher, B. M., Hinrichs, R. N., Welcher, R. L., Quiroz, L. D., St Laurent, B. F., Morrison, B. J.
The Journal of the American Osteopathic Association, 2005/03
Free full text

5261

Osteopathic medical training revisited: developing tomorrow's physicians
Innes, K.
The Journal of the American Osteopathic Association, 2005/03
Free full text

5262

The Case of a Patient with Persistent Urinary Urgency
Clark, R. C.
The AAO Journal, 2005/03
Free full text

5263

Survey of osteopathic and allopathic residents' attitudes toward osteopathic manipulative treatment
Allee, B. A., Pollak, M. H., Malnar, K. F.
The Journal of the American Osteopathic Association, 2005/03
Free full text

5264

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03

5265

Where Do We Go From Here? 2004 Thomas L. Northup Lecture
Glover, J. C.
The AAO Journal, 2005/03
Free full text




5269


5270



5272

The effect of osteopathy in the treatment of chronic low back pain – a feasibility study
Kirk, L., Underwood, M., Chappell, L., Martins-Mendez, M., Thomas, P.
International Journal of Osteopathic Medicine, 2005/03

5273

Attitudes towards prescribing rights: a qualitative focus group study with UK osteopaths
Grundy, M., Vogel, S.
International Journal of Osteopathic Medicine, 2005/03

5274

Welcome to IJOM
Moore, A. P.
International Journal of Osteopathic Medicine, 2005/03

5275

IJOM: An international journal for an international readership
Moran, R. W., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/03

5276

An account of the development of the conceptual basis of osteopathy course at the British School of Osteopathy
Nash, K., Tyreman, S.
International Journal of Osteopathic Medicine, 2005/03

5277

Intramuscular ketorolac versus osteopathic manipulative treatment in the management of acute neck pain in the emergency department: a randomized clinical trial
McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/02
Free full text

5278

Chairman of COPT concludes debate on “hardship exception“
Opipari, M. I.
The Journal of the American Osteopathic Association, 2005/02
Free full text

5279

Hysteresis as a measure of ankle dysfunction
Cohen, A. M., Mertz, J., Stewart, P., Warner, M. J., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/01
Free full text

5280

The effect of manual therapy and a home exercise program on cervicogenic headaches: A case report
Hanten, W. P., Olson, S. L., Lindsay, W. A., Lounsberry, K. A., Stewart, J. K.
Journal of Manual and Manipulative Therapy, 2005/01

5281

The biodynamic model of osteopathy in the cranial field
McPartland, J. M., Skinner, E.
Explore (NY), 2005/01

5282

Chronic low back pain: osteopaths' attitudes and management
Griffiths, L.
Unpublished MSc thesis, 2005/01
Free full text

5283

Rebuttal regarding the “hardship exception“
Steier, K. J.
The Journal of the American Osteopathic Association, 2005/01


5285

The effect of mobilisation on pressure pain thresholds in the lumbar spine
Medle, M.
Unpublished MSc thesis, 2005/01
Free full text

5286

Die Wirbelsäule
(The Spine)
Fuhrmann, M., Kühn, J.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01


5288

Osteopathie und Chiropraktik
(Osteopathy and chiropractic)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

5289



5291

Effects of osteopathic manipulative treatment on pediatric patients with asthma: a randomized controlled trial
Guiney, P. A., Chou, R., Vianna, A., Lovenheim, J.
The Journal of the American Osteopathic Association, 2005/01
Free full text

5292

Spondylodiszitis
(Spondylodiscitis)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01


5294

Don’t Raise Your Hand – Put it on the Patient
Dowling, D. J.
The AAO Journal, 2004/12
Free full text


5296

Case Study: An Osteopathic Resolution of a Neurocardiogenic Syncope
Somoano, Y., Hagopian, S.
The AAO Journal, 2004/12
Free full text

5297

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text

5298

Cost-utility analysis of osteopathy in primary care: results from a pragmatic randomized controlled trial
Williams, N. H., Edwards, R. T., Linck, P., Muntz, R., Hibbs, R., Wilkinson, C., Russell, I., Russell, D., Hounsome, B.
Family Practice, 2004/12
Free full text




5302

Gibt es eine kranielle Osteopathie?
(Is there such a thing as cranial osteopathy?)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11


5304

Osteopathie in der kraniellen Sphäre
(Osteopathy in the cranial sphere)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11

5305

Geburtstraumatisch bedingtes Zephalhämatom
(Birth trauma-related cephalohematoma)
Fuhrmann, M., Münster, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11

5306

Osteopathic medical training: developing the seasoned osteopathic physician
Clark, R. C.
The Journal of the American Osteopathic Association, 2004/11

5307

Osteopathischer Dachverband endlich gegründet
(Osteopathic umbrella organization finally founded)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2004/11

5308

The unique role of osteopathic physicians in treating patients with low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/11
Free full text


5310

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text

5311

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text


5313

The relation between thoracic paraspinal tissues and pressure sensitivity measured by a digital algometer
Fryer, G., Gibbons, P., Morris, T.
Journal of Osteopathic Medicine, 2004/10






5319

The elephant in the room: does OMT have proved benefit?
Bledsoe, B. E.
The Journal of the American Osteopathic Association, 2004/10
Free full text

5320

More about the use of OMT during influenza epidemics
Magoun, H. I.
The Journal of the American Osteopathic Association, 2004/10
Free full text

5321

DO outlines steps to malpractice reform
Michaud, R. G.
The Journal of the American Osteopathic Association, 2004/10
Free full text


5323

Effectiveness and efficiency of a primary care based osteopathy clinic for spinal pain
Williams, N. H.
Unpublished PhD thesis, 2004/10
Free full text

5324


5325

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09

5326

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09


5328

Influenza epidemic or pandemic? Time to roll up sleeves, vaccinate patients, and hone osteopathic manipulative skills
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/09
Free full text

5329

DO notes difference between residency programs
Hornbeck, K. L.
The Journal of the American Osteopathic Association, 2004/09
Free full text

5330

Chronic Fatigue Syndrome: The Misunderstood Disease
Gregg, T., Williams, S. F.
The AAO Journal, 2004/09
Free full text

5331


5332

Lymphatic Manipulative Pump Research: A Brief Review of Literature
McMillan, S., Crow, W. T., Greene, C. H.
The AAO Journal, 2004/09
Free full text

5333

Cranial Manipulation Induces Sequential Changes in Blood Flow Velocity on Demand
Nelson, K. E., Sergueef, N., Glonek, T.
The AAO Journal, 2004/09
Free full text

5334

Chronic Pelvic Pain Syndrome
Rossi, P. J., Dickey, J. L.
The AAO Journal, 2004/09
Free full text

5335

A review of King HH and Lay EM, “Osteopathy in the Cranial Field,“ in Foundations for Osteopathic Medicine, 2nd ed
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2004/09


5337

Investigating the Effect of OMT on Circulatory Biochemical Markers
Degenhardt, B. F., Darmani, N., Towns, L., Rhodes, D. C. J., Trinh, C., Johnson, J. C.
The Journal of the American Osteopathic Association, 2004/08

5338


5339

Kurzinterview: Silvio Castagna
(A short interview with Silvio Castagna)
Schmidt, S., Castagna, S.
Osteopathische Medizin, 2004/08


5341




5344

Effects of Osteopathic Manipulative Treatment on Symptom Severity and Functional Status in Carpal Tunnel Syndrome
Meyer, P. M., Stoll, S. T., Cruser, D., White, H. D., Whitesell, R., Angel, L.
The Journal of the American Osteopathic Association, 2004/08


5346

Interview: Jane Stark
(An interview with Jane Stark)
Stark, J.
Osteopathische Medizin, 2004/08


5348

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text

5349

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text

5350

Tobacco dependence curricula in undergraduate osteopathic medical education
Montalto, N. J., Ferry, L. H., Stanhiser, T.
The Journal of the American Osteopathic Association, 2004/08
Free full text

5351

Ultra Marathon Performance Improves Following OMT
Weibel, J., Lovy, A., Nelson, K. E., Kappler, R., Glonek, T.
The Journal of the American Osteopathic Association, 2004/08

5352

Conclusion of frequently used unsupported by data
Smith, R. M.
The Journal of the American Osteopathic Association, 2004/08
Free full text

5353

In opposition to Resolution 42
Steier, K. J.
The Journal of the American Osteopathic Association, 2004/08
Free full text

5354

Physiologic and Anatomic Changes in Carpal Tunnel Syndrome: Is Osteopathic Manipulative Treatment an Effective Non-surgical Alternative Therapy?
White, H. D., Stoll, S. T., Cruser, D., Meyer, P. M., Whitesell, R.
The Journal of the American Osteopathic Association, 2004/08


5356

Interview: Marina Fuhrmann, VOD e.V.
(An interview with Marina Fuhrmann, VOD e.V.)
Schmidt, S., Fuhrmann, M.
Osteopathische Medizin, 2004/08

5357

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07

5358

The effect of osteopathic manipulative treatment on immune response to the influenza vaccine in nursing homes residents: a pilot study
Noll, D. R., Degenhardt, B. F., Stuart, M. K., Werden, S., McGovern, R. J., Johnson, J. C.
Alternative Therapies In Health And Medicine, 2004/07

5359

Osteopathy in Idiopathic Parkinson Syndrome
Pelzl, R.
Unpublished MSc thesis, 2004/07
Free full text


5361

Yes, Dr Still, an MD won the 2004 Northup Writing Award!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/07
Free full text

5362

Fasziales Thoraxkompressionstrauma
(Fascial thoracic compression trauma)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07


5364

Osteopathie im Bereich des Brustkorbs
(Osteopathy in the thoracic region)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07


5366

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text

5367

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text

5368

Evaluating the rationale of the osteopathic internship
Smith, A. B.
The Journal of the American Osteopathic Association, 2004/06
Free full text

5369

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text




5373

Pseudokrupp
(Pseudo Croup)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05


5375

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

5376

Assessing the ability of medical students to perform osteopathic manipulative treatment techniques
Boulet, J. R., Gimpel, J. R., Dowling, D. J., Finley, M.
The Journal of the American Osteopathic Association, 2004/05
Free full text

5377

A randomized controlled trial of osteopathic manipulative treatment following knee or hip arthroplasty
Licciardone, J. C., Stoll, S. T., Cardarelli, K. M., Gamber, R. G., Swift, J. N., Jr., Winn
The Journal of the American Osteopathic Association, 2004/05
Free full text

5378


5379

Dreimonatskolik: Osteopathie klinisch klar überlegen
(Colic children: Osteopathy markedly superior)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05


5381

Osteopathie auf der Intensivstation
(Osteopathy in the intensive care unit)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
Free full text

5382

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text



5385

The effect of manipulation and mobilisation on pressure pain thresholds in the thoracic spine
Fryer, G., Carub, J., McIver, S.
Journal of Osteopathic Medicine, 2004/04

5386

DO relates positive experience with use of integrated neuromusculoskeletal release
Connolly, T. P.
The Journal of the American Osteopathic Association, 2004/04
Free full text

5387

A divisional approach to enhancing research among osteopathic family practice residents
Smith-Barbaro, P., Fulda, K. G., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2004/04
Free full text

5388

Musculoskeletal disorders: does the osteopathic medical profession demonstrate its unique and distinctive characteristics?
Sun, C., Desai, G. J., Pucci, D. S., Jew, S.
The Journal of the American Osteopathic Association, 2004/04
Free full text


5390

A presentation of stiff and painful shoulder — a case based commentary
Chemeris, A. I., Clive, B., Lathey, D., Niel-Asher, C. S.
Journal of Osteopathic Medicine, 2004/04

5391

Osteopathic emergency medicine
Anderson, G. V.
Annals of Emergency Medicine, 2004/03
Free full text

5392

Energy medicine: an osteopath's personal view
Handoll, N.
The Journal of Alternative and Complementary Medicine, 2004/03

5393

Effectiveness of a sham protocol and adverse effects in a clinical trial of osteopathic manipulative treatment in nursing home patients
Noll, D. R., Degenhardt, B. F., Stuart, M., McGovern, R., Matteson, M.
The Journal of the American Osteopathic Association, 2004/03
Free full text

5394

Status of complementary and alternative medicine in the osteopathic medical school curriculum
Saxon, D. W., Tunnicliff, G., Brokaw, J. J., Raess, B. U.
The Journal of the American Osteopathic Association, 2004/03
Free full text

5395

Interdisciplinary approach to teaching medication adherence to pharmacy and osteopathic medical students
Singla, D. L., MacKinnon, G. E., MacKinnon, K. J., Younis,W., Field, B.
The Journal of the American Osteopathic Association, 2004/03
Free full text

5396

Cystic Fibrosis: A Case History
Back, H. D., Gamber, R. G.
The AAO Journal, 2004/03
Free full text

5397

The Neuroendocrine-Immune Complex Illustrated in the Work of Dr. Frank Chapman
Capobianco, J. D.
The AAO Journal, 2004/03
Free full text

5398

A Case of Right First Rib Somatic Dysfunction Diagnosed and Treated
Lipton, J. A., Neil, M., Drew, B., McCarty, C.
The AAO Journal, 2004/03
Free full text

5399

Akuter Lumbago - ein funktioneller Ansatz
(Acute lumbago: a functional approach)
Debroux, J.J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02

5400

Sturzgeburt und fasziales System
(Precipitate labor and fascial system)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02



5403

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text

5404

Strength in collaboration
Quinn, A.
The Journal of the American Osteopathic Association, 2004/02
Free full text

5405



5407

Outpatient osteopathic single organ system musculoskeletal exam form: training and certification
Sleszynski, S. L., Glonek, T., Kuchera, W. A.
The Journal of the American Osteopathic Association, 2004/02
Free full text

5408

Let's learn from the influenza epidemic
Richardson, M. E.
The Journal of the American Osteopathic Association, 2004/02
Free full text

5409

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text

5410

Efficacy of manipulation in low back pain treatment: The validity of meta-analysis conclusions
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Journal of Bodywork and Movement Therapies, 2004/01

5411

Osteopathic treatment for the symtomatic relief of meniere's disease
Adamek, K.
Unpublished MSc thesis, 2004/01
Free full text

5412

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain
Alivizatos, J.
Unpublished MSc thesis, 2004/01
Free full text

5413

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text

5414





5418

Bridging the gap between medical education and application of OPP/OMT
Crosby, J. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text

5419



5421

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text


5423

Inter-examiner and intra-examiner reliability of the seated flexion test
O'Keefe, P.
Unpublished MSc thesis, 2004/01
Free full text

5424

Osteopathic emergency physician training and use of osteopathic manipulative treatment
Ray, A. M., Cohen, J. E., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text

5425

Osteopathic treatment to patients with primary dysmenorrhea
Pirritano, R.
Unpublished MSc thesis, 2004/01
Free full text

5426

The effect of osteopathic treatment on the irritable bowel syndrome: a case series
Stasiuk, D.
Unpublished MSc thesis, 2004/01
Free full text

5427

Effects of osteopathic treatment on people with psoriatic arthritis: a pilot study
Wall, R., Ryan, E., Kiatos, J.
Unpublished MSc thesis, 2004/01
Free full text


5429

Randomized osteopathic manipulation study (ROMANS): pragmatic trial for spinal pain in primary care
Williams, N. H., Wilkinson, C., Russell, I., Edwards, R. T., Hibbs, R., Linck, P., Muntz, R.
Family Practice, 2003/12
Free full text


5431

Bedside cardiology skills training for the osteopathic internist using simulation technology
Issenberg, S. B., Gordon, M. S., Greber, A. A.
The Journal of the American Osteopathic Association, 2003/12
Free full text

5432

Osteopathic manipulative treatment in prenatal care: a retrospective case control design study
King, H. H., Tettambel, M. A., Lockwood, M. D., Johnson, K. H., Arsenault, D. A., Quist, R.
The Journal of the American Osteopathic Association, 2003/12
Free full text

5433

Support needed for clinical faculty in osteopathic emergency medicine residencies
Minor, S. K., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2003/12
Free full text

5434

Neuromusculoskeletal Medicine/ OMM: Useful to ALL DOs
van Buskirk, R. L.
The AAO Journal, 2003/12
Free full text


5436

Relations between academic performance by medical students and COMLEX-USA Level 2: a multisite analysis
Evans, P., Goodson, L. B., Schoffman, S. I., Baker, H. H.
The Journal of the American Osteopathic Association, 2003/11
Free full text

5437

Correlation between prior exercise and present health and fitness status of entering medical students
Peterson, D. F., Degenhardt, B. F., Smith, C. M.
The Journal of the American Osteopathic Association, 2003/11
Free full text

5438

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11

5439

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text


5441

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text


5443

The effect of muscle energy technique on hamstring extensibility: the mechanism of altered flexibility
Ballantyne, F., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/10

5444

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10

5445

Intervertebral dysfunction: a discussion of the manipulable spinal lesion
Fryer, G.
Journal of Osteopathic Medicine, 2003/10

5446

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10

5447

A prospective study of osteopathic medical students' attitudes toward use of osteopathic manipulative treatment in caring for patients
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2003/10
Free full text

5448

Characteristics of the courses that best predict COMLEX-USA level 1 performance
Sefcik, D. J., Prozialeck, W. C., O'Hare, T. H.
The Journal of the American Osteopathic Association, 2003/10
Free full text

5449

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., Brown, S. A., Burchett, A, W.
The Journal of the American Osteopathic Association, 2003/10
Free full text








5457

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

5458

Osteopathie in der Schwangerschaft
(Osteopathy during pregnancy)
Gillemot, B.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

5459



5461

Osteopathie bei Zwillingsschwangerschaft
(Osteopathy in twin pregnancy)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10



5464

Muscle energy technique in patients with acute low back pain: a pilot clinical trial
Wilson, E., Payton, O., Donegan-Shoaf, L., Dec, K.
Journal of Orthopaedic & Sports Physical Therapy, 2003/09

5465

Osteopathic manipulative treatment in the emergency department for patients with acute ankle injuries
Eisenhart, A. W., Gaeta, T. J., Yens, D. P.
The Journal of the American Osteopathic Association, 2003/09
Free full text

5466

Principles from evolutionary biology and psychology will further strengthen tenets and profession
Pohlod, C. A.
The Journal of the American Osteopathic Association, 2003/09
Free full text

5467

Productivity outcomes for recent grants and fellowships awarded by the American Osteopathic Association Bureau of Research
Rose, R. C., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2003/09
Free full text

5468

Development of the Attitudes Toward Osteopathic Principles and Practice Scale (ATOPPS): preliminary results
Russo, D. P., Stoll, S. T., Shores, J. H.
The Journal of the American Osteopathic Association, 2003/09
Free full text


5470

Letters to the editor
Ehrenfeuchter, W. C., Kellam, R. T.
The AAO Journal, 2003/09
Free full text


5472

Dynamic Strain-Vector Release: An Energetic Approach to OMT
Hendryx, J. T., O'Brien, R. L.
The AAO Journal, 2003/09
Free full text

5473


5474

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text

5475

The use of osteopathic manipulative treatment as adjuvant therapy in children with recurrent acute otitis media
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F.
Archives of Pediatrics & Adolescent Medicine, 2003/09
Free full text

5476

Osteopathic manipulation to prevent otitis media--does it work?
Pichichero, M. E.
Archives of Pediatrics & Adolescent Medicine, 2003/09

5477

Osteopathic and Allopathic Family Practice Residents' Attitudes Toward OMT/OPP
Allee, B. A., Pollak, M. H., Malnar, K. F., Elfrink, L. D., Mulkey, L. E.
Journal of Osteopathic Medicine, 2003/08

5478

Patient-reported Outcomes of Osteopathic Manipulative Treatment, The Development of a Research Tool
Caldwell, C. T., Degenhardt, B. F., Johnson, J. C., Hoberman, C. J.
The Journal of the American Osteopathic Association, 2003/08

5479

Determining the Impact of Osteopathic Manipulative Therapy in the Management of Irritable Bowel Syndrome
Chiesa, J. C., Pomerantz, S. C., Shinkle, J. W., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08

5480

Study raises important issues about the potential benefit of osteopathy in the cranial field to patients with Parkinson's disease
Boehm, K. M., Lawner, B. J., McFee, R. B.
The Journal of the American Osteopathic Association, 2003/08
Free full text

5481

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text


5483

Benefits of Osteopathic Manipulative Treatment After Abdominal Hysterectomy: A Retrospective Cohort Study
Ludwig, K., Hortos, K., Gupte, C.
The Journal of the American Osteopathic Association, 2003/08

5484

Osteopathic Manipulative Therapy (OMT) as a Non-pharmacological Treatment for Stable Patients with Emphysema and Chronic Bronchitis
Morley, T. F., Shinkle, J. W., Pomerantz, S. C., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08

5485

Hemodynamic Effects of Osteopathic Manipulative Treatment (OMT) Immediately Following Coronary Artery Bypass Graft (CABG) Surgery
O-Yurvati, A. H., Carnes, M., Clearfield, M., Stoll, S. T., McConathy, W.
The Journal of the American Osteopathic Association, 2003/08

5486

Determination of Pressures Used in Osteopathic Manipulative Treatments
Patterson, M. M., Shamus, E., Carter, K.
The Journal of the American Osteopathic Association, 2003/08

5487

Osteopathic Manipulative Treatment and Congestive Heart Failure
Scheunemen, G. M., Mnabhi, A. K. S., Papp, M. A., Nelson, K. E., Glonek, T.
The Journal of the American Osteopathic Association, 2003/08

5488

Lumbar Rotation Range of Motion with Lumbar Osteopathic Manipulative Treatment
Shamus, E., Patterson, M. M., Carter, K.
The Journal of the American Osteopathic Association, 2003/08

5489

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text

5490

Osteopathic manipulative medicine in the treatment of hypertension: An alternative, conventional approach
Spiegel, A. J., Capobianco, J. D., Kruger, A., Spinner, W. D.
Heart Disease, 2003/07

5491

Do osteopathic physicians differ in patient interaction from allopathic physicians? An empirically derived approach
Carey, T. S., Motyka, T. M., Garrett, J. M., Keller, R. B.
The Journal of the American Osteopathic Association, 2003/07
Free full text

5492

Predictive validity of osteopathic medical licensing examinations for osteopathic medical knowledge measured by graduate written examinations
Cavalieri, T. A., Shen, L., Slick, G. L.
The Journal of the American Osteopathic Association, 2003/07
Free full text

5493

Osteopathic manipulative treatment for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Stoll, S. T., Fulda, K. G., Russo, D. P., Siu, J., Winn, W., Swift, J.
Spine (Phila Pa 1976), 2003/07

5494

Osteopathic graduate medical education opportunities abound in south Florida
Pinto, M. G.
The Journal of the American Osteopathic Association, 2003/07
Free full text


5496

Zum primären Verletzungsmechanismus bei Beschleunigungsverletzungen
(Whiplash injury: What you should know)
Keller, M., Bischoff, A., Schwerla, B. S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

5497

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

5498

Nackenschmerzen: Hand anlegen überlegen!
(Neck pain: manual therapy scores best)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07



5501

Osteopathic physicians provide quality care--with or without OMT
Crow, R. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text

5502

Emergency medicine resident work productivity and procedural accomplishment
Deveau, J. P., Lorenz, J. E., Hughes, M. J.
The Journal of the American Osteopathic Association, 2003/06
Free full text

5503

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text


5505

OMT's effectiveness already proven
Tessien, R. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text

5506



5508

From the Archives: A Manual of Cranial Technique
Lippincott, R. C., Lippincott, H. A.
The AAO Journal, 2003/06
Free full text

5509

OMT Relieves Jaw Pain
Pasquarello, G.
The AAO Journal, 2003/06
Free full text


5511

Osteopathic manipulative treatment techniques preferred by contemporary osteopathic physicians
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2003/05
Free full text

5512

The effect of muscle energy technique on gross trunk range of motion
Lenehan, K. L., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/04

5513

Research at US colleges of osteopathic medicine: a decade of growth
Guillory, V. J., Sharp, G.
The Journal of the American Osteopathic Association, 2003/04
Free full text

5514

Regarding the editorial on tobaccoism
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/04

5515

Thanks for professional support
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2003/04


5517

Osteopathie bei chronischer Sinusitis
(Osteopathy for chronic sinusitis)
Häfner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

5518

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

5519

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

5520

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04


5522

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

5523

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

5524

Time to forge affiliations between osteopathic medical schools and hospitals
Belsky, D. H.
The Journal of the American Osteopathic Association, 2003/03
Free full text

5525

A proposal that benefits all
Bentley, E. M.
The Journal of the American Osteopathic Association, 2003/03
Free full text

5526

Tobaccoism revisited
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/03
Free full text

5527

Osteopatia in neonatologia
(Osteopathy in neonatology)
Colli, R., Biagiotti, I., Sterpa, A.
La Pediatria medica e chirurgica : Medical and surgical pediatrics, 2003/03

5528

Conceptual and Treatment Models in Osteopathy
Jordan, T.
The AAO Journal, 2003/03
Free full text

5529

Characteristics of physicians disciplined by the State Medical Board of Ohio
Clay, S. W., Conatser, R. R.
The Journal of the American Osteopathic Association, 2003/02
Free full text

5530

Failure to convince osteopathic medical students of OMT's worth increases risk of subspecialization
Corbett, R. M.
The Journal of the American Osteopathic Association, 2003/02
Free full text

5531

Validity and reliability of the Osteopathic Survey of Health Care in America (OSTEOSURV)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/02
Free full text


5533

Manipulation of the cervical spine
Hing, W. A., Reid, D. A., Monaghan, M.
Manual Therapy, 2003/02

5534

Alternative treatments for neck sprain
Hogg, K., Morton, R.
Emergency Medicine Journal, 2003/01

5535

Benefits of osteopathic schools
Blackstone, E. A.
Health Affairs, 2003/01

5536

Results of a survey of inaugural class graduates of a college of osteopathic medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2003/01
Free full text

5537

Use of osteopathic manipulative treatment by Ohio osteopathic physicians in various specialties
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2003/01
Free full text




5541

Clinical thinking: does your choice of university make a difference?
Harris, M.
Unpublished MSc thesis, 2003/01
Free full text



5544

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text


5546

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01

5547

Praxis optimieren: Eingang und Flur
(Optimizing your practice: Entrance and hallway)
Edelmann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

5548

Das schmerzhafte Knie: Eine Übersicht
(The painful knee: an overview)
Resch, K.L., Bachem, S., Salzmann, I., Schwartz, U., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

5549

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

5550

Kompensatorische Kniebeschwerden
(Compensatory knee pain)
Schallier, F., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

5551

Das posttraumatische Kniegelenk
(The post-traumatic knee joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

5552


5553

From the Archives: Untitled Talk
Sutherland, W. G.
The AAO Journal, 2002/12
Free full text

5554

Social Capital and Osteopathic Medicine in Transition
Ward, R. C.
The AAO Journal, 2002/12
Free full text

5555

Reasons for student debt during medical education: a Michigan study
Zonia, S. C., Stommel, M., Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 2002/12
Free full text

5556

Improving the oral health knowledge of osteopathic medical students
Skelton, J., Smith, T. A., Betz, W. T., Heaton, L. J., Lillich, T. T.
Journal of Dental Education, 2002/11

5557

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

5558

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

5559

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11

5560

Selection criteria for applicants in primary care osteopathic graduate medical education
Bates, B. P.
The Journal of the American Osteopathic Association, 2002/11
Free full text

5561

Parameters of asthma and manipulation study questioned
Cali, G. E.
The Journal of the American Osteopathic Association, 2002/11
Free full text

5562

State of the art in standardized patient programs: a survey of osteopathic medical schools
Errichetti, A. M., Gimpel, J. R., Boulet, J. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text


5564

Institutional impact of a part-time faculty development fellowship program for osteopathic community-based physicians
Pinheiro, S. O., Liechty, D. K., Busch, K. V., Johnson, E. S., Dora, D. L., Butler, R. M.
The Journal of the American Osteopathic Association, 2002/11
Free full text

5565

Training family medicine residents for assessment and advocacy of older adults
Robbins, M. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text

5566

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text

5567

The effect of cranial manipulation on the Traube-Hering-Mayer oscillation as measured by laser-Doppler flowmetry
Sergueef, N., Nelson, K. E., Glonek, T.
Alternative Therapies in Health and Medicine, 2002/11

5568

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text





5573

Common Mother-Infant Treatment. A Way to Attachment Security
Kreutz, M.
Unpublished MSc thesis, 2002/10









5582

Working less, training harder
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2002/10
Free full text

5583

Conditions and diagnoses for which osteopathic primary care physicians and specialists use osteopathic manipulative treatment
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2002/10
Free full text


5585

Osteopathic perturbation and immune network compensation
Degabriele, R.
Journal of Osteopathic Medicine, 2002/10

5586

A retrospective case report of symphysis pubis dysfunction in a pregnant woman
Cassidy, I., Jones, C.
Journal of Osteopathic Medicine, 2002/10

5587

Research Interests and Motivations Among Osteopathic Medical Students: Results of a Pre-Clinical Student Survey
Licciardone, J. C., Fulda, K., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/09

5588

From the Archives: Vindication
Bennett, G. M.
The AAO Journal, 2002/09
Free full text

5589

Re: Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
McGovern, J. J., McGovern, R. J., Lemley, W. W.
The AAO Journal, 2002/09
Free full text

5590

Post-traumatic Headache of Cervical Origin
Mitra, M. M., Stoll, S. T.
The AAO Journal, 2002/09
Free full text

5591

Osteopathic Manipulative Treatment and Task Specific Practice Enhance Locomotor Recovery after Unilateral Sensorimotor Cortex Lesions in Rats
Schmanke, T., Rosario, H., Chughtai, H., Ruiz, C., O'Halpin, S., Wells, M. R., Hallas, B. H., Scandalis, T. A.
The Journal of the American Osteopathic Association, 2002/09

5592

Students', Interns' and Residents' Comfort and Confidence With Their OMT Skills
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2002/09

5593

Student performance on the Comprehensive Osteopathic Medical Licensing Examination-USA level 2 following a clinical evaluation, feedback, and intervention program
Agostini, D. E., Stano, A. S., Parente, D. H.
The Journal of the American Osteopathic Association, 2002/09
Free full text

5594

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text

5595

Osteopathic Manipulation Increases Active Range of Motion and Gait Parameters in Osteoarthritis: A Pilot Study
Bahamonde, L. G., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
Journal of Osteopathic Medicine, 2002/08

5596

Impact of Osteopathic Manual Medicine in Patients with Knee Osteoarthritis
Degenhardt, B. F., Kenney, R. G., McGovern, R. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/08

5597

Joint Kinetic Parameters as Indicators of Osteopathic Manipulative Treatment Effect in Osteoarthritis of the Knee
Kilbury Nason, L. L., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
The Journal of the American Osteopathic Association, 2002/08

5598

A Randomized Controlled Trial of Osteopathic Manipulative Treatment in Chronic, Non-Specific Low Back Pain
Licciardone, J. C., Stoll, S. T., Fulda, K., Russo, D. P., Siu, J., Winn, W., Swift Jr., J.
The Journal of the American Osteopathic Association, 2002/08

5599

Effect of Osteopathic Manipulative Treatment (OMT) On Recurrent Acute Otitis Media in Children
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F., Worden, K.
The Journal of the American Osteopathic Association, 2002/08

5600

Can A Sham Treatment Blind Subjects With Obstructive Lung Disease To Group Assignment?
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2002/08

5601

The Immediate Effect of OMT on Pulmonary Function Parameters in Obstructive Pulmonary Disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2002/08

5602

Differences in the Evaluation and Treatment of Neck and Back Pain among Osteopathic and Allopathic Family Physicians
Pedersen, B., Guillory, V. J., Lynch, J. K.
The Journal of the American Osteopathic Association, 2002/08

5603

The anatomy professor that ate New York: some dinosaurs are teachers, and some teach about dinosaurs
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2002/08
Free full text

5604

Rating interest in clinical research among osteopathic medical students
Licciardone, J. C., Fulda, K. G., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/08
Free full text

5605

Osteopathy in pregnancy and childbirth. Interview by Jenny Green
Sandler, S., Korth, S.
The Practising Midwife, 2002/07

5606

Quantifiable effects of osteopathic manipulative techniques on patients with chronic asthma
Bockenhauer, S. E., Julliard, K. N., Lo, K. S., Huang, E., Sheth, A. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text

5607

Good guys and practice guidelines: osteopathic medicine's role
Harper, D. L.
The Journal of the American Osteopathic Association, 2002/07
Free full text

5608

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text


5610

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text


5612

DO questions need for proposed new tenets of osteopathic medicine
Clark, R. C.
The Journal of the American Osteopathic Association, 2002/06
Free full text

5613

Osteopathic manipulative treatment in conjunction with medication relieves pain associated with fibromyalgia syndrome: results of a randomized clinical pilot project
Gamber, R. G., Shores, J. H., Russo, D. P., Jimenez, C., Rubin, B. R.
The Journal of the American Osteopathic Association, 2002/06
Free full text

5614

Mechanisms and effects of spinal high-velocity, low-amplitude thrust manipulation: previous theories
Evans, D. W.
Journal of Manipulative and Physiological Therapeutics, 2002/05

5615

Resources in bioethics at osteopathic medical schools
Peppin, J., Leeper, K., Garloff, D.
Academic Medicine, 2002/05
Free full text

5616

Can we afford to lose another osteopathic teaching facility?
Dickason, R. H.
The Journal of the American Osteopathic Association, 2002/05
Free full text

5617

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text

5618

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text

5619

Joint cracking and popping: understanding noises that accompany articular release
Protopapas, M. G., Cymet, T. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text

5620

Effects of osteopathic manipulative treatment and concentric and eccentric maximal-effort exercise on women with multiple sclerosis: a pilot study
Yates, H. A., Vardy, T. C., Kuchera, M. L., Ripley, B. D., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text

5621

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04

5622

In response
Sanders, G.
Journal of Osteopathic Medicine, 2002/04


5624

Unity between osteopathic and allopathic medicine only answer to preserving osteopathic uniqueness
Wagner, E. E.
The Journal of the American Osteopathic Association, 2002/04
Free full text

5625

Editorial
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2002/04

5626

Unrelenting Abdominal Pain of Elusive Origin: A Case Study
Chapello, I. A., Templin, M. A.
The AAO Journal, 2002/03
Free full text

5627

Search Words: Osteopath, Osteopathy, Osteopathic
Chila, A. G.
The AAO Journal, 2002/03
Free full text

5628

Osteopathy: A Noun Not Just An Adjective
Habenicht, A. L.
The AAO Journal, 2002/03
Free full text

5629

The Impact of Osteopathic Manipulative Medicine On Inpatient Outcomes
Klock, G. B.
The AAO Journal, 2002/03
Free full text

5630

Improved Pain Score Outcomes Achieved Through The Cooperative And Cost-Effective Use Of Physical (Osteopathic Manipulative) Medicine In The Treatment Of Outpatient Musculoskeletal Complaints
Lipton, J. A., Meneses, P., Martin, J. B., Mizera, A. C., Kappler, R. E., Brooks, J. S., Parr, C.
The AAO Journal, 2002/03
Free full text

5631

From the Archives: Osteopathic Fundamentals
Page, L. E.
The AAO Journal, 2002/03
Free full text

5632

Osteopathic philosophy must be the foundation of osteopathic medical education
Beals-Becker, L.
The Journal of the American Osteopathic Association, 2002/03
Free full text

5633

Quality of life in referred patients presenting to a specialty clinic for osteopathic manipulative treatment
Licciardone, J. C., Gamber, R. G., Russo, D. P.
The Journal of the American Osteopathic Association, 2002/03
Free full text

5634

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text

5635

Need for objective measures to prove clinical outcome
Oleski, S. L., Kim, M. D.
The Journal of the American Osteopathic Association, 2002/03
Free full text

5636

Evaluation of osteopathic manipulative treatment training by practicing physicians in Ohio
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2002/03
Free full text

5637

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02

5638

Proposed tenets of osteopathic medicine and principles for patient care
Rogers, F. J., D'Alonzo, G. E., Jr., Glover, J. C., Korr, I. M., Osborn, G. G., Patterson, M. M., Seffinger, M. A., Taylor, T. E., Willard
The Journal of the American Osteopathic Association, 2002/02
Free full text

5639

Interexaminer reliability and cranial osteopathy
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2002/01

5640

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text

5641

Osteopathic philosophy in comparison with other spiritual philosophical sytems
Feiel-Schmidt, G.
Unpublished MSc thesis, 2002/01
Free full text

5642

An alert regarding Canada's financial aid for an osteopathic medical education
Campbell, A.
The Journal of the American Osteopathic Association, 2002/01
Free full text

5643

End-of-life care focus critical to a complete medical education
Gaber, R.
The Journal of the American Osteopathic Association, 2002/01
Free full text

5644

Patient satisfaction and clinical outcomes associated with osteopathic manipulative treatment
Licciardone, J., Gamber, R., Cardarelli, K.
The Journal of the American Osteopathic Association, 2002/01
Free full text

5645

Identifying competencies for effective osteopathic physicians in the 21st century
Walrod, S.
Unpublished PhD thesis, 2002/01
Free full text

5646

Osteopathic approach may be helpful in war on terrorism
Rogers, F. J.
The Journal of the American Osteopathic Association, 2002/01
Free full text

5647

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text


5649

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text

5650

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text

5651

Is there any osteopathy in the specialty training of osteopathic residents?
Glover, J. C.
The AAO Journal, 2001/12
Free full text

5652

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text


5654

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text



5657

Guide OPTI development beyond organizational differences
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

5658

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

5659

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

5660

A Fact: The Medical Industry Doesn't Support Hands-On CME!
Noone, S. J.
The AAO Journal, 2001/12
Free full text

5661

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

5662

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text

5663

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text

5664

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text




5668


5669

Short-term effects of cervical manipulation on edge light pupil cycle time: a pilot study
Gibbons, P., Gosling, C. M., Holmes, M.
Journal of Osteopathic Medicine, 2001/10

5670

Thoracic spine dysfunction in upper extremity complex regional pain syndrome type I
Menck, J. Y., Requejo, S. M., Kulik, K.
Journal of Osteopathic Medicine, 2001/10

5671

Destiny of osteopathic profession. 1916
Meacham, W. B.
The Journal of the American Osteopathic Association, 2001/10

5672

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text

5673

Andrew Taylor Still Memorial Lecture: the osteopathic difference--is it only manipulation? 1984
Siehl, D.
The Journal of the American Osteopathic Association, 2001/10

5674

Osteopathic treatment in rehabilitation of whiplash injury
Stockinger, V.
Unpublished MSc thesis, 2001/10

5675

Efficacy of spinal manipulation for chronic headache: A systematic review
Bronfort, G.
Journal of Manipulative and Physiological Therapeutics, 2001/09

5676

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09

5677

Trends in Referral Patterns by Osteopathic Physician Preceptors: Results of a Pilot Study
Iverson, G. D., Helduser, J. W., Licciardone, J. C., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2001/09

5678

A Pilot Study Assessing Effects of OMT on Immune Changes Associated Wth Academic Stress
Joshi, B. P., Plotkin, B. J., Viselli, S. M.
The Journal of the American Osteopathic Association, 2001/09

5679

Respect the friendly adversary
Anderson, R. B.
The Journal of the American Osteopathic Association, 2001/09
Free full text

5680

Marketing lessons and retaining the traditional osteopathic internship
Broder, D. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text

5681

Decline in structural examination compliance in the hospital medical record with advancing level of training
Essig-Beatty, D. R., Klebba, G. E., LaPointe, N. G., Miller, E. D., Strong, R. E.
The Journal of the American Osteopathic Association, 2001/09
Free full text

5682

Has our profession become its own worst enemy?
Fettig, L. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text

5683

Development of the Attitudes Toward Osteopathic Principles and Practices Scale (ATOPPS): Preliminary Results of a Pilot Project
Russo, D. P., Stoll, S. T., Shores, J.
The Journal of the American Osteopathic Association, 2001/09

5684

Adjunctive osteopathic manipulative treatment in women with depression: a pilot study
Plotkin, B. J., Rodos, J. J., Kappler, R., Schrage, M., Freydl, K., Hasegawa, S., Hennegan, E., Hilchie-Schmidt, C., Hines, D., Iwata, J., Mok, C., Raffaelli, D.
The Journal of the American Osteopathic Association, 2001/09
Free full text

5685

Osteopathic manipulative treatment of low back pain during labor
Carpenter, S., Woolley, A.
The AAO Journal, 2001/09

5686

Elbow injuries in golf
Stockard, A. R.
The Journal of the American Osteopathic Association, 2001/09
Free full text

5687

The Evaluation of the Effect of Osteopathic Manipulative Techniques (OMT) on Headache Pain
Flotildes, K. L.
The Journal of the American Osteopathic Association, 2001/08

5688

Effect of Pre-Emptive Morphine and Postoperative Osteopathic Manipulative Technique on Pain Following Total Abdominal Hysterectomy: A Pilot Study
Goldstein, F., Jeck, S., Nicholas, A., Berman, M., Lerario, M.
The Journal of the American Osteopathic Association, 2001/08

5689

More on allopathic medical credentialing
Allee, B. A.
The Journal of the American Osteopathic Association, 2001/08
Free full text

5690

Osteopathic treatment of the common cold. 1937
Becker, A. D.
The Journal of the American Osteopathic Association, 2001/08
Free full text

5691

The Effects of a Structured OMT Curriculum on Osteopathic Exams and OMT for Hospitalized Patients
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2001/08

5692

The Effects of OMT on Vital Signs During Headache
Parikh, A. S.
The Journal of the American Osteopathic Association, 2001/08


5694

Methods of applying manipulative technic. 1945
Burns, L.
The Journal of the American Osteopathic Association, 2001/07
Free full text

5695

Soft tissues in areas of osteopathic lesion. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/07
Free full text

5696

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text

5697

Characteristics, satisfaction, and perceptions of patients receiving ambulatory healthcare from osteopathic physicians: a comparative national survey
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text

5698

Applications of manipulative techniques
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text

5699

Osteopathic medical schools should foster sense of identity
Fogel, R. M.
The Journal of the American Osteopathic Association, 2001/06
Free full text


5701

DOs question intent of challenge
Zorski, K. C., Woeller, K. N., Galin, C. M., Nani, S., Myers, G. P., Greenfield, J. R., Sendzicki, B., Haltof, A. H.
The Journal of the American Osteopathic Association, 2001/06
Free full text

5702

Sinusitis in children: the importance of diagnosis and treatment
Shrum, K. M., Grogg, S. E., Barton, P., Shaw, H. H., Dyer, R. R.
The Journal of the American Osteopathic Association, 2001/05
Free full text

5703

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

5704

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

5705

Letter that questions OCF requires no response
MacDonald, R. C.
The Journal of the American Osteopathic Association, 2001/05
Free full text

5706

President Bush's 2002 budget proposal would hamper geriatric education
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text

5707

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text


5709

Osteopathic treatment considerations for rheumatic diseases
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2001/04
Free full text

5710

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text


5712

Review of Sacral Somatic Dysfunction
Janiak, D. D.
The AAO Journal, 2001/03
Free full text

5713

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text

5714

Researched and demonstrated: inquiry and infrastructure at osteopathic institutions
Gevitz, N.
The Journal of the American Osteopathic Association, 2001/03
Free full text

5715

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text

5716

Going global with osteopathic medicine
Smith, D. A.
The Journal of the American Osteopathic Association, 2001/03
Free full text

5717

Osteopathische Medizin
(Osteopathic Medicine)
Tempelhof, S., Weingart, J. R.
Erfahrungsheilkunde, 2001/03

5718

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text

5719

Analyzing the osteopathic lesion. 1940
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/02
Free full text

5720

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text

5721

Testing osteopathic medical school graduates for licensure: is COMLEX-USA the most appropriate examination?
Graneto, J.
The Journal of the American Osteopathic Association, 2001/01
Free full text

5722

Snapshot Survey
General Osteopathic Council, 2001
Free full text

5723

Osteopathic medicine in the treatment of low back pain
Newswanger, D. L., Patel, A. T., Ogle, A.
American Family Physician, 2000/12
Free full text

5724

Shortness of breath and hypoxia following exploratory laparotomy
Ettlinger, H. M.
The AAO Journal, 2000/12
Free full text


5726

Low back pain: Cost and treatment
Swords, W. J.
The AAO Journal, 2000/12
Free full text

5727

Benefits of osteopathic manipulative treatment for hospitalized elderly patients with pneumonia
Noll, D. R., Shores, J. H., Gamber, R. G., Herron, K. M., Swift, J.
The Journal of the American Osteopathic Association, 2000/12
Free full text

5728

Questioning of OCF should rouse osteopathic response
Norton, J. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text

5729

Collaboration between pharmacy and osteopathic medicine to teach via the Internet
Sweeney, M. A., Schuster, M. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text

5730

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text

5731

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

5732

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

5733

A fresh look at osteopathic medical education in 2000
Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2000/11

5734

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

5735

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text

5736

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

5737

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text


5739

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

5740

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

5741

Galbreath technique: a manipulative treatment for otitis media revisited
Pratt-Harrington, D.
The Journal of the American Osteopathic Association, 2000/10
Free full text


5743

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text


5745

Influencing the vegetative nervous system through manipulation. 1945
Northup, G. W.
The Journal of the American Osteopathic Association, 2000/10
Free full text

5746

The autonomic nervous system in osteopathic therapy. 1948
Waitley, D. D.
The Journal of the American Osteopathic Association, 2000/10
Free full text

5747

Individualizing treatment plan and combining approaches key to pain management and holistic care: a student's perspective
Lawlor, T. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text

5748

An examination of the status of osteopathic medicine from 1960 to 2000
Steinberg, S. H.
Unpublished PhD thesis, 2000/10

5749

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text


5751

Carpal tunnel syndrome: more than just a problem at the wrist
Ramey, K. A.
The AAO Journal, 2000/09
Free full text

5752

Osteopathic cranial lesions. 1948
Kimberly, P. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text

5753

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text

5754


5755

Patients' satisfaction with osteopathic and GP management of low back pain in the same surgery
Pincus, T., Vogel, S., Savage, R., Newman, S.
Complementary Therapies in Medicine, 2000/09

5756

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09

5757

Strategic choices for a primary care advantage: re-engineering osteopathic medicine for the 21st century
Glover, S. H., Rivers, P. A.
Health Services Management Research, 2000/08

5758

Osteopathic Manual Medicine and Acute Injuries
Coppola, G. W., Gilmore, J. L., Miars, C. W., Jacobs, A.
The Journal of the American Osteopathic Association, 2000/08


5760

Public Perceptions of Osteopathic Physicians: Results from the First Osteopathic Survey of Health Care in America
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2000/08

5761

The First Osteopathic Survey of Health Care in America
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2000/08

5762

A Randomized Controlled Trial of Osteopathic Manipulation Following Knee or Hip Arthroplasty
Licciardone, J. C., Stoll, S. T., Herron, K. M., Gamber, R. G., Swift, J., Winn, W.
The Journal of the American Osteopathic Association, 2000/08

5763

Schizophrenia. 1939
Hildreth, A. G., Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text

5764

Effects of Osteopathic Manipulative Treatment on Knee Osteoarthritis
Pham, C. N., Knebl, J.
The Journal of the American Osteopathic Association, 2000/08

5765

Osteopathic Manipulation in the Management of Parkinson's Disease
Wells, M. R., McCarty, C. L., Smutny, C. J., Scandalis, T. A., Dittrich, F., Fazzini, E. A.
The Journal of the American Osteopathic Association, 2000/08

5766

Psychosis and osteopathy
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text

5767

Opinions Toward The Use of OMT by Oklahoma D.O.s Responding to Surveys in 1984 and 1999
Yates, H., Johnson, J. C.
The Journal of the American Osteopathic Association, 2000/08

5768

Comparison of osteopathic and allopathic results in dementia praecox. 1933
Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text

5769

The mechanism of anatomical structure in its relation to osteopathy. 1911
Bernard, H.
The Journal of the American Osteopathic Association, 2000/07
Free full text

5770

Use of a computer-assisted clinical case (CACC) SOAP note exercise to assess students' application of osteopathic principles and practice
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2000/07
Free full text

5771

The emerging concept of the osteopathic lesion. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2000/07
Free full text

5772

Osteopathic practice. 1903
Bernard, H. E.
The Journal of the American Osteopathic Association, 2000/06
Free full text

5773

Osteopathic manipulative treatment and Down syndrome
Funk, S. L.
The AAO Journal, 2000/06
Free full text

5774

From the Archives: Prenatal Care
Grow, O. P.
The AAO Journal, 2000/06
Free full text


5776

Survey of medical ethics in US medical schools: a descriptive study
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2000/06
Free full text

5777

Another great article on osteopathic manipulative treatment
Zorski, K. C.
The Journal of the American Osteopathic Association, 2000/06
Free full text

5778

Letters to the Editor
Cummings, C. H., Norton, J. M., Nelson, K. E.
The AAO Journal, 2000/06
Free full text


5780

Progressive inhibition of neuromuscular structures (PINS) technique
Dowling, D. J.
The Journal of the American Osteopathic Association, 2000/05
Free full text

5781

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05

5782

The treatment of influenza. 1918
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/05
Free full text

5783

Osteopathic success in the treatment of influenza and pneumonia. 1919
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/05
Free full text

5784

Relationship between academic achievement and COMLEX-USA Level 1 performance: a multisite study
Baker, H. H., Foster, R. W., Bates, B. P., Cope, M. K., McWilliams, T. E., Musser, A., Yens, D.
The Journal of the American Osteopathic Association, 2000/04
Free full text

5785

National study of the impact of managed care on osteopathic physicians
Horan, J.
The Journal of the American Osteopathic Association, 2000/04
Free full text

5786

Osteopathie - Die sanfte Chirotherapie
(Osteopathy - The gentle chirotherapy)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2000/04

5787

Osteopathic treatment of low back pain
Sweetman, B. J.
The New England Journal of Medicine, 2000/03

5788

Unity may preserve osteopathic ideals
Adair, A. D.
The Journal of the American Osteopathic Association, 2000/03
Free full text

5789

Relationship of preadmission variables and first- and second-year course performance to performance on the National Board of Osteopathic Medical Examiners' COMLEX-USA Level 1 examination
Baker, H. H., Cope, M. K., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2000/03
Free full text

5790

Research Directions From 1940-1988
Beal, M. C.
The AAO Journal, 2000/03
Free full text

5791


5792

Case Study: OMT and Chronic Cephalgia
Brown, C. S.
The AAO Journal, 2000/03
Free full text

5793

Advancing Osteopathic Medicine in Health Care: Integrating OMM into Osteopathic Medical Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 2000/03
Free full text

5794

Lift Treatment in Naval Special Warfare (NSW) Personnel: A Retrospective Study
Lipton, J. A., Brooks, J. S., Hickey, M. J., Drew, B. G., Eggleston, M. T., Gemmer, C. H.
The AAO Journal, 2000/03
Free full text

5795

Case Study of a 42-year-old patient with Systemic Lupus Erythematosus
Zucker, N.
The AAO Journal, 2000/03
Free full text

5796

Refractory torticollis after a fall
Kaprow, M. G., Sandhouse, M.
The Journal of the American Osteopathic Association, 2000/03
Free full text

5797

Multiple sclerosis article ignores conventional and osteopathic treatment options
Schreier, E. M.
The Journal of the American Osteopathic Association, 2000/03
Free full text

5798

Research on OPP/OMT is Critical to the Profession's Future
Noone, S. J.
The AAO Journal, 2000/03
Free full text

5799

Letters to the Editor
Friedman, H. D., McMillin, D. L., Richards, D. G., Mein, E. A., Nelson, C. D., Kellam, R. T., Patriquin, D. A., Clark, R. C.
The AAO Journal, 2000/03
Free full text

5800

Letters to the Editor
Orlando, C., Field, L.
The New England Journal of Medicine, 2000/03

5801

Osteopathic treatment of low back pain
Cherkin, D.
The New England Journal of Medicine, 2000/03

5802

Osteopathic treatment of low back pain
Foster, D., Johnson, M. D., Harrelson, A.
The New England Journal of Medicine, 2000/03

5803

Osteopathic treatment of low back pain
Oppenheim, J. S.
The New England Journal of Medicine, 2000/03

5804

Manual medicine treatment of the cervical spine and whiplash injury
Bilkey, W. J., Tomski, M. A.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02

5805

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02


5807

Importance of empiricism in medicine
Hartman, S. E.
The Journal of the American Osteopathic Association, 2000/02
Free full text

5808

Paradox answered
Parker, C.
The Journal of the American Osteopathic Association, 2000/02
Free full text

5809

Physician recalls unforgettable evening in her early career
Wales, A. L.
The Journal of the American Osteopathic Association, 2000/02
Free full text

5810

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02

5811

Management of osteoporosis in the new millennium
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2000/01

5812

Osteopathy an independent system co-extensive with the science and art of healing. 1901
Littlejohn, J. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text

5813

OMT and diffuse musculoskeletal complaints following a motor vehicle accident
Bezilla, T. A.
The AAO Journal, 1999/12
Free full text

5814

Take the time to teach to ensure the legacy and future of our profession
Steier, K. J.
Journal of Osteopathic Medicine, 1999/12
Free full text

5815

Comparison of osteopathic and allopathic medical schools' support for primary care
Peters, A. S., Clark-Chiarelli, N., Block, S. D.
Journal of General Internal Medicine, 1999/12

5816

Osteopathic treatment of asthma: A literature review and call for research
Jackson, K. M., Steele, K. M.
The AAO Journal, 1999/12
Free full text

5817

Importance of OMT cannot be overemphasized
Abend, D. S.
Journal of Osteopathic Medicine, 1999/12
Free full text



5820

An overview of osteopathic medicine
Lesho, E. P.
Archives of Family Medicine, 1999/11

5821

New England Journal of Medicine article may be misleading about OMT
Coughlin, P., Kriebel, R., Fogel, R.
Journal of Osteopathic Medicine, 1999/11
Free full text

5822

A comparison of osteopathic spinal manipulation with standard care for patients with low back pain
Andersson, G. B., Lucente, T., Davis, A. M., Kappler, R. E., Lipton, J. A., Leurgans, S.
The New England Journal of Medicine, 1999/11
Free full text



5825

Osteopathic unity must continue
Ross, K. E.
Journal of Osteopathic Medicine, 1999/10
Free full text




5829

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain. A randomized controlled trial)
Adorjàn-Schaumann, A., Höhrhan, G., Wille, H., Wolff, A.
Unpublished D.O. thesis, 1999/10

5830

Low back pain in pregnancy
Gallagher, K. M.
The AAO Journal, 1999/09
Free full text

5831

A review of the principles of William G. Sutherland's general techniques
Golden, W. J.
The AAO Journal, 1999/09
Free full text

5832

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text

5833


5834

Osteopathic manipulative treatment of an 8-year-old child born with anoxia
Morelli, M. A.
The AAO Journal, 1999/09
Free full text


5836

Professional identification and affiliation of the 1992 graduate class of the colleges of osteopathic medicine
Aguwa, M. I., Liechty, D. K.
Journal of Osteopathic Medicine, 1999/08
Free full text

5837

Remember the DO difference
Rossi, P. C.
Journal of Osteopathic Medicine, 1999/07
Free full text

5838

Training osteopathic geriatric academicians: impact of a model geriatric residency program
Cavalieri, T. A., Basehore, P., Perweiler, E., Chopra, A.
Journal of Osteopathic Medicine, 1999/07
Free full text

5839

OMT and urinary incontinence
Farley, J. E.
The AAO Journal, 1999/06
Free full text

5840

MRI assessment of changes in swelling of wrist structures following OMT in patients with carpal tunnel syndrome
Ramey, K. A., Kappler, R. E., Chimata, M., Hohner, J., Mizera, A. C.
The AAO Journal, 1999/06
Free full text

5841

OMM beyond the classroom – The Future is now
Veneziano, M.
The AAO Journal, 1999/06
Free full text

5842

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text

5843

An osteopathic approach to asthma
Rowane, W. A., Rowane, M. P.
Journal of Osteopathic Medicine, 1999/05
Free full text

5844

DO's approach to patient is 'wholistic'--not holistic
Gotfried, R.
Journal of Osteopathic Medicine, 1999/05
Free full text

5845

The Effectiveness of CV-4 and Resting Position Techniques on Subjects with Tension-Type Headaches
Hanten, William P., Olson, Sharon L., Hodson, Jennifer L., Imler, Vickie L., Knab, Virginia M., Magee, Jennifer L.
Journal of Manual & Manipulative Therapy, 1999/04/01

5846


5847

Visualization technology in medical education
Gorbis, S., Hallgren, R. C.
Journal of Osteopathic Medicine, 1999/04
Free full text

5848

Call to develop and implement dually approved residency programs
Daftarian, H.
Journal of Osteopathic Medicine, 1999/04
Free full text

5849

Dancing Elaine neck syndrome
Chin, C.
The AAO Journal, 1999/03
Free full text

5850

1998 Louisa Burns Memorial Lecture: can teaching and research coexist?
Yorio, T.
Journal of Osteopathic Medicine, 1999/03
Free full text

5851

Adjunctive osteopathic manipulative treatment in the elderly hospitalized with pneumonia: a pilot study
Noll, D. R., Shores, J., Bryman, P. N., Masterson, E. V.
Journal of Osteopathic Medicine, 1999/03
Free full text

5852

Chiropractic and osteopathic education at Royal Melbourne Institute of Technology. A student perspective
French, S. D., Marshall, S. J., Webb, M., Tucker, C.
Australasian Chiropractic & Osteopathy, 1999/03
Free full text

5853

Making a difference: the osteopathic approach lecture series
Danto, J. B., Kavieff, T. R.
Journal of Osteopathic Medicine, 1999/03
Free full text

5854

Seize opportunity to foster osteopathic pride
Bahrami, P.
Journal of Osteopathic Medicine, 1999/03
Free full text

5855

The Use of OMT in Stroke Rehabilitation
Maxwell, S.
The AAO Journal, 1999/03
Free full text

5856

The principles of osteopathic structural therapy – Part IV
Page, L. E.
The AAO Journal, 1999/03
Free full text


5858

Standard osteopathic manipulative treatment acutely improves gait performance in patients with Parkinson's disease
Wells, M. R., Giantinoto, S., D'Agate, D., Areman, R. D., Fazzini, E. A., Dowling, D., Bosak, A.
Journal of Osteopathic Medicine, 1999/02
Free full text

5859

Time to tell the world about osteopathic medicine
Oliveri, E. A., Osborn, G. C.
Journal of Osteopathic Medicine, 1999/02
Free full text

5860

Revisiting the role of osteopathic manipulation in primary care
Hopp, R. J.
Journal of Osteopathic Medicine, 1999/02
Free full text

5861

An international study of osteopathic practice
Cameron, M.
Unpublished MSc thesis, 1999/01
Free full text

5862

Comparison of the scope of allopathic and osteopathic medical school health promotion programs for students
Hooper, J., Cox, C. C., Cambre, K., Wilburn, D., Webster, M., Wolf, T.
American Journal of Health Promotion, 1999/01

5863

Widespread confusion prevails over 'osteopathy'
Truthan, C. E.
Journal of Osteopathic Medicine, 1998/12
Free full text


5865


5866

The principles of osteopathic structural therapy – Part III
Page, L. E.
The AAO Journal, 1998/12
Free full text

5867

Student Movement of the Medicine/Public Health Initiative promotes nationwide preventive healthcare approach
Cardarelli, R., Pierce, T.
Journal of Osteopathic Medicine, 1998/12
Free full text

5868

Case Study: OMT and the enlarged prostate
Smutney, C. J.
The AAO Journal, 1998/12
Free full text

5869

Scoliosis and Osteopathic Manipulative Treatment
Weatherly, J.
The AAO Journal, 1998/12
Free full text

5870

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text

5871

Osteopathic medical education in 1998 prepares for the future
Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text

5872




5875

Osteopathic medical school applicants not allopathic medical school 'rejects'
Kasovac, M.
Journal of Osteopathic Medicine, 1998/10
Free full text


5877

Sinusitus Supplement missing osteopathic component
Dudley, G.
Journal of Osteopathic Medicine, 1998/10

5878

Short leg syndrome
Lal, S.
The AAO Journal, 1998/09
Free full text

5879

Correction to 'professional identity' article
Tettambel, M. A.
Journal of Osteopathic Medicine, 1998/09
Free full text

5880

Key to our survival lies in honesty
Olson, C. D.
Journal of Osteopathic Medicine, 1998/09
Free full text

5881

L'ostéopathie et la chiropraxie.
(Osteopathy and chiropractic)
Klein, P.
Revue médicale de Bruxelles, 1998/09

5882

Integrating cranial osteopathy with gnathologic orthopedics
Kennedy, J. M.
The Journal - American Academy of Gnathologic Orthopedics, 1998/09

5883

The origin and relief of common pain
Irvin, R. E.
Journal of Back and Musculoskeletal Rehabilitation, 1998/09

5884

The principles of osteopathic structural therapy – Part II
Page, L. E.
The AAO Journal, 1998/09
Free full text

5885

Case study: Neck and shoulder pain
Pasquarello, G.
The AAO Journal, 1998/09
Free full text

5886

Alternative therapies and complementary medicine: a mutiny in the making
Friedman, H. D.
Journal of Osteopathic Medicine, 1998/09
Free full text

5887

Scalene entrapment syndrome
Royder, J. O.
The AAO Journal, 1998/09
Free full text


5889

An 'apples-to-apples' comparison of training hours for DOs, PAs, NPs
Truthan, C. E.
Journal of Osteopathic Medicine, 1998/08
Free full text

5890

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text


5892


5893


5894

Solar Plexus Injuries: An old injury with a new twist
Jones, J. M., May, T.
The AAO Journal, 1998/06
Free full text

5895

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06

5896

The principles of osteopathic structural therapy – Part I
Page, L. E.
The AAO Journal, 1998/06
Free full text

5897

Case History
Strait, B. W.
The AAO Journal, 1998/06
Free full text

5898

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05

5899

Muscle energy concepts and coupled motion of the spine
Gibbons, P., Tehan, P.
Manual Therapy, 1998/05

5900

Are D.O.s losing their unique identity?
Guglielmo, W. J.
Medical Economics, 1998/04

5901

Coming full circle: osteopathic manipulative treatment and immunity
Allen, T. W.
Journal of Osteopathic Medicine, 1998/04

5902

Application of osteopathic principles to a viral upper respiratory infection
Cavanaugh, S. P.
The AAO Journal, 1998/03
Free full text

5903

Partners for two decades: AOA and the National High Blood Pressure Education Program
Nickey, W. A., Lenfant, C.
Journal of Osteopathic Medicine, 1998/03

5904

Effect of lymphatic and splenic pump techniques on the antibody response to hepatitis B vaccine: a pilot study
Jackson, K. M., Steele, T. F., Dugan, E. P., Kukulka, G., Blue, W., Roberts, A.
Journal of Osteopathic Medicine, 1998/03


5906

Sinusitis and OMT
Sept, K.
The AAO Journal, 1998/03
Free full text

5907

The medical school curriculum for the 21st century
Wood, D. L., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/02

5908

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02

5909

Re-examining the number of osteopathic residency programs
Baker, H. H.
Journal of Osteopathic Medicine, 1998/02

5910

Osteopathic versus allopathic care
Wakham, M.
Hospital Practice, 1998/01


5912

Positional release techniques in the treatment of muscle and joint dysfunction
Chaitow, L.
Clinical Bulletin of Myofascial Therapy, 1998/01

5913

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01

5914

Inpatient osteopathic manipulative treatment: Impact on length of stay
Cantieri, M. S.
The AAO Journal, 1997/12
Free full text

5915

Motor-vehicle accident trauma
File, P. M.
The AAO Journal, 1997/12
Free full text

5916

The basic principles of osteopathic practice
Hollis, A. S.
The AAO Journal, 1997/12
Free full text

5917

Pain: a functional disorder
Ernst, E.
British Journal of General Practice, 1997/12
Free full text

5918

Leading the pace of change: crisis or opportunity?
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/12
Free full text

5919

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text

5920

Anatomy of an OPTI dissected: structure, function, and the impact of budget reconciliation legislation
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/11
Free full text

5921

A snapshot of osteopathic medical education in 1997
Retz, K. C.
Journal of Osteopathic Medicine, 1997/11
Free full text

5922

Forecast for osteopathic medical education programs in the for-profit hospital environs
Spink, G. C.
Journal of Osteopathic Medicine, 1997/11
Free full text

5923

(Osteopathy treatment)
Osteopathie-Behandlung
Mach, J.
Deutsche Medizinische Wochenschrift, 1997/10

5924

Anatomy of an OPTI: Part I. Form, function, and relationships
Meyer, C. T., Mann, M. P., Riley, C., Portanova, R.
Journal of Osteopathic Medicine, 1997/10
Free full text

5925

The effects of muscle energy technique on lumbar range of motion
Schenk, R. J., MacDiarmid, A., Rousselle, J.
Journal of Manual and Manipulative Therapy, 1997/10

5926

Managing back pain in general practice--is osteopathy the new paradigm?
Williams, N.
British Journal of General Practice, 1997/10
Free full text


5928

Osteopathic manipulative treatment: Practice use and and opinions of the Texas College of Osteopathic Medicine alumni
Gamber, R. G., Kennedy, D. A., Erickson, R. C., Moss, J. A., McKay Hart, C., Zengerle, C., Stone, R. C., Gish, E. E.
The AAO Journal, 1997/09
Free full text

5929

Case history: Low back pain with a radiating 'electric shock'
McCarty, C. L.
The AAO Journal, 1997/09
Free full text

5930

The effect of osteopathic manipulative treatment (OMT) on heart rate and blood pressure in female athletes
Paul, F. A., Norton, J. M., Cross, N. A., Buser, B. R.
The AAO Journal, 1997/09
Free full text

5931

Pondering the effects of the Reconciliation Budget law on osteopathic medical education
Wood, D. L.
Journal of Osteopathic Medicine, 1997/09
Free full text

5932

The art of osteopathy
Wales, A. L.
The AAO Journal, 1997/09
Free full text

5933

The controversy of cranial bone motion
Rogers, J. S., Witt, P. L.
Journal of Orthopaedic & Sports Physical Therapy, 1997/08

5934

An osteopathic prescription for medical education reform: Part 2. Specialty mix and community integration
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/08
Free full text

5935

An osteopathic prescription for medical education reform: Part 1. Curriculum and infrastructure
Ross-Lee, B., Wood, D. L., Mann, D. D., Portanova, R. P., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/07
Free full text


5937

The hysteresis loop as a model for low back motion analysis
Warner, M. J., Mertz, J. A., Zimmerman, A. S.
Journal of Osteopathic Medicine, 1997/07
Free full text

5938

OMM and Asthma
Jealous, J. S.
The AAO Journal, 1997/06
Free full text

5939

Informing public, students will make profession 'visible'
Bahrami, P.
Journal of Osteopathic Medicine, 1997/06
Free full text

5940

Osteopathic manifesto. VI. The light of the profession. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/06
Free full text



5943

Comparing medical knowledge of osteopathic medical trainees in DO and MD programs: a random effect meta-analysis
Shen, L., Cavalieri, T., Clearfield, M., Smoley, J.
Journal of Osteopathic Medicine, 1997/06
Free full text

5944

Introducing the cranial approach in osteopathy and the treatment of infants and mothers
Sullivan, C.
Complementary Therapies in Nursing and Midwifery, 1997/06

5945

Chest pain and the role of somatic dysfunction
Wax, C. M., Abend, D. S., Pearson, P. H.
Journal of Osteopathic Medicine, 1997/06
Free full text

5946

Muscle tones
Waldron, B. J.
The AAO Journal, 1997/06
Free full text

5947

From 'Osteopathic Manipulative Procedure in Disorders of the Eye'
Wolf, A. H.
The AAO Journal, 1997/06
Free full text

5948

Will failure to use OMT be grounds for malpractice?
Allen, T. W.
Journal of Osteopathic Medicine, 1997/05
Free full text

5949

Repositioning maneuver for benign paroxysmal positional vertigo (BPPV)
Brooks, J. G., Abidin, M. R.
Journal of Osteopathic Medicine, 1997/05
Free full text

5950

Osteopathic medical considerations of reflex sympathetic dystrophy
Nelson, K. E.
Journal of Osteopathic Medicine, 1997/05
Free full text

5951

Osteopathic manipulation for low back pain
Abend, D. S.
Postgraduate Medicine, 1997/04

5952

Establishment of behavioral parameters for the evaluation of osteopathic treatment principles in a rat model of arthritis
Hallas, B., Lehman, S., Bosak, A., Tierney, S., Galler, R., Jacovina, P., Scandalis, T. A., Wells, M.
Journal of Osteopathic Medicine, 1997/04
Free full text

5953

Soft tissue manipulation: neuromuscular and muscle energy techniques
Roberts, B. L.
Journal of Neuroscience Nursing, 1997/04

5954

Case History: Intractable Low Back Pain
Koss, R. M.
The AAO Journal, 1997/03
Free full text

5955

Carpal Tunnel Syndrome
Miller, K.
The AAO Journal, 1997/03
Free full text


5957

Comparison of entrance requirements for health care professions
Doxey, T. T., Phillips, R. B.
Journal of Manipulative and Physiological Therapeutics, 1997/02

5958

Can DOs still 'circle the wagons'? Reflections on the use of osteopathic manipulative treatment
Fry, L. J.
Journal of Osteopathic Medicine, 1997/02
Free full text

5959

Variables influencing the use of osteopathic manipulative treatment in family practice
Johnson, S. M., Kurtz, M. E., Kurtz, J. C.
Journal of Osteopathic Medicine, 1997/02
Free full text

5960

Osteopathic manipulative treatment: student attitudes before and after intensive clinical exposure
Magnus, W. W., Gamber, R. G.
Journal of Osteopathic Medicine, 1997/02
Free full text

5961

Osteopathic physicians and expert medical testimony
McAbee, G. N.
Journal of Osteopathic Medicine, 1997/01
Free full text


5963

From Principles of Osteopathy
Page, L. E.
The AAO Journal, 1996/12
Free full text

5964

AOA continuing medical education
MacPherson, S. B., Rodgers, D. J.
The Journal of the American Osteopathic Association, 1996/11
Free full text

5965

Osteopathic graduate medical education
Bronersky, V. M., Falbo, P. W.
The Journal of the American Osteopathic Association, 1996/11
Free full text

5966

Geriatric education in osteopathic medical schools
Carlsen, W., Pfeiffer, B., Marx, T., Bonyo, B.
The Journal of the American Osteopathic Association, 1996/11
Free full text

5967

Osteopathic medical education at the bridge to the 21st century
Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

5968

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

5969

In pursuit of generalism: basic factors influencing the specialty decisions of osteopathic medical school seniors in 1995
Singer, A. M.
The Journal of the American Osteopathic Association, 1996/11
Free full text

5970

Research programs of the AOA and their role in osteopathic medical education
Retz, K. C., McGill, S. L.
The Journal of the American Osteopathic Association, 1996/11
Free full text

5971

Income and expenditures of osteopathic medical colleges
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

5972

Undergraduate osteopathic medical education
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

5973

Obtaining credentials for osteopathic manipulative medicine
Kuchera, M. L.
American Family Physician, 1996/10

5974

Osteopathic medical education: the introduction of managed care principles into our undergraduate curriculum
Musser, A. E., Vinn, N.
The Journal of the American Osteopathic Association, 1996/10
Free full text

5975

A manipulative technique of Andrew Taylor Still as reported by Charles Hazzard, DO, in 1905
Van Buskirk, R. L.
The Journal of the American Osteopathic Association, 1996/10
Free full text


5977

The efficacy of osteopathic treatment for primary dysmenorrhea in young women
Chadwick, K., Morgan, A.
The AAO Journal, 1996/09
Free full text

5978

Standardization of the hospital record for osteopathic structural examination: Part 2. Effects of an educational intervention on documentation of palpatory and structural findings and diagnosis
Friedman, H. D., Johnston, W. L., Kelso, A. F., Schwartz, F. N., Beal, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 1996/09
Free full text

5979

Results of the 1996 National Resident Matching Program: family practice
Kahn, N. B., Jr., Garner, J. G., Schmittling, G. T., Ostergaard, D. J., Graham
Family Medicine, 1996/09

5980

AAO Case History: Common problems in newborn and infant
Sholars, H.
The AAO Journal, 1996/09
Free full text

5981

Transforming osteopathic medical education
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/08
Free full text

5982

Craniosacral therapy
Elsdale, B.
Nursing Times, 1996/07

5983

Osteopathic manipulative treatment applications for the emergency department patient
Paul, F. A., Buser, B. R.
The Journal of the American Osteopathic Association, 1996/07
Free full text

5984

AAO Case Study: Recurrent Otitis Media
Gintis, B. R.
The AAO Journal, 1996/06
Free full text


5986

An Osteopathic Approach to HIV/AIDS
Mulligan, T.
The AAO Journal, 1996/06
Free full text


5988

Ambulatory care training standards for continuity of care in osteopathic family medicine
Winters, F. D., Zonia, S., Cook, J. N., Dora, D. L., Meyer, C. T.
The Journal of the American Osteopathic Association, 1996/04
Free full text

5989

The osteopathic physician teacher
Grimshaw, D. N.
The AAO Journal, 1996/03
Free full text

5990

A functional approach to heel lift therapy
Johnson, K. H.
The AAO Journal, 1996/03
Free full text

5991

Case History: Somatic dysfunctions related to chronic lumbar and hip strain
Jones, J. M.
The AAO Journal, 1996/03
Free full text

5992

Curriculum goals for the training of osteopathic family practice residents for the year 2000
Dickerman, J., Rich, P.
The Journal of the American Osteopathic Association, 1996/03
Free full text

5993

Osteopathy and medical evolution (1962)
Korr, I. M.
The AAO Journal, 1996/03
Free full text

5994

Sacral shear: Review and a new treatment for obstetrical patients
Treadwell, R. C., Magnus, W. W.
The AAO Journal, 1996/03
Free full text

5995

Update on osteopathic medical concepts and the lymphatic system
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 1996/02
Free full text

5996

Preliminary findings on the use of osteopathic manipulative treatment by osteopathic physicians
Fry, L. J.
The Journal of the American Osteopathic Association, 1996/02
Free full text

5997

When it comes to OMT, do we practice what we preach?
Kasovac, M.
The Journal of the American Osteopathic Association, 1996/02
Free full text

5998

The safety of manipulative treatment: review of the literature from 1925 to 1993
Vick, D. A., McKay, C., Zengerle, C. R.
The Journal of the American Osteopathic Association, 1996/02
Free full text

5999

Marketing key to increased women applicants to COMs
Payson, S. M.
The Journal of the American Osteopathic Association, 1996/01
Free full text

6000

(Manual therapy, chiropractic, osteopathy. From alternative therapy to medicine)
Ylinen, J., Piispanen, J., Silen, K., Airaksinen, O.
Duodecim, 1996/01

6001

AAO Case Study: Trigeminal Neuralgia
Coffey, D.
The AAO Journal, 1995/12
Free full text

6002

Manipulation of the Eustachian Tube
Heatherington, J. S.
The AAO Journal, 1995/12
Free full text

6003

Osteopathic GME consortia
Meyer, C. T., Mann, M. P.
Academic Medicine, 1995/11

6004

Osteopathic postdoctoral training institution: the osteopathic 'road map' to graduate medical education viability
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/11
Free full text

6005

Synergism strengthens osteopathic medical education programs
Allen, T. W.
Journal of Osteopathic Medicine, 1995/10
Free full text

6006

Female enrollment in colleges of osteopathic medicine: five years and five percentage points behind
Baker, H. H.
The Journal of the American Osteopathic Association, 1995/10
Free full text

6007

OMM Residency Training and Certification
Ettlinger, H., Pelkey, Z.
The AAO Journal, 1995/09
Free full text

6008

Osteopathic graduate medical education programs must be maintained
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/09
Free full text

6009

Hospital guidelines for diagnosis-related groups/osteopathic manipulative treatment
Feely, R. A.
The Journal of the American Osteopathic Association, 1995/09
Free full text

6010

Proposed matrix could yield bountiful 'harvest'
Stiles, E. G.
The Journal of the American Osteopathic Association, 1995/09
Free full text

6011

The Effect of Osteopathic Manipulative Treatment in the Post Abdominal Surgical Patient (A Preliminary Study)
Pratt-Harrington, D., Neptune-Ceran, R.
The AAO Journal, 1995/09
Free full text

6012

AAO Case Study: Demonstration of the Fundamental Tenent of Osteopathy
Stanley, S. A.
The AAO Journal, 1995/09
Free full text

6013

Phenobarbital-induced fibromyalgia as the cause of bilateral shoulder pain
Goldman, S. I., Krings, M. S.
The Journal of the American Osteopathic Association, 1995/08
Free full text

6014

Palpatory diagnosis and manipulative management of carpal tunnel syndrome: Part 2. 'Double crush' and thoracic outlet syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 1995/08
Free full text

6015

10,000 apply to osteopathic schools
Japsen, B.
Modern Healthcare, 1995/06

6016

Osteopathic graduate medical education: don't give up the ship--yet!
Meyer, C. T.
Journal of Osteopathic Medicine, 1995/06
Free full text

6017

A standardized form for DSM-IV review of symptoms and mental status examination for students and residents
Reeves, R. R., Bullen, J. A.
The Journal of the American Osteopathic Association, 1995/06
Free full text

6018

Performance of osteopathic medical school graduates on the American Osteopathic Board of Internal Medicine certifying examinations 1985 to 1994
Slick, G. L., Dolan, S., Draba, R. E.
The Journal of the American Osteopathic Association, 1995/06
Free full text

6019

AAO Case Study: Severe Left Hip Pain
Tenpenny, S. J.
The AAO Journal, 1995/06
Free full text

6020

The Experimental Method of Learning
Young, M. D.
The AAO Journal, 1995/06

6021

Nerve compression syndromes as models for research on osteopathic manipulative treatment
Luckenbill-Edds, L., Bechill, G. B.
The Journal of the American Osteopathic Association, 1995/05
Free full text

6022

Making sense of federal GME reforms: the need for secondary reforms
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/05
Free full text

6023

Making sense of federal GME reforms: the impact on osteopathic medicine
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/04
Free full text

6024

AAO Case Study: Chronic Upper Extremity Pain
DeFeo, G. A.
The AAO Journal, 1995/03
Free full text

6025

Time to abolish most osteopathic graduate medical education programs
Kienitz, R.
The Journal of the American Osteopathic Association, 1995/03
Free full text

6026

Postnatal back care
Parsons, C.
The Modern Midwife, 1995/02

6027

A model for improving generalist physician output: the osteopathic experience
Cummings, M., Ennis, M.
Academic Medicine, 1995/01
Free full text


6029

DOs who train in allopathic residency programs not 'disloyal'
Wogec, J.
The Journal of the American Osteopathic Association, 1994/12
Free full text

6030

A perspective from osteopathic medical schools
Arnstein, S. R., Haspel, L. U.
The Milbank Quarterly, 1994/12
Free full text

6031

AAO Case History: Immune System
Wallace, E. M.
The AAO Journal, 1994/12
Free full text

6032

Healthcare reform and practice choices: a survey of osteopathic medical students
Shubrook, J. H., Jr., Solomon, J. A., Ross-Lee
The Journal of the American Osteopathic Association, 1994/11
Free full text

6033

Osteopathic medical education adapts to a changing environment
Ward, W. D.
The Journal of the American Osteopathic Association, 1994/11
Free full text

6034

The danger of complacency
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/11
Free full text

6035

Colleges of Osteopathic Medicine
The Journal of the American Osteopathic Association, 1994/11
Free full text

6036

Membership of AOA Committees on Osteopathic Medical Education 1994-1995
The Journal of the American Osteopathic Association, 1994/11
Free full text

6037

Overview of financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1994/11
Free full text



6040

Management of the Cervical Area
Denslow, J. S.
The AAO Journal, 1994/09
Free full text

6041


6042

Results of the 1994 National Resident Matching Program: family practice
Kahn, N. B., Jr., Schmittling, G., Ostergaard, D. J., Graham
Family Medicine, 1994/09

6043

AAO Case Study: Sinusitis
Sept, K.
The AAO Journal, 1994/09
Free full text

6044

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text

6045

Palpatory diagnosis and manipulative management of carpal tunnel syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 1994/08
Free full text

6046

Effect of clerkship training at rural sites on students' clinical skills
Brandau, D., Heun, L.
Academic Medicine, 1994/08
Free full text

6047

The outlook for osteopathic medical specialists within a reformed healthcare system
Ross-Lee, B., Weiser, M. A., Kiss, L.
The Journal of the American Osteopathic Association, 1994/07
Free full text

6048

Osteopathic manipulation and injection therapy for low back pain
Orman, R.
American Family Physician, 1994/07

6049

The in-training examination in internal medicine
Garibaldi, R. A., Trontell, M. C., Waxman, H., Holbrook, J. H., Kanya, D. T., Khoshbin, S., Thompson, J., Casey, M., Subhiyah, R. G., Davidoff, F.
Annals of Internal Medicine, 1994/07

6050

Managed care and graduate medical education: mutual objectives, barriers, and prospects
Natkow, N., Fry, L. J.
The Journal of the American Osteopathic Association, 1994/07
Free full text

6051

Complexity of the healthcare crisis in rural America
Simpson, C., Simpson, M. A.
The Journal of the American Osteopathic Association, 1994/06
Free full text

6052

AAO Case History: Postpartum Facial Palsy
Lee, R. P.
The AAO Journal, 1994/06
Free full text

6053

You can be both conventional and nonconventional
Abend, D. S.
Archives of Family Medicine, 1994/06

6054

Stranger in a New Land
Mills, M.
The AAO Journal, 1994/06
Free full text

6055

Osteopathic principles underlie treatment of back pain
Moncman, M.G.
The Journal of the American Osteopathic Association, 1994/06
Free full text

6056

Specialty-oriented internships
Opipari, M. I.
The Journal of the American Osteopathic Association, 1994/06
Free full text

6057

Performance-based assessment of moral reasoning and ethical judgment among medical students
Smith, S. R., Balint, J. A., Krause, K. C., Moore-West, M., Viles, P. H.
Academic Medicine, 1994/05
Free full text

6058

DOs encouraged to participate in pharmaceutical, clinical trials
Allen, T. W.
The Journal of the American Osteopathic Association, 1994/05
Free full text

6059

More suggested changes to osteopathic medical curriculum
Clark, R. C.
The Journal of the American Osteopathic Association, 1994/05
Free full text

6060

'Parallel and distinctive': the philosophic pathway for reform in osteopathic medical education
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/04
Free full text

6061

Dark period in history of osteopathic medicine revisited
Frymann, V. M.
The Journal of the American Osteopathic Association, 1994/04
Free full text

6062

Preparing the osteopathic academic health centers for healthcare reform
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/04
Free full text

6063

Performance of candidates on the American Osteopathic Board of Internal Medicine subspecialty certifying examinations 1984-1992
Slick, G. L.
The Journal of the American Osteopathic Association, 1994/03
Free full text

6064

Opportunities and Issues for Osteopathic Hospitals
The AAO Journal, 1994/03
Free full text

6065

Manual Medicine and its Role in Psychiatry
Osborn, G. G.
The AAO Journal, 1994/03
Free full text

6066

Outcome Data for Patients Experiencing Chronic Pain
Stiles, E. G.
The AAO Journal, 1994/03
Free full text

6067

Osteopathy – How It Differs from Other Manual Methods
Woodall, P. H.
The AAO Journal, 1994/03
Free full text

6068

Effects of adding sacral base leveling to osteopathic manipulative treatment of back pain: a pilot study
Hoffman, K. S., Hoffman, L. L.
The Journal of the American Osteopathic Association, 1994/03
Free full text

6069

Revamp primary care programs to include psychiatry training
Magen, J. G.
The Journal of the American Osteopathic Association, 1994/03
Free full text

6070

Managed care: an opportunity for osteopathic physicians
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/02
Free full text

6071

Effects of osteopathic manipulative treatment in patients with cervicothoracic pain: pilot study using thermography
Walko, E. J., Janouschek, C.
The Journal of the American Osteopathic Association, 1994/02
Free full text

6072

Clarifying number of DOs in allopathic residency programs
Sprafka, S.
The Journal of the American Osteopathic Association, 1994/01
Free full text

6073

Osteopathic manipulative treatment: what does it really do?
Steiner, C.
The Journal of the American Osteopathic Association, 1994/01
Free full text

6074

A strategy for the future success of osteopathic medicine
Wax, C. M.
The Journal of the American Osteopathic Association, 1994/01
Free full text

6075

The primary medicine initiative--continuity in medical education
Wood, D. L.
The Journal of the American Osteopathic Association, 1994/01
Free full text

6076

Osteopathic manipulation for lumbar disk disease
Pearson, R. H.
American Family Physician, 1994/01

6077

Readers respond to 'osteopathic physician' identity
Rentz, L. E., Goldstein, M.
The Journal of the American Osteopathic Association, 1994/01
Free full text

6078

Debate continues on the call to reform the profession
Terry, R. R., Comeaux, Z., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text

6079

The osteopathic distinction: fact or fancy?
Peppin, J. F.
The Journal of Medical Humanities, 1993/12

6080

Crafting effective internal memos
Baker, H. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text

6081

Response: Debate continues on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/12
Free full text

6082

Focused goals of osteopathic medical education achieve results
Ward, W. D.
The Journal of the American Osteopathic Association, 1993/11
Free full text

6083

Osteopathic manipulation and tension-type headaches
Baird, R. E., Cullom, S., Deedman, R., Feeney, J., Kellogg, J., Simning, P., Stevens, M. B.
American Family Physician, 1993/11

6084

No 'paradigm shift' needed at COMs
Richwine, W. B., Papa, F. J.
The Journal of the American Osteopathic Association, 1993/11
Free full text

6085

Important characteristics of a director of medical education
Powell, V. D., Jr., George
The Journal of the American Osteopathic Association, 1993/11
Free full text

6086

Financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1993/11
Free full text

6087

An MD's note to his osteopathic medical students
Friedlander, E. R.
The Journal of the American Osteopathic Association, 1993/10
Free full text

6088

Do medical students' knowledge and attitudes about health and exercise affect their physical fitness?
Liang, M. T., Dombrowski, H. T., Allen, T. W., Chang, C. O., Andriulli, J., Bastianelli, M., Davina, E., Norris, S. D.
The Journal of the American Osteopathic Association, 1993/10
Free full text

6089

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text

6090

Lifestyle changes associated with osteopathic medical education
Crapse, F. J., Jr., Hudgins, P. M., Baker
The Journal of the American Osteopathic Association, 1993/10
Free full text

6091

Promoting the health and fitness of osteopathic medical students
Licciardone, J. C.
The Journal of the American Osteopathic Association, 1993/10
Free full text

6092

More comments on the call to reform the profession
McPartland, J. M., Pulsipher, D. W., Cope, M. K., Wagenknecht, D. A.
The Journal of the American Osteopathic Association, 1993/10
Free full text

6093

Response: More comments on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/10
Free full text

6094

Primary care DOs, specialists--and OMM--important to profession
Wax, C. M.
The Journal of the American Osteopathic Association, 1993/09
Free full text

6095

AAO Case History
Somner, L.
The AAO Journal, 1993/09
Free full text

6096

'Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/09
Free full text

6097


6098

Osteopathy vs chiropractic
Friedman, H.
The Journal of Family Practice, 1993/09
Free full text

6099

Teaching residents to write a research paper
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1993/09
Free full text

6100

OMT enhances any medical regimen
Keller, J. A.
The Journal of the American Osteopathic Association, 1993/09
Free full text


6102

The HIV-infected house officer: residency training issues
Fernandez, E. S., Troutman, H. T., Herbert, B., Condoluci, D. V.
The Journal of the American Osteopathic Association, 1993/08
Free full text

6103

Readers offer suggestions for reforms in osteopathic medicine
Rosenblum, J.
The Journal of the American Osteopathic Association, 1993/08
Free full text

6104


6105

Another view of the “crisis“ in osteopathic medicine
Baker, H. H.
Academic Medicine, 1993/07
Free full text

6106

Complementary medicine. Who prescribes these treatments and when?
Ernst, E.
British Medical Journal, 1993/07
Free full text

6107

Helping-not hurting--residents with substance use disorders
Sells, K. W., Gorby, W. G.
The Journal of the American Osteopathic Association, 1993/06
Free full text

6108

'Blueprint' for creating classroom facilities in teaching hospitals
Hayes, O. W.
The Journal of the American Osteopathic Association, 1993/06
Free full text

6109

Investigating the role of osteopathic manipulation in the treatment of asthma
Allen, T. W., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 1993/06
Free full text


6111


6112

Research important to education--and society
Retz, K. C.
The Journal of the American Osteopathic Association, 1993/05
Free full text

6113

Arranging affiliation agreements and outside rotations
Willard, R. L.
The Journal of the American Osteopathic Association, 1993/04
Free full text

6114

Osteopathy, chiropractic, and spinal manipulation
Morehouse, M.
Annals of Internal Medicine, 1993/04

6115

Osteopathic medicine: a call for reform
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/04
Free full text

6116

Lower Back Pain In An Elderly Patient With Complicated History
Buser, B. R.
The AAO Journal, 1993/03
Free full text


6118

Integrating OMT Into The Hospital Setting
Jones, L. B.
The AAO Journal, 1993/03
Free full text

6119

Outcomes assessment: 'buzz words' in medical education whose time has come
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/03
Free full text

6120

Primary & Secondary Respiration – Part II
Lee, R. P.
The AAO Journal, 1993/03
Free full text

6121

Assessing outcomes of the educational program of the West Virginia School of Osteopathic Medicine
Cope, M. K., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text

6122

Panic Attack – Another View
Wright, H. O. L.
The AAO Journal, 1993/03
Free full text

6123

Procedures to follow when dismissing an intern or resident
Opipari, M., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text

6124

An approach to training and retaining primary care physicians in rural Appalachia
Roberts, A., Foster, R., Dennis, M., Davis, L., Wells, J., Bodemuller, M. F., Bailey, C. A.
Academic Medicine, 1993/02
Free full text

6125

Managing substance use disorders in resident physicians
Benzer, D. G.
The Journal of the American Osteopathic Association, 1993/02
Free full text

6126

Clinical teaching in the ambulatory care setting: how to capture the teachable moment
Bowling, J. R.
The Journal of the American Osteopathic Association, 1993/02
Free full text

6127

Progress in scientifically proving the benefits of OMT in treating symptoms of dysmenorrhea
Chapman, J. D.
The Journal of the American Osteopathic Association, 1993/02
Free full text

6128

Manual force, mechanically assisted articular chiropractic technique using long and/or short level contacts
Bergmann, T. F.
Journal of Manipulative and Physiological Therapeutics, 1993/01



6131

Integrate osteopathic principles and practices in postgraduate medical education--now
Kasovac, M., Jones, J. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text

6132

Anatomy, Asthma and Dysautonomia
Sanders, E. C.
The AAO Journal, 1992/12
Free full text

6133

With a look at the past, osteopathic medical education heads into its second century
Ward, D.
The Journal of the American Osteopathic Association, 1992/11
Free full text

6134

Four approaches to using patients to teach and evaluate clinical skills of residents, interns, and students
Medio, F. J., Morewitz, S. J.
The Journal of the American Osteopathic Association, 1992/11
Free full text

6135

Voices From the Future: what students, interns, and residents want from osteopathic graduate medical training
Kushner, D., Cooney, J.
The Journal of the American Osteopathic Association, 1992/10
Free full text

6136

Heed 'Voices From the Future' and reform GME training
Meyer, C. T.
The Journal of the American Osteopathic Association, 1992/10
Free full text

6137

From the AOBSPOMM Files
Feely, R. A.
The AAO Journal, 1992/09
Free full text


6139

Teaching the process of obtaining informed consent to medical students
Johnson, S. M., Kurtz, M. E., Tomlinson, T., Fleck, L.
Academic Medicine, 1992/09

6140

Strategy for Addressing Third Party Payors on OMT
O'Connell, J. A.
The AAO Journal, 1992/09
Free full text

6141

Challenge to osteopathic education. Returning to its primary care roots
Cummings, M.
JAMA: The Journal of the American Medical Association, 1992/09

6142

Graduate medical education
JAMA: The Journal of the American Medical Association, 1992/09

6143

Kudos to Dr Frymann and colleagues
Morey, L. W.
The Journal of the American Osteopathic Association, 1992/09
Free full text

6144

Reorganizing 'traditional' case presentation enhances learning, clinical experience
Russell, B., Penney, C. W.
The Journal of the American Osteopathic Association, 1992/08
Free full text

6145

Suggestions for clinicians providing--and residents seeking--feedback
Sprafka, S.
The Journal of the American Osteopathic Association, 1992/08
Free full text

6146

A Patient With Bilateral Shoulder Pain
Buser, B. R.
The AAO Journal, 1992/06
Free full text

6147

Is Osteopathic Education Ready For Its Next Century?
Corbett, S. R.
The AAO Journal, 1992/06
Free full text

6148

College of Podiatric Medicine and Surgery in Des Moines
Tomczak, R. L.
Journal of the American Podiatric Medical Association, 1992/06
Free full text

6149

Somatic Dysfunction: A Neurophysiologic & Osteopathic Overview
Tsompanidis, A. J.
The AAO Journal, 1992/06
Free full text

6150

Rheumatoid Arthritis: The Incurable Disease?
Wright, H. O. L.
The AAO Journal, 1992/06
Free full text

6151

Effect of osteopathic medical management on neurologic development in children
Frymann, V. M., Carney, R. E., Springall, P.
The Journal of the American Osteopathic Association, 1992/06
Free full text

6152

Guidelines for designing resident rating forms
Gugelchuk, G. M., Daum, S. G.
The Journal of the American Osteopathic Association, 1992/06
Free full text

6153

HIV clinical training enhances DOs skills in the fight against AIDS
Macher, A. M., Fernandez, E. S., Rivo, M. L., Mullan, F.
The Journal of the American Osteopathic Association, 1992/06
Free full text

6154

Recruiting interns and residents to an osteopathic medical training program
Slick, G. L.
The Journal of the American Osteopathic Association, 1992/05
Free full text

6155

Revamped osteopathic hospital group flourishing
Burda, D.
Modern Healthcare, 1992/05

6156

Training osteopathic medical students in behavioral medicine and psychiatry
Magen, J.
The Journal of the American Osteopathic Association, 1992/05
Free full text

6157

'Loopholes' weaken hospital accreditation policy
Horspool, J. C.
The Journal of the American Osteopathic Association, 1992/04
Free full text

6158

The medical education system in Oklahoma
Lapolla, M., Duffy, D., Lewis, C. S.
The Journal of the Oklahoma State Medical Association, 1992/03


6160

The Patient Who Wouldn't Give Up
Wright, H. O. L.
The AAO Journal, 1992/03
Free full text

6161

Osteopathy & Chronic Pain
Miller, T. D.
The AAO Journal, 1992/03
Free full text

6162

Case presentation as a teaching tool: making a good thing better
Brose, J. A.
The Journal of the American Osteopathic Association, 1992/03
Free full text

6163

The physical fitness of first-year osteopathic medical students
Licciardone, J. C., Hagan, R. D.
The Journal of the American Osteopathic Association, 1992/03
Free full text

6164

'Blueprint' for designing a curriculum for intern and residency programs
Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 1992/02
Free full text

6165

A curriculum database with boolean natural-language searching in HyperCard
Mann, D., Goodrum, K., DeWine, J. M., McVicker, J.
Proceedings Annual Symposium on Computer Application in Medical Care, 1992/01
Free full text

6166

New HIV series helps to define osteopathic physicians' role in AIDS epidemic
Calabrese, L. H.
The Journal of the American Osteopathic Association, 1992/01
Free full text

6167

A Disease Which No Longer Exists
Wright, H. O. L.
The AAO Journal, 1991/12
Free full text

6168

Alternative and complementary medicine for asthma
Lane, D. J., Lane, T. V.
Thorax, 1991/11
Free full text

6169

Superlatives and concerns in osteopathic medical education
Baker, H. H.
The Journal of the American Osteopathic Association, 1991/11
Free full text

6170

Incorporating OMT in hospital training
Cooper, G. J.
The Journal of the American Osteopathic Association, 1991/11
Free full text


6172

US osteopathic medical school finances
Reich, M. M.
The Journal of the American Osteopathic Association, 1991/11
Free full text

6173

Pathophysiologic Models: Aids to the Selection of Manipulative Techniques
Hruby, R. J.
The AAO Journal, 1991/09
Free full text

6174

Who Will Hatch Our Students?
Morey, L.
The AAO Journal, 1991/09
Free full text

6175

Osteopathic vs. chiropractic education: a student perspective
McNamee, K. P., Magarian, K., Phillips, R. B., Greenman, P. E.
Journal of Manipulative and Physiological Therapeutics, 1991/09

6176

A proposal to modify research and scholarly activities during osteopathic residency training
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1991/09
Free full text

6177

Cystic Fibrosis and a Victory for Osteopathic Methods: A Case History
Wright, H. O. L.
The AAO Journal, 1991/09
Free full text

6178

Osteopathic interns' attitudes toward their education and training
Shlapentokh, V., O'Donnell, N., Grey, M. B.
The Journal of the American Osteopathic Association, 1991/08
Free full text

6179

Bias in medical education? Take my word for it!
Schulte, J.
Medical Economics, 1991/08

6180

Selected characteristics of graduate medical education in the United States
Rowley, B. D., Baldwin, D. C., Jr., McGuire
JAMA: The Journal of the American Medical Association, 1991/08

6181

Osteopathic medical educators should heed lesson from interns
Johnston, W. L.
The Journal of the American Osteopathic Association, 1991/08
Free full text

6182

Osteopathic principles and practices: maintaining a vital link in osteopathic education
Kappler, R. E.
The Journal of the American Osteopathic Association, 1991/07
Free full text

6183

Insanity or Hypoglycemia?
Wright, H. O. L.
The AAO Journal, 1991/06
Free full text

6184

Who should teach osteopathic manipulative medicine?
Lo, K. S.
The Journal of the American Osteopathic Association, 1991/03
Free full text

6185

Not every DO masters the art of manipulation
Obarski, T. P.
The Journal of the American Osteopathic Association, 1991/03
Free full text

6186

To manipulate or not to manipulate, that is the question
Padgett, D. K.
The Journal of the American Osteopathic Association, 1991/03
Free full text

6187

Evaluation of videodisc modules: a mixed method approach
Parkhurst, P. E., Lovell, K. L., Sprafka, S. A., Hodgins, M.
Proceedings Annual Symposium on Computer Application in Medical Care, 1991/02
Free full text

6188

Osteopathic research: the needed paradigm shift
Korr, I. M.
The Journal of the American Osteopathic Association, 1991/02
Free full text

6189

Our osteopathic uniqueness needs nurturing
Kuchera, W. A.
The Journal of the American Osteopathic Association, 1991/02
Free full text

6190


6191

Osteopathic medicine
Eaton, J. A., Bates, B. P., Willard, F. H.
Orthopaedic Nursing, 1991/01
Free full text




6195

Do real DOs practice manipulation?
Cole, T. J.
The Journal of the American Osteopathic Association, 1990/12
Free full text


6197

Osteopathic postdoctoral education
Baker, H. H., Wachtler, J.
The Journal of the American Osteopathic Association, 1990/11
Free full text

6198

Research programs of the AOA and their role in osteopathic education
Retz, K. C.
The Journal of the American Osteopathic Association, 1990/11
Free full text

6199

Practicing what we teach: integrating osteopathic principles into practice
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/10
Free full text

6200

Politics cloud state of osteopathic medical residency programs
Donovan, P. J.
The Journal of the American Osteopathic Association, 1990/10
Free full text

6201

Osteopathic medicine: the profession's role in society
Korr, I. M.
The Journal of the American Osteopathic Association, 1990/09
Free full text

6202

Allopathic residencies: current and former residents' viewpoints
Baron, M., Karp, S. J., Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/09
Free full text

6203

Commenting on L-tryptophan and osteopathic physicians in allopathic residencies
Davis, F. E.
The Journal of the American Osteopathic Association, 1990/09
Free full text


6205

Searching for clues to the origins of OMT
Beatty, D. R.
The Journal of the American Osteopathic Association, 1990/08
Free full text

6206

Development of an Expert System to Teach Diagnostic Skills
Elieson, S. W.
Unpublished PhD thesis, 1990/08
Free full text

6207

Time to reemphasize OMT as stress reliever
Northup, G. W.
The Journal of the American Osteopathic Association, 1990/08
Free full text

6208

Louisa Burns memorial lecture: research in residencies
Belsky, D. H.
The Journal of the American Osteopathic Association, 1990/07
Free full text

6209

The effect of helium-neon laser and osteopathic manipulation on soft-tissue trigger points
Greene, C. H., DeBias, D. A., Helig, D., Nicholas, A. S., England, K., Ehrenfeuchter, W., Young, W. L.
The Journal of the American Osteopathic Association, 1990/07
Free full text

6210

How effectively are osteopathic medical students coping with a stressful life-style?
Kurtz, M. E., Paulsen, R. D., Ferguson, D.
The Journal of the American Osteopathic Association, 1990/07
Free full text

6211

Time to change GPs' ID
Felder, M.
The Journal of the American Osteopathic Association, 1990/06

6212

Factors influencing osteopathic physicians' decisions to enroll in allopathic residency programs
Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/06

6213

An open controlled assessment of osteopathic manipulation in nonspecific low-back pain
MacDonald, R. S., Bell, C. M. J.
Spine (Phila Pa 1976.), 1990/05


6215

Quality assurance monitoring of osteopathic manipulative treatment
Koss, R. W.
The Journal of the American Osteopathic Association, 1990/05
Free full text

6216

The Century Club: a model for staff-supported medical education
Meyer, C. T.
The Journal of the American Osteopathic Association, 1990/05
Free full text

6217

The pull toward the vacuum: osteopathic medical education in the 1980s
Cummings, M.
The Journal of the American Osteopathic Association, 1990/04
Free full text

6218

A second opinion on geriatric training programs
Toffol, G. J., Schultz, D. R., Root, K. E., Weintraub, J. R.
The Journal of the American Osteopathic Association, 1990/03
Free full text

6219

General practice residency training and the osteopathic profession: trends and issues for the 1990s
Aquilina, A. D.
The Journal of the American Osteopathic Association, 1990/02
Free full text


6221

An integrated osteopathic treatment approach in acute otitis media
Pintal, W. J., Kurtz, M. E.
The Journal of the American Osteopathic Association, 1989/09
Free full text





6226

The orientations of medical students to osteopathic medicine
Aho, W. R.
Unpublished PhD thesis, 1970/01

6227

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12

6228

Pain Management Across Special Populations: Pediatrics, Geriatrics, and Pregnancy
Poliak-Tunis, M., Khakhkhar, S., Ayres, B.
Physical Medicine and Rehabilitation Clinics


 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends