Advanced search



 
 80.2% of the records
 
 19.8 % of the records
 
 57.9 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal hemodynamic maneuverabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabdominopelvic regionabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic detailingacademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute careacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute generalized exanthematous pustulosisacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadherenceadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadversityadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimers diseaseAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangiogramangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior scaleneanterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic enlargementaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial rulearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrographyarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical diabetesatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybicuspid aortic valvebifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanical responsebiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipartate patellabipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblackblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringblistersbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood oxygen saturationblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasebone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone metastasisbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachiocephalic vesselsbrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous emphysemabullous lesionsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcar accidentcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac apex anglecardiac arrestcardiac cirrhosiscardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabiliationcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCBTCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectionCECScecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular accidentcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic exertional compartment syndromechronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic orchialgiachronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccidioidomycosiscoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive latencycognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecold therapycold water exposurecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscolostomycomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconference registrationconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantscryotherapyCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademodex folliculitisdemographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentoalveolar systemdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic ketoacidosisdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary habitsdietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscolorationdiscontinued trialsdiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisembarkment syndromedisengagement-techniquedisinfectiondisinfection protocoldisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal kyphosisdorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug approvaldrug combinationdrug industrydrug legislationdrug prescriptionsdrug reactiondrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenal perforationduodenojejunal junctionduodenumdupilumabduplex scanningDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadysrhythmiadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaeczema herpeticumedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRejection fractionelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiogramselectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendoscopyendothelial dysfunctionendothelial functionendovascular retrievalenduranceendurance sportsenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophiliaeosinophilic fasciitiseosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal auditory canal exostosisexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubationextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyelidseyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfaceface masksfacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial neuropathyfacial painfacial paralysisfacial structurefacial swellingfacial tapingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfebrile neutrophilic dermatosisfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow rateflu testingfluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood attitudesfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenforamen magnumFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiant cell arteritisgiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonadal veingonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgoutgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegritgroingroin injurygroin paingroove signgross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth failuregrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaglund deformityhair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhand surgeryhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth motivationhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionalhealth professionalshealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemochromatosishemodialysishemodynamichemodynamic controlhemodynamicshemoglobinhemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehereditary spherocytosisHermansky-Pudlak syndromehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanicHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghorseshospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxemiahypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincident painincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury recoveryinjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinstrumentationinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview selectioninterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintimate partner violenceintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischemic strokeischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseisotretinoinITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. BockJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournal policyjournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansaskaposi varicelliform eruptionKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney diseasekidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage disorderslanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngeal cancerlaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTlead exposureleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukodermaleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelichen planus pigmentosus inversuslidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung cancerlung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmaltreatmentmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmaskmask mandatemasksMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMay-Thurner syndromeMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedical writingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetatarsophalangeal jointmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrosurgerymicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle scalenemiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal change diseaseminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymitral valve prolapsemix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonoclonal antibodiesmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular latencyneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnevus spilusnevus unius lateralisnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluonchocerciasisoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisonyxopen arteryopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen oval windowopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid usageopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan mobilityorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational behaviororganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic exerciseosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen supplyoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillary fibroelastomapapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepatent ductus arteriosuspatent foramen ovalepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatient-reported outcomespatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer recoverypeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceived weightperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferencepercutaneous coronary interventionperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericarditispericardiumperichondritisperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languageperson-first languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepolitical advocacypoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepositivismpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cortical atrophyposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprehabilitationprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature epiphyseal closurepremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbycusispresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional sportsprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurigo nodularisprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric distresspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary abscesspulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSpyoderma gangrenosumQ angleq-testQEEGqi gongqigongQLQ-C30qtc intervalquackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesracismradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrashrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreaction timereactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundrealismreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared blood cellsred flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulationsregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of liferiverboardingRL1-803rlq painRLSRobert Fulfordrobotic surgeryroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff intervalrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsscent detectionscent dogsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerodermasclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescrambler therapyscreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch interestsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-harmself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsseroprevalenceserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice dogsservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36SGLT2 inhibitorsshadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortageshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromeShulman syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin rashskin temperatureskin testsskin toneskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialtyspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatic cordspermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervespinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainsspringing techniquesprintsprintingSQOR-V questionnainnairesquamous cell carcinomasquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysterilizationsternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain injurystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous emphysemasubcutaneous hemorrhagesubjective cognitive declinesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital muscle inhibition techniquesuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden cardiac deathsudden infant death syndromeSudeck syndromeSufismsugarsuicidal ideationsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial heatsuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperior vena cava syndromesuperoxide anion radicalssupervised exercisesupervised injection sitessupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgSweets syndromeswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandswollen earsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic inertiatherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic surgerythoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthromboembolismthrombolytic therapythrombosisthrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocilizumabtocilizumab therapytocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatracheobronchial casttrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment algorithmstreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment tacticstreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrial qualitytrialstriamcinolone acetonidetriathletestribal healthcaretrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUgandaUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract diseaseurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccination statusvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvalvular heart diseasevancomycinvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular physiologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena cava filtervena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitamin deficienciesvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noisewhitewater kayakingWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework hourswork schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysxeroderma pigmentosumyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

2054 results (please see below)  Sort:    
1

Interexaminer reliability studies: spanning a gap in medical research--Louisa Burns Memorial Lecture
Johnston, W. L.
The Journal of the American Osteopathic Association, Aug
2

Umsetzung osteopathischer Prinzipien in der Ausbildung
Weyland, K.
DO - Deutsche Zeitschrift für Osteopathie, 2026/03
3

Placebo-Effekte in der Osteopathie und anderen manuellen Therapien – Teil 2: Bedeutung für die klinische Praxis, Ausbildung und Forschung
(Placebo effects in osteopathy and other manual therapies – Part 2: Significance for clinical practice, training, and research)
Hohenschurz-Schmidt, D., Liem, T.
Osteopathische Medizin, 2026/03
4

Incorporation of virtual reality into medical physiology
Benmerzouga, I., Oviawe, E.
Advances in Physiology Education, 2026/03
Free full text
5

Perspectives of Anatomy Education Among Osteopathic Medical Students: A Cross-Sectional Survey
Heins, R. J., Mindrup, M., Hemaya, J., Sloan, S. S.
Cureus, 2026/03
Free full text
6

Shifting Focus: An Advocacy-Focused Analysis of Omega Beta Iota’s Membership and Political Engagement Strategies
Rashid, M. F., Rizvi, S. A.
Cureus, 2026/03
Free full text
7

Exploring the utility of ChatGPT as a learning tool in osteopathic medical education
Martin, P., Pate, N., Benmerzouga, I.
International Journal of Osteopathic Medicine, 2026/03
8

Methodological considerations for evaluating ChatGPT as a learning tool in osteopathic medical education
Saripudin, M., Hamdan, A. H., Asiah, N.
International Journal of Osteopathic Medicine, 2026/03
9

Artificial Intelligence in Osteopathy Education: A Critical Analysis of Educators' and Researchers' Perspectives
Suherman, U., Ulfah, Krinanda, V. D., Suhardita, K., Saputra, R., Putra
International Journal of Osteopathic Medicine, 2026/03
10

Revolutionizing Osteopathic Education: Integrating ChatGPT and Virtual Reality for Immersive Learning
Wahyudin, H., Oktasari, M., Megawati, M., Mufarida, H., Elviana, E., Kuswandi, A.
International Journal of Osteopathic Medicine, 2026/03
11

Regarding “Where are the Black men in osteopathic medical schools?”
Bohler, F., Garden, A. R.
Journal of Osteopathic Medicine, 2026/03
Free full text
12

Addressing physician shortage in medically underserved rural and tribal communities through residency program collaboration
Bray, N. N., Raischel, M., McGuire, D., Newhardt, R., Nolan, D., Snyder, T., Som, M., VanVolkinburg, L., Landgraf, C., Wheeler, D.
Journal of Osteopathic Medicine, 2026/03
Free full text
13

Conceptualizing osteopathic medical professionalism: an institutional self-assessment rubric for colleges of osteopathic medicine
Fleming, R. K., Jones, A. C., Shelnutt, M., Slieman, T. A., White, S., Williams, B. R.
Journal of Osteopathic Medicine, 2026/03
Free full text
14

Response to: Regarding “Where are the Black men in osteopathic medical schools?”
Megafu, M.
Journal of Osteopathic Medicine, 2026/03
Free full text
15

Different letters, same results: a comparison of milestones among US allopathic and osteopathic residents
Langhan, M. L., Ngo, T. L., Yamazaki, K., Nesiama, J.A. O., Pence, L., Hogan, S. O.
Journal of Osteopathic Medicine, 2026/02
Free full text
16

Evaluating Laparoscopic Simulation Training for Preclinical Osteopathic Medical Students
Muchard, R. D., Jacobsen, N. D., Sypula, T., Longley, S., Hurrinus, N., Barefield, N. S., Patel, P. G.
Cureus, 2026/02
Free full text
17

Impact of the Council of State Neurosurgical Societies (CSNS) Fellowship on the Development of Neurosurgical Careers: A Retrospective Study
Rawson, C., Tenhoeve, S., Oladipo, O., Carter, A., Bauer, S., Lucke-Wold, B., Benzil, D., Adogwa, O., Sharma, A., Karsy, M.
Cureus, 2026/02
Free full text
18

Challenging hierarchies and fostering collaboration: a critical discourse analysis of interprofessional education in healthcare training
Zorda, E. M., Sargent, M. A., Gose, C. E., Becker, M. T., Garber, S. S., DePrimo, A., Batteson, T.
Journal of Osteopathic Medicine, 2026/02
Free full text
19

Identifying risk factors for burnout and self-harm thoughts among medical students: a multi-institutional survey study
Eddy, A. J., Bray, N. N., Place, A. J.
Journal of Osteopathic Medicine, 2026/02
Free full text
20

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2026/01
21

Effects of the allopathic and osteopathic graduate medical education merger on U.S. specialty training: a review
Ibrahim, S., Abdelhady, M., Venckus, J., North, C., Bohler, F.
Medical Education Online, 2026/01
Free full text
22

Race, ethnicity, and gender discrepancies between allopathic and osteopathic otolaryngology trainees from 2015 to 2023
Minutello, K. M., Nicks, S. L., Gillette, B. T., Hasan, S., Shermetaro, C. B.
Journal of Osteopathic Medicine, 2026/01
Free full text
23

Effect of COMLEX-USA Level 1 pass/fail score reporting on student stress, test preparation, and performance
Jin, R., Sandella, J. M., Gross, G. A., Dawley, M., Boulet, J., Mao, X., Wang, Y.
Journal of Osteopathic Medicine, 2026/01
Free full text
24

Allopathic resident prevalence in orthopedic residency programs formerly accredited by the American Osteopathic Association during single accreditation
Murray, J. B., Balazs, G. C., Speicher, M. R., Olsen, A. A.
Journal of Osteopathic Medicine, 2026/01
Free full text
25

Development, implementation, and evaluation of interprofessional events on climate change in health professions curricula
Ly, K., Cariddi, A., Cote, M., Hall, K.
Frontiers in Medicine, 2026/01
Free full text
26

Graduate Degree Holders in the U.S. Residency Match: Trends and Outcomes (2016-2024)
Barron, D. W., Yu, H., Pendse, R. S., Barzee, B. M., Rappaport, D. E.
Journal of Medical Education and Curricular Development, 2026/01
Free full text
27

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/12
Free full text
28

Palpation and its learning: A professionalization approach to acquiring a complex skill
Rosenzweig, F., Feruglio, R., Marin, T.
International Journal of Osteopathic Medicine, 2025/12
29

Analysis of hepatitis B immunity in vaccinated medical students
Gentile, N., Aghera, C., Smith, H., Mazzoleni, S., Redden, D., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2025/12
Free full text
30

Is Research Fun? A Survey of Osteopathic Medical Students
Amendolara, A., Homan, M., Thorpe, L., Payne, A., Stacey, S. K., Small, C.
Journal of Osteopathic Medicine, 2025/12
31

Evaluating the Accuracy and Educational Utility of ChatGPT in Osteopathic Manipulative Medicine (OMM) and Treatment (OMT): A Cross-Sectional Performance Study
Babar, M., Arain, A., Jordan, R., Badeuax, M., Voth, S.
Journal of Osteopathic Medicine, 2025/12
32

Analyzing Medical Student Knowledge Regarding Nutrition
Barros, M., Weir, S.B., Bennett, A.
Journal of Osteopathic Medicine, 2025/12
33

Addressing Chronic Disease Burden and Healthcare Access Gaps in People Experiencing Homelessness: A Community-Based Study Through Osteopathic Medical Student-Led Interventions in Detroit
Figueroa, K., Nallabelli, N., Abu-Zama, A., Bryce, R., Restini, C.
Journal of Osteopathic Medicine, 2025/12
34

Evaluating Artificial Intelligence’s Accuracy in Identifying Anatomical Structures on Cadavers: Implications for Osteopathic Medical Education
Gray, J.
Journal of Osteopathic Medicine, 2025/12
35

Characterization and comparison of osteopathic medical student performance in pathology and laboratory medicine: an analysis of competency in an integrated organ-systems curriculum
Harp, E., Hughes, G.
Journal of Osteopathic Medicine, 2025/12
36

Enhancing Transitional Support for First-Year Medical Students: An Osteopathic, Student-Centered Perspective
Hartman, T., Pookkattu, M., Dearden, S., Venkataraman, V.
Journal of Osteopathic Medicine, 2025/12
37

Wie geht Beruf? – Teil 1: Gesetzgebungsverfahren, Heilberufe und Status quo der Osteopathie in Deutschland
(How does the profession work? – Part 1: Legislative process, healthcare professions, and the status quo of osteopathy in Germany)
Newiger, C.
Osteopathische Medizin, 2025/12
38

Bridging Communication Gaps: Exploring Medical Students’ Understanding and Experiences in Caring for Patients with Hearing Impairments and Language Barriers
Kim, A., Nolin, J. R., Bracy, H., Berko, H., Mazzorana, A., Leiber, K., Hernandez, E.
Journal of Osteopathic Medicine, 2025/12
39

Osteopathic Medical Students’ Perspectives on Osteopathic Manipulative Therapy during Third- Year Clerkships: A Cross-sectional Study of Three Osteopathic Medical Schools
Longley, S., Spears, E., Domingo, F. S., Kymes, E., Dixon, C., Weir, S.B.
Journal of Osteopathic Medicine, 2025/12
40

Evaluating Student Mental Health Resource Utilization and Self-Perceived Mental Health
Muppala, M. S., Sanapala, C., Shields, E., Kemp, E., Goldsteen, R., Tano, S., Grewal, P.
Journal of Osteopathic Medicine, 2025/12
41

Bridging the Gap: A Tri-campus Survey on Student Confidence in Applying OMT in Neurological Conditions
Nallanukala, G. S., Noto-Bell, L., Nallanukala, V.
Journal of Osteopathic Medicine, 2025/12
42

Pushing into the Barrier: Investigating the Use of OMM Among 3rd and 4th Year Medical Students
Pirzadeh, N., Dona, C. G., Valencia, R., Anche, G., Liang, W. M., Chen, D., Para, R., Volokitin, M.
Journal of Osteopathic Medicine, 2025/12
43

The Escape Room Experience – A Novel Learning Modality to Reinforce Team-based Problem Solving, Communicating under Stress, and Tapping Group Knowledge Among “Trapped” Preclinical Osteopathic Medical Students
Renner, T., Imwalle, S., Cain, T. J.
Journal of Osteopathic Medicine, 2025/12
44

Zink’s Fascial Patterns Among First- and Second-Year Medical Students
Rutt, G., Graham, M., Boesler, D.
Journal of Osteopathic Medicine, 2025/12
45

D.O. Podcast Increases Pre-Medical Student Knowledge and Attitudes Toward Osteopathic Medicine
Sullivan, V. E., D'Amelio, M. P., Storch, I. M., van Rooyen, D. R., Storch, N. C., Callaway, C. A., Pierce-Talsma, S. L., Hauler, J. J.
Journal of Osteopathic Medicine, 2025/12
46

Osteopathic Medical Education and Treatment: Changes in Perspective Through the Lens of Standardized Patients
Thompson, T. R., Craun, W. D., Strickland Creech, T., Parks, J. M., Nolin, J. R.
Journal of Osteopathic Medicine, 2025/12
47

The Impact of Preclinical Curriculum Based Serving-Learning on Osteopathic Medical Students’ Understanding of the Social Determinants of Health
Touma, O., Lacaze, M.
Journal of Osteopathic Medicine, 2025/12
48

Perceptions of Campus Climate and Inclusivity Among LGBTQIA+ Osteopathic Medical Students: A Cross-Sectional Study
Varin, P., Temucin, S., Reese, A., Florescu, N., Grace, C., Bettiker, R., Sonneville, K., Fiscus, V., Tanaka, L.A.
Journal of Osteopathic Medicine, 2025/12
49

Factors Affecting Medical Student Participation in Student Evaluations of Teaching: A Retrospective Study
Walker, R., Tucker, S., Smith, M. L.
Journal of Osteopathic Medicine, 2025/12
50

Geographical distribution and match trends of osteopathic residents in otolaryngology residency programs: a cross-sectional analysis
Reardon, L., Stucki, B., Akella, D., Carr, M. M.
Journal of Osteopathic Medicine, 2025/12
Free full text
51

Using Generative Artificial Intelligence (AI) to Compare Commission on Osteopathic College Accreditation (COCA) and Liaison Committee on Medical Education (LCME) Standards
Hedrick, J. S., Cottrell, S. A., Nield, L. S., Ferrari, N.
Cureus, 2025/12
Free full text
52

NextGenDO: A Pre-medical Outreach Program to Promote Early Exposure to Osteopathic Medicine
Quezada, K. A., Gjunkshi, L., Persaud, N. A., Hasty, R.
Cureus, 2025/12
Free full text
53

Le dessin ostéopathique des atteintes corporelles : une clinique émersive
(Osteopathic drawings of bodily injuries: An immersive clinical experience)
Jacquot, E., Paintendre, A., Andrieu, B.
Evolution Psychiatrique, 2025/12
54

Effect of positional asymmetry palpatory models on improvement and retention of accuracy during pelvic asymmetry assessments
Hajicek, J. M., Huhn, M. B., Thurgood, A., Isemann, E. N., Barnwell, C. B., Starks, Z., Ying-Fang Wang, M., Degenhardt, B. F.
Journal of Osteopathic Medicine, 2025/12
Free full text
55

A Retrospective Comparative Analysis of MD and DO Applicants' Acceptance to Plastic Surgery Residency
Yacoub, S. G., Guyler, M., Zak, A., Marlar, R., Obeid, R., Leavitt, W. III., Bernard, S., Isakov, R., Rampazzo, A., Gharb, B. B.
Annals of Plastic Surgery, 2025/12
56

Prolotherapy in the Academy: A Mixed Methods Survey Study
Dubey, J., Jones, N. R., Evered, J. A., Grob, R., Andrie, J., Rabago, D.
Journal of Integrative and Complementary Medicine, 2025/12
Free full text
57

Educating tomorrow’s osteopaths and the crucial role of ethics teaching. Where we are now? A position paper of the Italian Academy of Osteopathic Medicine
Ferioli, E.
Medicina e Morale, 2025/12
58

De-stress pain management: Assessing pain management care amongst primary care providers
Browder, B. H., Reynolds, C., Agnello, R.
Postgraduate Medicine, 2025/12
59

Osteopathic Acceptance in General Surgery Residency: A Five-Year Review of Resident Outcomes
Baule, S. M., Nguyen, J., Mehdiyar, D., Panlilio, M. A., Flume, H., Hanna, A., Cordero, A., Shepherd, J., Johnson, R., Sees, J. P.
Cureus, 2025/12
Free full text
60

Evaluating Research Preparedness and Skill Gaps Among Osteopathic Medical Students Pursuing Surgical Specialties
Beerman, S. A., Stucki, B., Wong, R., Alexander, V. S., Vogel, A., Heard, M. A., Wallen, T. J.
Cureus, 2025/12
Free full text
61

Enhancing the Awareness of Osteopathic Learning Opportunities Through a Newsletter
Eilerman, A., Benton, A., Shneker, N., Abdo, M., Mar, D., Faherty, M., Reynolds, R.
The AAO Journal, 2025/12
62

The State of Osteopathic Physicians in Orthopaedic Training and Academic Practice
Cohn, R. M., Bitterman, A. D.
Journal of the American Academy of Orthopaedic Surgeons, 2025/12
63

Corrigendum to “Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution”
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/12
64

Medical Student Perspectives on Abortion Education in US Osteopathic Medical School Curricula
Steffes, R., Thakur, P., Cox, S., Adams, C., Creamer, B. A., Dennis, J. F.
Perspectives on Sex and Reproductive Health, 2025/12
65

Geographical distribution of osteopathic urology residents and match trends in the United States
Wong, R., Eke, B., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/11
Free full text
66

Clerkship Rotations Are a Key Driver of Family Medicine Choice: Insights from the 2024 National Resident Survey
Barr, W., Peterson, L. E., Fleischer, S., Bazemore, A.
Journal of the American Board of Family Medicine, 2025/11
Free full text
67

Cancer Prevention and Therapy With Nutritional Science: Addressing the Gap in Medical Education and Practice
Collignon, T. E., Bishayee, A.
MedComm, 2025/11
Free full text
68

DO and MD Enrollment in U.S. Dermatology Residencies Following the Graduate Medical Education Merger: Implications for Access
Park, L., Beach, S., Glick, B. P., Benedetto, A. V.
Clinical Dermatology, 2025/11
69

A quantitative analysis comparing pre-clinical volunteering hours with third-year medical students' preceptor evaluations
Ranta, E. K., Ranta, J. C., Redden, D., Stoner, A. M.
Journal of Osteopathic Medicine, 2025/11
Free full text
70

Scholar 12 longitudinal outcomes: osteopathic research development application to facilitate scholarly activity during the pandemic and beyond
Rowane, M. J., Thomas, K. A., Smith, T. M., Terrel, M. A., Rowane, M. P., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2025/11
Free full text
71

Osteopathic Medicine Applicants in Urology: Evolving Pathways and Persistent Gaps After the Merger
Toumazos, K., Svendsen, C., Spencer, K. A., Cranford, W., McLouth, C., Buchanan, A. F.
Urology Practice, 2025/11
72

Evaluating Community Awareness of Osteopathic Manipulative Medicine and New Educational Programs in Fresno County, United States: A Cross-Sectional Survey
Mazdeyasnan, L., Shabbir, Z., Ham-Ying, J.
Cureus, 2025/11
Free full text
73

EXPRESS: Differences in Attitudes among Health Professions Students and Educators toward People Experiencing Homelessness: Novel Correlations with Physical Comfort, Prior Experiences, and Interest in Learning
Gilmore, E., Szeto, C., Spector, E., Shono, Y., Pumerantz, A.
Journal of Investigative Medicine, 2025/11
74

Assessing eating disorder education in U.S. medical schools: a qualitative content analysis of lecture slides
Laboe, A. A., Pictor, L. E., Gavuji, M., Temucin, S., Kreynin, A., Sheil, E., Jourdan, B., Schaumberg, K., Davis, H., Harrop, E. N.
Eating and Weight Disorders, 2025/11
Free full text
75

Assessing fundamental clinical skills of osteopathic medical students
Boulet, J. R., Sandella, J. M., Gimpel, J., LaBaere, R.
Journal of Osteopathic Medicine, 2025/10
Free full text
76

Affirmative Action Repeal and Racial and Ethnic Diversity in US Medical School Admissions
Florescu, N., Lin, A., Temucin, S., Rae, L.
JAMA Network Open, 2025/10
Free full text
77

From Simulation to Surgery: Gauging Surgical Interest in Osteopathic Medical Students Through Cadaveric Simulation: A Pilot Study
Paladichuk, S., Chase, T., Downs, A., Heck, C., Cortner, M., Cornwell, H., Shang, T., Brennan, Z., Walser, R. F., Kerber, K., Wallen, T.
Journal of Medical Education and Curricular Development, 2025/10
Free full text
78

Enhancing Embryology Education Through Virtual Reality: A Pilot Study
Quiñones-Rodríguez, J., Rice, R., Mayer, W., Marchelli, G., Bouchoukian, M., Davis, P.
Anatomical Record, 2025/10
79

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10
80

Incorporating the Certified Professional in Patient Safety credential into undergraduate medical curriculum: assessment and lessons learned
Gelinas, L., Hassan, A. K., Lieto, J., Yurvati, A. H.
Journal of Osteopathic Medicine, 2025/10
Free full text
81

Predicting COMLEX-USA Level 2-CE using medical school performance and use for student advising
Wang, S., Basehore, P.
Journal of Osteopathic Medicine, 2025/10
Free full text
82

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/10
Free full text
83

Assessing Osteopathic Medical Student Knowledge of Common Vitamin and Mineral Deficiencies
Stevens, A. A., Weir, S. B.
Cureus, 2025/10
Free full text
84

Preceptor-Ranked Competencies in Osteopathic Medical Students: A Comparison of General Surgery and Surgical Subspecialties
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Garg, R., Thacker, R. R., Roach, S. L.
Cureus, 2025/10
Free full text
85

The Predictors of COMLEX-USA (Comprehensive Osteopathic Medical Licensing Examination of the United States) Level 1 Success Among Osteopathic Medical Students: The Role of Study Habits and Post-baccalaureate Background
Shults, R., Belizaire, S., Kennedy, C., Chosie, K.
Cureus, 2025/10
Free full text
86

Top 100 cited articles in osteopathic medical education: A bibliometric analysis
Bright, H. S. IV., Robinson, K., Fitterling, L., Kelley, S., Wang, M. Y.F., Lipke, L.
Medical Reference Services Quarterly, 2025/10
87

Virtual Escape Rooms in Anatomy Education: Case Studies from Two Institutions
Beger, A. W., Hannan, S., Patel, R., Sweeney, E. M.
Advances in Physiology Education, 2025/09
Free full text
88

Corrigendum to: The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T.H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/09
Free full text
89

A proven template for providing streamlined, scalable, cost-effective clinical research opportunities in osteopathic medical schools
Greek, J. N., Greek, A. P., Hopper, M., Arnce, R.
Journal of Osteopathic Medicine, 2025/09
Free full text
90

Technology use and satisfaction among colleges/schools of osteopathic medical education
Linsenmeyer, M., Ridpath, L.
Journal of Osteopathic Medicine, 2025/09
Free full text
91

Medical student perceptions of psychiatric conditions and the impact of stigmatizing language
Monahan, Z., Stevens, V., Hartwell, M., Ford, A. I.
Journal of Osteopathic Medicine, 2025/09
Free full text
92

Why is identification with osteopathy decreasing in medical students?
Kauffman, Z. S., Harper, T., Augustyniak, R. A., Ruff, C.
Journal of Osteopathic Medicine, 2025/09
Free full text
93

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/09
94

Abstracts From the Third Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 13, 2025
Akenami, F. O., Ismail, R., Obando Solano, C. P., Amalfitano, A.
Spartan Medical Research Journal, 2025/09
Free full text
95

Academic Background Affects Students’ Confidence and Anxiety Levels about Undergraduate Osteopathic Medical Education
Jambunathan, V.
Spartan Medical Research Journal, 2025/09
96

Assessing Osteopathic Medical Students’ Perceptions on Training to Identify Social Determinants of Health: A Pilot Study in a Detroit Street Medicine Program
Nallabelli, N.
Spartan Medical Research Journal, 2025/09
97

Dermatology match disparities: analyzing osteopathic vs. allopathic student outcomes post-ACGME/AOA single accreditation system (2020-2024)
Wan, L., Bawa, K., Park, A., Kadri, H., Cusick, A., Trotter, S. C.
Journal of Osteopathic Medicine, 2025/09
98

Osteopathy Educators’ and Researchers’ Perspectives on Artificial Intelligence in Academia: A Cross-Sectional Study
Mhadhbi, H., Draper-Rodi, J., Consorti, G., Antunes Ferreira, A. P., Horta, L. M., Rinne, S., Vaucher, P., Ménard, M.
International Journal of Osteopathic Medicine, 2025/09
99

Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/09
100

Understanding the Ranking and Matching Behaviors During the 2023 and 2024 General Surgery Match Cycles: A Program Signaling Approach
Pakdaman, S., LaFemina, J., Byrd, K. S., Dunleavy, D. M., Balestrieri, S. G., Jurich, D. P., Dowden, A. J., Lamb, D. L.
Journal of Surgical Education, 2025/09
101

A novel simulation enhanced education for osteopathic manipulation of hospitalized patients
Eilerman, A. P., Libonate, G., Pothen, S., Rudie, M., Zardoost, S., Donaldson, B., Gable, B.
Journal of Osteopathic Medicine, 2025/09
Free full text
102

Exploring the Relationship between Grit, Burnout, and Academic Success among First-Year Osteopathic Medical Students during Fundamentals of Anatomic Science I Course
Guzik, H.
Unpublished Dissertation, 2025/09
Free full text
103

Osteopathic Manipulative Treatment (OMT) Protocol on Sleep Quality in Medical Students as Measured by the Fitbit Smart Watch: A Pilot Study
Radigan, R., Finkelstein, A., Lee, B., George, E., Bhushan, P., Sousa, A., Yao, S. C.
The AAO Journal, 2025/09
104

Centering the Medical Student Perspective in a Mixed-Methods Evaluation of the Holistic Admissions Process at a Mission-Driven Institution
Liszka, B. L.
Unpublished PhD thesis, 2025/08
Free full text
105

The Need for Telehealth Education in the Medical School Curriculum
Carney, M., Thornton, M. E., Avancha, K., Nolin, J. R., Alexander, J.
Cureus, 2025/08
Free full text
106

Integrating a Microbiology Laboratory Improves the Attitudes and Performance of First-Year Osteopathic Medical Students
Hrach, V. L.
Cureus, 2025/08
Free full text
107

Concussion Best Practice Guidelines for Return to Activity and the Role of Occupational Therapy: Effects of an Education Module for Medical Students
Finn, C.
Brain Injury, 2025/08
108

Understanding COMLEX-USA Level-1 as a Pass/Fail examination: impact and opportunities
Gerhardson, A., Efurd, M., Sexton, P., Sefcik, D.
Journal of Osteopathic Medicine, 2025/08
Free full text
109

Effectiveness of Different Teaching Modalities in Human Gross Anatomy Education
Mooney, A., Thompson, N. E., Hoffmann, S.
Clinical Anatomy, 2025/07
110

The impact of a summer research internship program on research engagement of osteopathic medical students
Bishayee, A., Wallace, M. A., Bobak, A. K., Sasher, T. L., Alvarez, L. A., Flink, T. S.
Journal of Osteopathic Medicine, 2025/07
Free full text
111

Exploring the Characteristics and Competencies of Successful Osteopathic Medical Students on General Surgery Clerkship
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Thacker, R. R., Roach, S. L.
Cureus, 2025/07
Free full text
112

A Pilot Study of Orthopedic Applicants Regarding Sub-internship Number, Cost, and Preferences
Schultz, M. J., Riebesell, S., Lutz, R. W., McCahon, J., Suarez, J. D., Purtill, J., Daniel, J.
Cureus, 2025/07
Free full text
113

Predicting First-Semester Performance of First-Year Medical Students in a Changing Landscape
Walker, M., George, A., Mohsin, S., Nichani, R., Garg, R., Chosie, K., Kennedy, C.
Cureus, 2025/07
114

Enabling Exploration: Examining the Availability and Adequacy of Conference Funding for Medical Students
Allison, S. G., Soltani, H., Chwa, E. S., Shuaibi, D. W., Allison, K. R., Gosain, A. K.
Plastic and Reconstructive Surgery-Global Open, 2025/07
Free full text
115

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text
116

The effectiveness of training student physicians in culturally sensitive patient care using an interprofessional culturally competent curriculum
Aminpour, A., Gelvin, M., Smurzynski, A., Gardner, F., Gardere, J.
Journal of Osteopathic Medicine, 2025/07
Free full text
117

Building Community With Community: Collaborative Reflections on the Rural and Urban Community Orienting Experience (RUCOE)
Casapulla, S., Kropf, K., Kalout, S., Lingerak, S.
Teaching and Learning in Medicine, 2025/07
118

A survey of sexual harassment and assault in osteopathic medical schools
Chiriboga, K., Zeller, M., LaPlante, M., Prasad, C.
BMC Medical Education, 2025/07
Free full text
119

A cross-sectional analysis of pathology exposure across COCA-accredited osteopathic medical schools: Gaps and opportunities in pathology undergraduate medical education
Preston, P., Herman, M., Berry, A., Robinson, M., Schukow, C. P., Kowalski, P.
Academic Pathology, 2025/07
Free full text
120

Pioneering the future: incorporating lifestyle medicine tools in osteopathic medical education
Bansal, S., Shubrook, J. H.
Journal of Osteopathic Medicine, 2025/07
Free full text
121

The Impact of Simulated Osteopathic Manipulative Medicine Hospital Rounds on Student Confidence and the Likelihood of OMT Use During Clinical Clerkships
Abdulnour, T., Pryor, J., Chun, L.
The AAO Journal, 2025/06
122

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06
123

Exploring the Impact of Teaching Assistants on Student Learning in Osteopathic Manipulative Medicine (OMM) Laboratory Session: A Survey Study
Mehra, M., Ashkezari, A. D., Caron, E., Noto, P., Yao, S. C.
The AAO Journal, 2025/06
124

Assessing the Impact of Osteopathic Principles and Practice Teaching Assistants (OPP-TAs) at California Health Sciences University College of Osteopathic Medicine (CHSU-COM)
Miller, G., Pryor, J., Chun, L.
The AAO Journal, 2025/06
125

Gender Sensitivity in Osteopathy: The Challenge of Diagnosing Pubic Symphysis Somatic Dysfunctions
Velasquez, L., Walker-Elders, A., Feygin, H., Hahn, D., Lee, D., Volokitin, M.
The AAO Journal, 2025/06
126

Impact of Academic Support Interventions on Failing First-Semester Medical Students
Chosie, K., Shults, R.
Cureus, 2025/06
Free full text
127

The Impact of Biological Sex, Medical School Background, and Geographic Location on Diversity in U.S. Neurosurgery Residency Programs
Fioletova, M., Perkinson, K. A., Nemani, M., Sees, J. P.
Cureus, 2025/06
Free full text
128

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/06
129

Trends in osteopathic medical education: a scoping review
Hoskins, K., Montgomery, M., Griffith, A., Pollard, H., Orr-Roderick, D., Schmick, D., Strausman, J., Wade, S., Robertson, M., DeArmond, M.
Journal of Osteopathic Medicine, 2025/06
Free full text
130

Assessing Osteopathic Medical Students' Knowledge, Attitude, and Perspective on the Use of Assisted Reproductive Technologies (ART)
Patel, A., Capote, M. M., Manguvo, A., Mafuvadze, B.
Cureus, 2025/05
Free full text
131

The Impact of a Simulated Intrauterine Device Insertion Clinic on Osteopathic Medical Students’ Knowledge, Attitude, and Self-Efficacy Regarding Intrauterine Devices
Betit, A. L., Kelly, L. P., Garg, R., Patel, P. G.
Cureus, 2025/05
132

Towards a more equitable future: development, implementation, and evaluation of a novel e-course on racial disparities in pain management for medical students
Stensland, M., Maples, N., Sanford, E., Martinez, M.
BMC Medical Education, 2025/05
Free full text
133

Recent and future trends in osteopathic orthopedic surgery residency match rates following the transition to a single accreditation system
Turnow, M., Nemani, M. G., Gupta, N., Hartman, H., Manes, T., Williamson, T., Gianakos, A.
Journal of Osteopathic Medicine, 2025/05
Free full text
134

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2025/05
Free full text
135

International medical graduate orthopaedic residents show higher research productivity than United States graduate peers before and during residency
MacLeod, J. S., Jacome, F., Mansour, H., Lee, M. S., Akwuole, F., Cho, S., Lee, J., Lema, O., Chopra, A., Bakaes, Y., Painter, S., Baker, H., Mejia, A.
International Orthopaedics, 2025/05
136

Efforts in Undergraduate Medical Education to Improve Socioeconomic Status Diversity
Velasquez, D. E., Shrestha, A., Matias, W. R.
Academic Medicine, 2025/05
Free full text
137

Residency Program Characteristics Associated With Osteopathic Resident Representation
Nikolla, D. A., Sachdeva, V., Distefano, A., Bryan, A., Mudrakola, V., Milliron, M. L., Bowers, K. M.
Cureus, 2025/04
Free full text
138

“Transition to Clinical Years“ Podcast Series: A Pilot Project to Support Rising Third-Year Students
Price, K. W., Bhagtani, H., Abraham-Hardee, S., Yeager, D., Anandakrishnan, R.
Cureus, 2025/04
Free full text
139

Does Malpractice Risk Deter Medical Students From Pursuing Obstetrics and Gynecology?
Thai, A., Huynh, K., Pickering, T., Maron, A., Wang, L., Stohl, H.
Cureus, 2025/04
Free full text
140

An Expert Consensus of Acceptable Scholarly Activities in Emergency Medicine Residency Training Programs
Garg, N., Totten, V. Y., Greenberg, M. R., Wilkerson, G., Finnell, J. T., Lau, W. B., Miner, J. R., d'Etienne, J. P., Brenner, J. D., Kumar, P., Camargo, C. A.
The Journal of Emergency Medicine, 2025/04
141

A cross-sectional study of newly established medical schools in the United States: student body diversity remains an unmet challenge
Oyoun Alsoud, L., West, K., Sorrell, S., Andolsek, K. M., Al Hageh, C., Ibrahim, H.
Medical Education Online, 2025/04
Free full text
142

Modeling the importance of physician training in practice location for Ohio otolaryngologists
Borgemenke, S., Newsom, D., Scheatzle, P., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/04
Free full text
143

Effectiveness of a program director for osteopathic medical education to support osteopathic recognition at a training site with multiple programs
Eilerman, A., Porter, C., Faherty, M., Zmuda, E.
Journal of Osteopathic Medicine, 2025/04
Free full text
144

An Investigation of Second-Year Medical Students' Use of Outside Resources at Two Institutions
Berry, A., Campbell, A., Li, D., Bay, C., Ikonne, U.
Medical Science Educator, 2025/04
Free full text
145

Lecture Capture, Transcripts, and Captioning in US Colleges of Osteopathic Medicine: Descriptive Cross-Sectional Survey
Khong, P., Holmes, D., Masoudian, B., Lund, G. C., Garwood, S.
Medical Science Educator, 2025/04
Free full text
146

A comprehensive review of clinical experiences and extracurricular activities for US premedical students applying to osteopathic medical schools
Kadavakollu, S., Dang, T., Bains, J., Ham-Ying, J., Boyanovsky, B., Qureshi, M., Graneto, J., Richards, S.
Journal of Osteopathic Medicine, 2025/04
Free full text
147

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2025/04
148

Fostering Professionalism in Medical Education: the Common Ground Professionalism Initiative at Michigan State University College of Osteopathic Medicine
Jalaba, S., Ruger, K., Kerver, H.
Medical Science Educator, 2025/04
Free full text
149

The assessment of point-of-care ultrasound (POCUS) in residency: the benefits of a four-year longitudinally integrated curriculum
Le, D. Q., Scarpulla, M., Lam, H., Kern, J., Vroegop, S., Yaeger, J., Finch, C., Martini, W., Bolch, C. A., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2025/03
Free full text
150

Prevalence of pelvic examinations on anesthetized patients without informed consent
Cutting, R., Reddy, V., Polam, S., Neiman, N., Manna, D.
Journal of Osteopathic Medicine, 2025/03
Free full text
151

Impact of osteopathic manipulative medicine training during graduate medical education and its integration into clinical practice
Kramer, J. L., Trombetti, K., De Asis, K., Mai, V., Swing, E.
Journal of Osteopathic Medicine, 2025/03
Free full text
152

The impact of osteopathic recognition on multiple medical specialty residencies in a university-based setting
Nohomovich, B., Tito, E., Baker, J., Gomes, T.
Journal of osteopathic medicine, 2025/03
Free full text
153

The Seven Drivers of Change in Osteopathic Education
Engel, R.
International Journal of Osteopathic Medicine, 2025/03
154

Changes in Matches into Surgical Residencies and Fellowships Following the ACGME Merger
Soliman, S. S., Andrews, G., Emara, S., Watkins-Granville, N., Podwójniak, A., Hasan, I., Stuti, J., Brotman, A.
Journal of Surgical Education, 2025/03
Free full text
155

Exploring the Cost and Access Gap Between Osteopathic and Allopathic Medical Students When Applying for General Surgery Fourth-Year Away Rotations
Moza, M. M., Guarneri, B. D., Morrison, L., Allgood, L.
Cureus, 2025/03
Free full text
156

Increase in the Number of Medical Schools in the United States and Its Potential Adverse Ramifications for Urology Residency Applicants
Donato, U. M., Ebedes, D. M., Nelwan, D., Imam, A., Patel, T.
Cureus, 2025/03
Free full text
157

An Innovative Osteopathic Curriculum for Allopathic and Osteopathic Family Medicine Residents
Price, J. W.
The AAO Journal, 2025/03
158

Addressing confounding factors in the match disparities between DO and MD seniors
Bohler, F.
Journal of Osteopathic Medicine, 2025/03
Free full text
159

Appraisal of Sexual Education Curriculum in Secondary Schools With Inclusion of Practical Implications and Evaluation, Based on Rural-Urban Residence
Betit, A. L., Kennedy, C.
Cureus, 2025/03
Free full text
160

Assigning Commercial Off-The-Shelf (COTS)-Based Board-Style Pharmacology Practice Questions to Medical Students
Ghayur, M. N., Ghayur, A.
The Journal of Pharmacology and Experimental Therapeutics, 2025/03
161

503 A Closer Look at Pathology Education in Osteopathic Medical Schools: Data from 2021 to 2024
Preston, P., Herman, M., Berry, A., Robinson, M., Kowalski, P.
Laboratory Investigation, 2025/03
162

Investigating trends in orthopedic surgery match for osteopathic and allopathic graduates post-single accreditation transition
Megafu, M., Guerrero, O. D.
Journal of Osteopathic Medicine, 2025/02
Free full text
163

Analysis of self-reported confidence in independent prescribing among osteopathic medical graduating seniors
Eldeeb, K.
Journal of Osteopathic Medicine, 2025/02
Free full text
164

Determining the effects of social media engagement on surgery residents within the American College of Osteopathic Surgeons
Alexander, V. S., Eke, B., Xu, A., Wong, R., Greek, A., Ernst, M., Roberts, H., Ariwodo, O., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/02
Free full text
165

Analysis of self-reported confidence in independent prescribing among osteopathic medical graduating seniors
Eldeeb, K.
Journal of Osteopathic Medicine, 2025/02
Free full text
166

Perspectives of osteopathic medical students on preclinical urology exposure: a single institution cross-sectional survey
Wong, R., Mayrovitz, H. N.
Journal of Osteopathic Medicine, 2025/02
167

Generative Artificial Intelligence in Medical Education—Policies and Training at US Osteopathic Medical Schools: Descriptive Cross-Sectional Survey
Ichikawa, T., Olsen, E., Vinod, A., Glenn, N., Hanna, K., Lund, G. C., Pierce-Talsma, S.
JMIR Medical Education, 2025/02
Free full text
168

Pursuing Osteopathic Recognition: A National Survey on US Program Director Perspectives
Dong, T., Shapiro, M., Soh, M., Merkebu, J., Cervero, R., McClain, R., Durning, S. J.
Journal of Graduate Medical Education, 2025/02
Free full text
169

Development and Implementation of the “Exercise is Medicine“ Elective at an Osteopathic Medical School
Mitchell, C., DeMartino, S., Ivers, L., Brown, A., Maccabee, E., Griffith, B., Pankey, C. L.
Medical Science Educator, 2025/02
Free full text
170

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text
171

Foot and ankle fellowship-trained osteopathic orthopaedic surgeons: a review, analysis, and understanding of current trends
Henry, J. P., Partan, M. J., Chen, K. M., Cohn, R. M., Bitterman, A. D.
Journal of Osteopathic Medicine, 2025/01
Free full text
172

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text
173

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
174

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text
175

Electronic health care record for objective structured clinical examination stations at Philadelphia College of Osteopathic Medicine School of Pharmacy Georgia Campus during 2022-2023 academic year
Alhaddad, G., Saade, R., Najafabadi, I. K.
American Journal of Health-System Pharmacy, 2025/01
176

Efficacy of an Abdominal Surgery Simulator in Didactic Medical Training: A Randomized Controlled Trial
Fincher, S. E., Koniuk, V. M., Benavidez, M. S., Benefield, M. C., Drew, D. L., Hasan, D. M., Minner, N., Prakash, T. C., Parks, M. J., Lindsey, T.
Cureus, 2025/01
Free full text
177

Evaluation of an Osteopathic Manipulative Medicine Curriculum for Pediatric Residents
LeMay, M., Newhall, L.
Academic Pediatrics, 2025/01
178

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01
179

Shifting Perspectives: Assessing Knowledge and Beliefs in Harm Reduction Strategies Among Future Healthcare Professionals - H.E.R.O. Harm Reduction and Opioid Education
Hamilton, M. E., Brian, M., Hill, S., Hurst, T.
American Journal of Health-System Pharmacy, 2025/01
180

Resident Perceptions of Migraine Management and Interventions to Improve Care
Malone, L. I., Kelley, K.
American Journal of Health-System Pharmacy, 2025/01
181

The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T. H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/01
Free full text
182

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text
183

Osteopathic medical students' use of a customized mobile app to supplement ECG lectures for examinations
Zumwalt, J.
Unpublished PhD thesis, 2024/12
184

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text
185

A call to include intersectionality on board examinations
Dozier, D. R., Rodríguez, J. E.
Journal of Osteopathic Medicine, 2024/12
Free full text
186

Making the Cut: A Six-Year “Bone-afide“ Membership Trend From Student to Surgeon
Nemani, M. G., Barham, E., Sees, J. P.
Cureus, 2024/12
Free full text
187

Evaluating perspectives, knowledge and behaviors of osteopathic medicine in a United States osteopathic medical school: A study in employee education and changes in understanding
Glaser, K., Roberts, J., Coleman, M. K., Payton, M., Wilke, S., Linton, M., Waller, J.
International Journal of Osteopathic Medicine, 2024/12
188

Evaluating the Information Quality of YouTube Videos on Manual Medicine/Therapy
Is, E. E., Tarihci Cakmak, E., Damla Korkmaz, M.
International Journal of Osteopathic Medicine, 2024/12
189

Student perception of Case Based Learning at a medical school in New York before and during the COVID-19 pandemic
Bhurtyal, K. K., Kung-Lau, S., Pino, M. A.
Journal of Osteopathic Medicine, 2024/12
190

Institutional Funding of Medical Students for Research Conferences: Is There a Benefit for the NRMP?
Dennis, J. F., Khan, H., Papatheofanis, C., Agollari, K., Marino, R., Schumann, T., Woolhiser, E.
Journal of Osteopathic Medicine, 2024/12
191

Effectiveness of Prematriculation Programs for Student Success in Medical School
Frontz, A., Sheridan, L., Davidson, K., Gundler, C.
Journal of Osteopathic Medicine, 2024/12
192

Outreach Education led by Osteopathic Medical Students on Substance Use Prevention for Sustainable Health Literacy in Underserved Youth Communities
Garg, E., Gogineni, K., Mahimkar, S., Jambunathan, V., Jamal, L., Nazaroff, C., Restini, C.
Journal of Osteopathic Medicine, 2024/12
193

Assessing the Role of Osteopathic Medical Education on Community Health Literacy Interventions Pilot Study
Good, C., McClain, E.
Journal of Osteopathic Medicine, 2024/12
194

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12
195

“Limitations of Life:” A Mixed Methods Survey Exploring Osteopathic Medical Students’ Perspectives on Reasons Preventing them from Practicing In Rural Communities
Haque, N., Richardson, C.
Journal of Osteopathic Medicine, 2024/12
196

Building Disability Competency in Osteopathic Medical Students in Rural Ohio Pilot Study
Hughes, A., Barrett, J., Dillman, O.
Journal of Osteopathic Medicine, 2024/12
197

Promoting the Understanding Of Prerequisites, Training, Career Opportunities, and Practice Philosophy of Osteopathic Physicians Amongst Students in the Southeastern U.S.
Iyer, H., Saravanan, S., Oquendo, G., Zarandy, J., Roberts, M.
Journal of Osteopathic Medicine, 2024/12
198

Trends and Outcomes in Residency Matches: Assessing the Post-Merger Landscape for DO and MD Graduates
Jerman, H., Yebernetsky, K. E., Wilson, S.M. T., Rosmarin, S., Divito, C. B.
Journal of Osteopathic Medicine, 2024/12
199

Assessing the Role of Pronoun Competency Training in the Expansion of Transgender and Gender Diverse Curriculum in Undergraduate Medical Education
Morgan, R., Buckley, S., Scotten, M.
Journal of Osteopathic Medicine, 2024/12
200

Exploring Attitudes Towards Osteopathic Medicine in First and Second Year Osteopathic Medical Students Following Osteopathic Manipulative Medicine
Neiman, N., de Jesus, A., Zeller, A. M.
Journal of Osteopathic Medicine, 2024/12
201

Assessing the Potential Role for Using Artificial Intelligence (AI) in Osteopathic Medical Students Teaching and Learning
Patel, N., Martin, P., Benmerzouga, I.
Journal of Osteopathic Medicine, 2024/12
202

Osteopathic Medical Student Experiences with Assessing Red-Reflex in Different Skin Tones
Shah, P., Curran, S.
Journal of Osteopathic Medicine, 2024/12
203

Evaluation of the Use of 3D Printed Spinal Models to Educate and Assess Osteopathic Medical Students
Valdés, D., Zarandy, J., Sherrington, M., Cohen, M., Matechak, J.
Journal of Osteopathic Medicine, 2024/12
204

Development of the skill of dosed pressure in doctors in the process of professional retraining in the speciality «Osteopathy»
(Развитие навыка дозированного давления у врачей в процессе профессиональной переподготовки по специальности «Остеопатия»)
Boyarinov, V. N., Potekhina, Y. P.
Russian Osteopathic Journal, 2024/12
205

Third-year medical students' perceptions of confidence and readiness to perform EFAST after training
Rocic, P., Garrison, R., Stitle, K., Reynolds, A., Andrews-Dickert, R.
BMC Medical Education, 2024/12
Free full text
206

Das Menschenbild in der Osteopathie. Wie Osteopath*innen den Menschen sehen. Eine qualitative Studie
Fuchsluger, M.
unpublished MSc thesis, 2024/12
207

A Quantitative Program Evaluation of Restorative Justice Practices at United States Medical Schools
Harrison Schulman, J.
Unpublished MSc thesis, 2024/12
208

Concerns of osteopathic medical students during the COVID-19 pandemic
Hanna, O., Vinyard, C. J., Casapulla, S.
Journal of Osteopathic Medicine, 2024/11
Free full text
209

Unpacking ABSITE Performance: Evaluating International vs Domestic Medical Graduates and DO vs MD Trainees in a Joint Residency Program
Rahimpour, A., Baxter, J. D., Fox, D. W. N., Morrison, M., Denning, D. A., Ray, P. D., Barry, R.
Journal of the American College of Surgeons, 2024/11
210

Feasibility of a cinematic-virtual reality training program about opioid use disorder for osteopathic medical students: a single-arm pre–post study
Rehl, D., Mangapora, M., Love, M., Love, C., Shaw, K., McCarthy, J., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/11
Free full text
211

Enhancing Clinical Skills Through Virtual Reality: A Study on 12-Lead Electrocardiogram Placement in Medical Education
Olayeye, K., Oviawe, E.
Cureus, 2024/11
Free full text
212

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text
213

Students with prior anatomy experience start out stronger in medical school gross anatomy
Louro, M. D., Meegan, G., Rudin, L. R., Granatosky, M. C., Thompson, N. E.
Anatomical Sciences Education, 2024/10
214

Response to “Fostering a research culture in osteopathic medical education”
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2024/10
Free full text
215

Fostering a research culture in osteopathic medical education
Kadavakollu, S., Dang, T., Richards, S.
Journal of Osteopathic Medicine, 2024/10
Free full text
216

Assessing nutrition literacy and nutrition counseling proficiency following an interdisciplinary culinary medicine elective
Kirby, A. N., DeBellis, J., Wolter, K., Mount, G., Wang, C.H., Bishop, J., Barkhouse, J., Wirth, K., Nguyen, N., Cacciatore, C., Kraus, K.
Journal of Osteopathic Medicine, 2024/10
Free full text
217

Improving learning experience through implementing standardized team-based learning process in undergraduate medical education
Andrews-Dickert, R., Nagaraj, R., Zhan, L., Knittig, L., Zhao, Y.
BMC Medical Education, 2024/10
Free full text
218

Using Osteopathic Medical School Institutional Data to Establish the Correlation Between Academic Performance and First-Time Board Pass Rates to Develop Academic Interventions for Students at Risk of First Board Failure
Chosie, K.
Cureus, 2024/10
Free full text
219

The Transformative Care Continuum: implementing an accelerated pathway that addresses the new roles of the family medicine physician
Chrisman-Khawam, L., Snyder, S., Tyler, C., Harley, D., Davidson, E., Anthes, L., Casapulla, S.
Medical Education Online, 2024/10
Free full text
220

Geographical Distribution and Trends Analysis of Osteopathic General Surgery Residents
Ernst, M. D., Alexander, V. S., Wong, R., Berg, N., Roberts, H., Vogel, A. D., Burns, J. B., Conrad-Schnetz, K.
Cureus, 2024/10
Free full text
221

The Effect of an Anatomy Prep Course on OMS-1 Student's Performance During the Fall Semester
Prasad, D. M., Inman, A. M., Blanc, P. K., Gaunt, J. A., Guzik, H. M., Peterson, J. L.
Clinical Anatomy, 2024/10
222

A Retrospective Study of Virtual Hospital Experiential Learning Across Clerkship and Pre-clerkship Doctor of Osteopathic Medicine Students at a Medical School Based in the United States
Kersh, L., Sciuva, A., Shaw, J.
Cureus, 2024/10
Free full text
223

Evaluating the Impact of Direct, Direct Video, and Indirect Video Laryngoscopy Training on the Proficiency of Medical Students in Performing Direct Laryngoscopy: A High-Fidelity Manikin-Based Assessment
Moriarty, S. E., Perera, I. R., Sabbagh, M., Yeckley, M., Carpio, P., Hoodfar, A., LePera, A., Anandakrishnan, R., Daniels, T., Martin, R., Looney, J., Gittings, K., Edwards, W., Rawlins, F.
Cureus, 2024/10
Free full text
224

Perceived benefits and limitations of game-based simulation education by osteopathy students in early clinical training: A preliminary mixed methods study
Mhadhbi, H., Horta, L. M., Ims, J., Draper-Rodi, J., Mansfield, H., Shaw, R., Rinne, S., Cleland Silva, T., Metsälä, E., Ménard, M.
International Journal of Osteopathic Medicine, 2024/09
225

Young Doctors Program-Colorado: An Elective Elementary School Program to Improve Health Literacy, Utilization of the Healthcare System, and Osteopathic Awareness
Sposet, S., Fabich, R., McEchron, M.
Medical Science Educator, 2024/09
Free full text
226

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text
227

Integrating nutrition and culinary medicine into preclinical medical training
Johnston, E. A., Torres, M., Goldgraben, S., Burns, C. M.
BMC Medical Education, 2024/09
Free full text
228

Medical and pharmacy students' perceptions of their IPE and cultural competencies following an innovative course
Addo-Atuah, J., Gardere, J.
Pharmacy Education, 2024/09
229

Morphofunctional indicators of the body students of the medical university
(Морфофункциональные показатели организма студентов медицинского университета)
Kalyuzhny, E. A., Bogomolova, E. S., Mukhina, I. V., Galova, E. A., Basurov, V. A., Nazarova, N. A.
Russian Osteopathic Journal, 2024/09
230

Characteristics of perception channels of doctors and their changes in the process of professional retraining in the discipline of «Osteopathy»
(Характеристики каналов восприятия у врачей и их изменения в процессе профессиональной переподготовки по дисциплине «Остеопатия»)
Sokolova, I. V., Potekhina, Y. P.
Russian Osteopathic Journal, 2024/09
231

Geographical Distribution of Osteopathic Neurosurgery Residents
Ariwodo, O., Greek, A., Wong, R., Alexander, V. S., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Cureus, 2024/09
Free full text
232

Response to “Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection“
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2024/09
Free full text
233

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text
234

An osteopathic orientation to interprofessional education
Martinez, E. S., Redding, D.
Journal of Osteopathic Medicine, 2024/09
Free full text
235

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2024/09
Free full text
236

Professional skill priorities: Comparison views of osteopathy industry professionals and osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2024/09
Free full text
237

Changes in the Affective Empathy of Osteopathic Students: a Longitudinal Study
Newton, B. W., Vaskalis, Z. T.
Medical Science Educator, 2024/08
238

The WELLMESS Project (Move Well, Eat Well, Sleep Well, Stress Well)
Machireddy, D. R., Reid, C. G., Hollingsworth, J. C., Redden, D.
Cureus, 2024/08
Free full text
239

On-site peer mentorship’s effect on personal and professional development, stress reduction, and ease of transition into the medical education system
Whitfield, S., Hazard, C., Haynes, B., Coffey, T., Lynch, L., Davis, S.
Journal of Osteopathic Medicine, 2024/08
240

Evaluation of the Effect of Nutrition Education on Osteopathic Medical Students’ Personal Nutrition Choices and Incorporation Into Future Medical Practice
Parker, A. T., Bateman, R., Fastring, D.
Cureus, 2024/08
Free full text
241

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text
242

Students Matriculating into Integrated Plastic Surgery: Are all Medical Schools Equal?
Yau, A., Lentskevich, M. A., Reddy, N. K., Gutowski, K. S., Yau, I., Gosain, A. K.
The Journal of Craniofacial Surgery, 2024/08
243

Examining differences in trends in the orthopedic surgery match for osteopathic and allopathic medical graduates after the transition to single accreditation
Wood, R. S., Krumrey, J.
Journal of Osteopathic Medicine, 2024/07
Free full text
244

The hindrance of matching into neurosurgery from doctors of osteopathic-medicine perspective
Kashif, M., Muthana, A., Al-Qudah, A. M., Hoz, S. S.
Surgical Neurology International, 2024/07
Free full text
245

Interest in Cardiothoracic Surgery Among the American College of Osteopathic Surgeons’ Medical Students
Vogel, A. D., Wynn, A. B., Richards, M. C., Sindoni, M., Brennan, Z., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2024/07
246

Leitlinien in der Osteopathie: Pro und Kontra
(Guidelines in osteopathy: Pros and cons)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
247

Osteopathie und evidenzbasierte Medizin, Teil 3: Bedeutung der EBM für die Osteopathie
(Osteopathy and evidence-based medicine, part 3: Relevance of EBM for osteopathy)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
248

Lehre bereichert und verbindet – das Praxissemester
(Teaching enriches and connects – the practical semester)
Sander, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
249

Leitlinien in der Osteopathie: Pro und Kontra
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
250

A validity study of COMLEX-USA Level 3 with the new test design
Mao, X., Boulet, J. R., Sandella, J. M., Oliverio, M. F., Smith, L.
Journal of Osteopathic Medicine, 2024/06
Free full text
251

Evidence of anchoring bias in novice (first year) osteopathic French students in the context of the primary respiratory mechanism: A randomized-experimental study
Driaï-Allègre, C., Coste, F., Olmière, C., Grinand, M., Le Nohaïc, A., Romanet, F., Gourjon, G.
International Journal of Osteopathic Medicine, 2024/06
252

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/06
253

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/06
254

Osteopathie in Deutschland
(Osteopathy in Germany)
, 2024/06
Free full text
255

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06
256

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/06
Free full text
257

Somatic Dysfunction and Behavior Correlates in Medical Students
LaFontano, C. M., Huzij, T., Garlock, M., Speth, M., Ko, K., Crouch, N., McDaniel, R., McEchron, M.
The AAO Journal, 2024/06
258

Counterstrain Point Frequency and Treatment in Osteopathic Medical Students
Arnold, C., Quackenbush, D., Fahim, A., Quackenbush, G., Navarro, A., Edwards, C.
The AAO Journal, 2024/06
259

Exploring the Evolution of the Mind-Body Connection as First-Year Osteopathic Medical Students Learn about Common Osteopathic Dysfunctions
Krauss, A., Normil, N., Mosley, B., George, S., Volokitin, M., Milani, S., Henshaw, M.
The AAO Journal, 2024/06
260

Wie es dazu kam, dass Osteopathie unterrichtet wurde
(How osteopathy came to be taught)
Haxton, J.
Osteopathische Medizin, 2024/06
261

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06
262

OMT in the 21st century: current use of technologies in manual therapy education and opportunities for innovation
Pietrantoni, D., Krzykwa, E., Broussard, D., Fredrickson, T., Waters, H., Mehra, R.
The AAO Journal, 2024/06
263

Learning Mindsets and Well-Being and Ill-Being Among Osteopathic Medical Students
Tibbetts, Y., Himmelberger, Z. M., Barron, K. E., Speicher, M. R., Hulleman, C. S.
JAMA Network Open, 2024/06
Free full text
264

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06
265

A Comparative American Board of Surgery In-Training Examination (ABSITE) Performance Analysis Between International vs. Domestic Graduates and Doctor of Medicine (MD) vs. Doctor of Osteopathic Medicine (DO) Medical Degrees
Rahimpour, A., Morrison, M., Denning, D. A., Bown, P., Ray, P., Barry, R.
Cureus, 2024/06
Free full text
266

Research integrity and academic medicine: the pressure to publish and research misconduct
Kearney, M., Downing, M., Gignac, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text
267

Does regular attendance in supplemental virtual near-peer tutoring in anatomy laboratory content improve anatomy performance for medical students?
Doty, J. E., Thompson, N. E.
Anatomical Sciences Education, 2024/05
268

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text
269

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text
270

Interventions to promote medical student well-being: an overview of systematic reviews
Bennett-Weston, A., Keshtkar, L., Jones, M., Sanders, C., Lewis, C., Nockels, K., Solomon, J., Howick, J.
BMJ Open, 2024/05
Free full text
271

The Tensegrity Curriculum: A Comprehensive Curricular Structure Supporting Cultural Humility in Undergraduate Medical Education
Jones, A. C., Bertsch, K. N., Williams, D., Channell, M. K.
Advances in Medical Education and Practice, 2024/05
Free full text
272

Implementing PathElective as an organized means of supplementing pathology education in an osteopathic medical school-the New York Institute of Technology College of Osteopathic Medicine experience
Plummer, M. M., Mirza, K. M., Lilley, C. M., Eng, N.
Academic Pathology, 2024/05
Free full text
273

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text
274

Promoting the Integration of Direct-to-Consumer Genetic Testing Results Into Clinical Practice
Glenn, K.
Unpublished PhD thesis, 2024/05
Free full text
275

Doctors of Osteopathic Medicine as Plastic Surgery Residents: Demographics, Credentials, and Pathways to Residency
Raborn, L. N., Elmorsi, R., Smith, B. T., Asaad, M., Kelley, R., Egro, F. M.
Journal of Surgical Education, 2024/04
276

Overcoming barriers to equality, diversity, inclusivity, and sense of belonging in healthcare education: the Underrepresented Groups' Experiences in Osteopathic Training (UrGEnT) mixed methods study
Draper-Rodi, J., Abbey, H., Hammond, J., Thomson, O. T., Brownhill, K., MacMillan, A., Fabusuyi, Y., Vogel, S.
BMC Medical Education, 2024/04
Free full text
277

The Academic Medicine and Leadership Track for Medical Students
Glaser, K., McEchron, M., Jensen, C., Park, D.
Medical Science Educator, 2024/04
Free full text
278

The Impact of Financial Education on Stress Among Orthopaedic Surgeons
Higginbotham, D. O., Nham, F. H., Cavazos, D. R., Chen, C., Stoker, S. K.
Cureus, 2024/04
Free full text
279

Effect of COVID-19 Curriculum Changes on Medical Student Exam Performance: A Case Series
Ho, J., Levy, J., Afshari, N., Patel, D., Andersen, S., Simanton, E., Linton, M.
Cureus, 2024/04
Free full text
280

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text
281

The 7 Elements Communication Rating Form for Teaching and Assessing Medical Communication Competency
Wise, C. M., Lovett, G. D., Swarm, G. M., Nazar, A.
Cureus, 2024/04
Free full text
282

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text
283

What is wrong with osteopathy? A response to Thomson and MacMillan
Nicholls, D. A.
International Journal of Osteopathic Medicine, 2024/03
284

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03
285

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03
286

Osteopathie und evidenzbasierte Medizin, Teil 2: Kritik an der EBM
(Osteopathy and evidence-based medicine, part 2: Criticism of EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
287

The impact of osteopathic recognition on multiple medical specialty residencies in a university-based setting
Nohomovich, B., Tito, E., Baker, J., Gomes, T.
Journal of Osteopathic Medicine, 2024/03
Free full text
288

Teaching ultrasound in osteopathic medical schools
Slyvka, Y., Gwilym, J. L.
Journal of Osteopathic Medicine, 2024/03
Free full text
289

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03
290

A tailored training based on students’ and teachers’ needs to improve palpation skills: A quantitative part of a mixed-method study
Lavazza, C., Zangoni, G., Sozzi, F., Abenavoli, A., Barenghi, M.
International Journal of Osteopathic Medicine, 2024/03
291

Expansion of osteopathic medicine practitioner education on substance use disorders
Petrides, J., Jha, S., Kowalski, A., Hosein, S., Collins, P. B., Coren, J.
Journal of Osteopathic Medicine, 2024/03
Free full text
292

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03
293

Medical Students' Knowledge, Attitudes Toward, and Identification of Adverse Childhood Experiences and Trauma-Informed Care
Piszczor, R., Barry, C., Gundacker, C., Wallace, C., Shibuya, J., Perle, J.
The Permanente Journal, 2024/03
Free full text
294

Academic Degree Bias Among Speaking and Leadership Roles at the American Academy of Orthopaedic Surgeons Annual Meetings, 2016-2021
Bartlett, L., Daley, A., Kazimierczak, A., Klein, B., Humbyrd, C., Bitterman, A., Cohn, R.
Cureus, 2024/03
Free full text
295

Cross-Sectional Analysis of the Effect of Physical Activity, Nutrition, and Lifestyle Factors on Medical Students' Academic Achievement
Neuman, J., Ina, E. A., Huq, S. O., Blanca, A., Petrosky, S. N.
Cureus, 2024/03
Free full text
296

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03
297

Prevalence and quality of medical Spanish education in US osteopathic medical schools: a national survey
Dey, K., Romero Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2024/02
Free full text
298

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text
299

The Prevalence and Distribution of Osteopathic Chief Residents in Emergency Medicine
Wandro, E., Rammaha, S., McGurk, K.
Cureus, 2024/02
Free full text
300

Identified strategies to mitigate medical student mental health and burnout symptoms
Ozan, K. G., McGough, J. E. G., Gabel, J., Snow, M., Michel, N., Cooper, L., Robinson, K.
Journal of Osteopathic Medicine, 2024/02
Free full text
301

An assessment of surgery core rotation quality at osteopathic medical schools
Casey, T., Brennan, Z., Pereira, K., Young, G., Paluri, S. N., Gudakunst, C.
Journal of Osteopathic Medicine, 2024/02
Free full text
302

The clinical anatomy fellowship: A participants' perspective
Thiel, G. E., Murtha, C. M., Dennis, J. F., Hopper, M.
Anatomical Sciences Education, 2024/02
303

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text
304

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text
305

Neurosurgery Clerkships in United States Medical Schools: A Survey of Doctor of Medicine–Granting and Doctor of Osteopathic Medicine–Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2024/01
306

Zwischen Evidenz und individueller klinischer Expertise – ein Vergleich der Konzeption der Evidenzbasierten Medizin und den Anliegen der Osteopathie
(Between evidence and individual clinical expertise – a comparison of the concept of evidence-based medicine and the concerns of osteopathy)
Stierl, J. A.
unpublished MSc thesis, 2024/01
307

The Effect of the Coronavirus (COVID-19) Pandemic on Gender and Medical School Diversity in Gastroenterology Fellowship Matching
Almujarkesh, M. K., Alsakarneh, S., Almeqdadi, M., Al Ta'ani, O., Mohamad, B., Kinnucan, J.
Gastro Hep Advances, 2024/01
Free full text
308

Osteopathie und evidenzbasierte Medizin, Teil 1: die EBM
(Osteopathy and evidence-based medicine, part 1: EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
309

Visual Health Impact of Online Learning During COVID-19 in Osteopathic Medical Students
Syed, Z., Quadri, S.
Journal of Osteopathic Medicine, 2023/12
310

Impact of the COVID-19 Pandemic on First Year Medical Students at the West Virginia School of Osteopathic Medicine
Towne, D., Easler, J., Eleazar, C.
Journal of Osteopathic Medicine, 2023/12
311

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12
312

A Student-Driven Mindfulness Curriculum for First-Year Osteopathic Medical Students: A Pilot Study
Nielsen, C., Katz, S., Parker, M., Trefsgar, J., Bcharah, H., Kalin, J., Delavary, D., Brunk-Grady, M., Jaqua, B.
Journal of Osteopathic Medicine, 2023/12
Free full text
313

Letter to the Editor: Underlining there is nothing wrong with osteopathy
Espírito Santo, J., Moita, J., Campos, B., Nunes, A.
International Journal of Osteopathic Medicine, 2023/12
314

Osteopathic Medical Students’ Preferences for Viewing Lectures at a Multi-Campus Medical School
King, L., Rodgers, J., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12
315

Letter to the Editor regarding: Thomson OP, and MacMillan A. What’s wrong with osteopathy?
Noy, M.
International Journal of Osteopathic Medicine, 2023/12
316

The Effect of Osteopathic Medical Students’ Age on Desired Specialty
Raidah, A., Huang, P., Tariq, N., Wong, H., Hildreth, L., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
317

Examining Osteopathic Medical Students’ Experiences with Distance Learning and Social Connectedness
Rodgers, J., King, L., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12
318

Letter o the Editor: Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
319

Letter to the Editor: There is nothing wrong with osteopathy
van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2023/12
320

Satisfaction and readiness for professional activity of students of the Institute of Osteopathy (Saint-Petersburg): a study using the DREEM questionnaire
(Удовлетворенность и готовность к профессиональной деятельности слушателей Института остеопатии (Санкт-Петербург): изучение с использованием опросника DREEM)
Filenko, A. B., Tregubova, E. S.
Russian Osteopathic Journal, 2023/12
Free full text
321

Building Interest in the Primary Care Specialty Through Enhanced Global Health Experience
Hernandez, M., Ibiwoye, M. O., Ledbetter, M., Thacker, R., Diaz, S.
Cureus, 2023/12
Free full text
322

Mental health differences in medical students based on curriculum and gender
Jestin, M., Sharma, S., Jhaveri, D., Mitchell, B., Micciche, D., Venkataraman, V., Lambert, K.
BMC Medical Education, 2023/12
Free full text
323

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text
324

Improving Transparency in the Residency Application Process: Survey Study
Ulin, L., Bernstein, S. A., Nunes, J. C., Gu, A., Hammoud, M. M., Gold, J. A., Mirza, K. M.
JMIR Formative Research, 2023/12
Free full text
325

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12
326

Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
327

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/12
Free full text
328

Evaluation of Using Three-Dimensional Sacral Models in the Education of Sacral Osteopathic Manipulative Treatment: A Quality Improvement Study
Carr, G., Schury, C., Hammer, T., Lippert, J., Azevedo, L.
Journal of Osteopathic Medicine, 2023/12
329

National Prevalence and Quality of Medical Spanish Education in US Osteopathic Medical Schools: An Approach to Improve Health Equity
Dey, K. A., Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2023/12
330

Social congruence between Osteopathic medical students and figures of support at NYIT College of Osteopathic Medicine
Doty, J. E., Thompson, N. E.
Journal of Osteopathic Medicine, 2023/12
331

Healthcare Camp for High School Students Enhances the Understanding of Foundations of Osteopathic Medicine, Identifying Implicit Bias, and Recognizing Social Determinants of Health
Flanagan, M. K., Liu, E. L., Neff, A. R., Klink, A. M., Kruse, K. M., Vroegop, J. M., Orr, A. L., Skinner, B. W., Hum, J. M.
Journal of Osteopathic Medicine, 2023/12
332

Empathy Fatigue in Osteopathic Medical Students
Gernert, E., Malaker, P., Nguyen, T., Uptegrove, L., Nagireddi, S.
Journal of Osteopathic Medicine, 2023/12
333

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12
334

Effectiveness of Osteopathic Tenet Integration into Basic Science Learning Objectives Using Generative Artificial Intelligence
Harp, E., Hughes, G.
Journal of Osteopathic Medicine, 2023/12
335

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
336

Efficacy of Virtual Reality Programs versus Traditional Lectures on Osteopathic Medicine Information Retention
Jacob, T. J., Jose, R. M., Abraham, A., Syed, F., Tran, T.
Journal of Osteopathic Medicine, 2023/12
337

Differences in Learning Approach and Resource Utilization Between First- and Second-Year Osteopathic Medical Students
Jose, R. M., Goldstein, L.
Journal of Osteopathic Medicine, 2023/12
338

Assessing the Quality and Quantity of Research Among Incoming First-Year Osteopathic Medical Students
Lynch, S., Byrne, J., Sharieff, K.
Journal of Osteopathic Medicine, 2023/12
339

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12
340

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12
341

Factors contributing to or impeding the development of OPP knowledge and skills among COM students – A Cross-Sectional Survey
Roberts, T., Wardle, M., Pryor, J.
Journal of Osteopathic Medicine, 2023/12
342

Assessing Correlation Between Manual Dexterity, Specialty Choice and Desire to Practice OMT in Newly Admitted Osteopathic Medical Students
Rome, V., Brolis, N.
Journal of Osteopathic Medicine, 2023/12
343

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12
344

Ultrasound-assisted bony landmark palpation in untrained palpators
Nichols, J. W., Schmidt, C., Raghuraman, D., Turner, D.
Journal of Osteopathic Medicine, 2023/11
Free full text
345

A Pilot Study of Symptoms of Major Depressive Disorder in Medical Students at an Osteopathic Medical School Before and After High-Stakes Examinations
Arabatzis, T. J., Doroshenko, J., Ashraf, M. A., Smith, R. M.
Advances in Medical Education and Practice, 2023/11
Free full text
346

Time Until Proof of Credentials Significantly Decreases With the Use of Blockchain Technology and the Document Management System
Tissier, E. A., Berglund, A., Johnson, G. J., Sanzone, Z. A., Goodbread, A. P., Parker, H., Lucas, J., Kashmer, D.
Cureus, 2023/11
Free full text
347

Building Interest in Cardiothoracic Surgery at an Osteopathic Medical School: Results of an Institutional Study and a Guide for Medical Schools
Vogel, A. D., Wynn, A., Sindoni, M., Richards, M. C., Eppler, A. R., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2023/11
Free full text
348

Key factors for residency interview selection from the National Resident Matching Program: analysis of residency Program Director surveys, 2016-2020
Stone, C. L., Dogbey, G. Y., Falls, J., Kuo, Y. P.
Journal of Osteopathic Medicine, 2023/11
Free full text
349

Neurosurgery Clerkships in United States Medical Schools: A Survey of MD- and DO-Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2023/11
350

Updates on Diversity Among Cardiology-Related Fellowships
Walk, C. T., Lantz, R.
Cureus, 2023/10
351

Enhancing Future Healthcare Professional Education Surrounding Substance Use Disorders
Riccio, K. K. C., Hales, K., Whittaker, A.
Journal of Addiction Medicine, 2023/10
352

Effects of a focused training on first-year osteopathic medical students' ability to incorporate point-of-care ultrasound in assessment of the anterior knee
Weaver, C., Heath, D. M., Makin, I. R. S., Hanamaika'i, K., Kanumalla, R., Matsushita, S., Chatta, P., Adhikari, S.
Journal of Osteopathic Medicine, 2023/10
Free full text
353

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09
354

The extent and quality of evidence for osteopathic education: A scoping review
MacMillan, A., Gauthier, P., Alberto, L., Gaunt, A., Ives, R., Williams, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/09
355

The effectiveness of disinfection protocols in medical school osteopathic manipulative medicine labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/09
Free full text
356

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09
357

Assessing interest in cardiothoracic surgery at an osteopathic medical school: Results of an institutional survey
Vogel, A. D., Wynn, A., Richards, M. C., Sindoni, M., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
JTCVS Open, 2023/09
358

Equal but Separate: The Slow Assimilation of Osteopathic Surgery Residents Two Years After the Unified Match
Bello, G., Lyles, E., Owens, S., Wilson, A. S., Westby, R. W., Evans, W., Edmondson, E., Lindsey, T. G. II., Falcone, J. L., Boyev, A.
Journal of Surgical Education, 2023/09
359

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09
360

Evaluation of the impact of a communication focused curriculum intervention in an undergraduate osteopathy programme
Muddle, L.
Unpublished PhD thesis, 2023/08
Free full text
361

Medical Uncertainty of Future Physicians: Socialization and Uncertainty Management in Medical Education
Duty, K. M.
Unpublished PhD thesis, 2023/08
362

Understanding the Use of Program Resources During Virtual Recruitment by Psychiatry Residency Applicants
Bernstein, S. A., Hodgins, G. E., Abu-Hamad, S., Gih, D. E., Gold, J. A.
Academic Psychiatry, 2023/08
Free full text
363

The Evaluation of a Digital Health Intervention to Improve Human Papillomavirus Vaccine Recommendation Practices of Medical Students
Richman, A. R., Torres, E., Wu, Q., Eldridge, D., Lawson, L.
Journal of Cancer Education, 2023/08
364

Diversity Differences Among Cardiovascular Fellowships Across Five Geographic Regions in the United States
Dye, M., Saeed, A., Nguyen, T. Q., Yu, S., Bey, J., Hefner, D., Walk, C. T., Lantz, R.
Cureus, 2023/08
Free full text
365

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text
366

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07
367

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/07
368

Surgical simulation in osteopathic medical schools
Seely, K. D., Hansen, M., Paluri, S. N., Rasmussen, K., Carter, S., Nigh, A.
Journal of Osteopathic Medicine, 2023/07
Free full text
369

Integrating A Student Co-Created Health Systems Science Curriculum Within UME
Ethridge, B., Steadman, M., Crews, B.
Southern Medical Journal, 2023/07
370

Comments on “Is cadaveric dissection essential in medical education? A qualitative survey comparing pre-and post-COVID-19 anatomy courses“
Michel, N. K., McGough, J. E. G.
Journal of Osteopathic Medicine, 2023/07
Free full text
371

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text
372

Effect of Objective Training Programs on Symmetry and Accuracy of Passive Motion Force Application
Hajicek, J., Huhn, M., Starks, Z., Wang, Y.F., Degenhardt, B.
The AAO Journal, 2023/06
Free full text
373

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06
374

Assessing Differences in Palpation Pressure between Osteopathic Medical Students and Osteopathic Physicians
Jacob, T., Khalid, A., Syed, F., Jose, R., Nikprelaj, K., Frankini, E., Yao, S., Toma, M.
The AAO Journal, 2023/06
Free full text
375

Learning abnormal physical examination signs: an introductory course
Sabirov, A., Chludzinski, M., Eminof, E., Eddy, A., Gallagher, J., Jung, I.
Journal of Osteopathic Medicine, 2023/06
Free full text
376

The Planetary Benefit of Suspending USMLE Step 2 CS: Estimating Carbon Emissions Associated with US Medical Students' Travel to Testing Centers
Sherpa, J. R., Donahue, L., Tsai, J., Nguemeni Tiako, M. J.
The Yale Journal of Biology and Medicine, 2023/06
Free full text
377

Incorporation of an osteopathic-focused lecture series into an already established pediatric residency curriculum
Wysong, M., Copenheaver, D., Powers, L., Flaherty, R.
The AAO Journal, 2023/06
Free full text
378

The first step to strengthening graduate level osteopathic education: a national review
Cain, R. A.
Journal of Osteopathic Medicine, 2023/06
Free full text
379

Physical health level and osteopathic status of students
(Уровень физического здоровья и остеопатический статус студентов)
Tyuleneva, A. A., Potekhina, Y. P.
Russian Osteopathic Journal, 2023/06
Free full text
380

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists: An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/06
381

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/06
Free full text
382

Accompagner les changements curriculaires vers l’approche par compétences dans les formations en santé : étude d’une stratégie de changement pragmatique portée par un individu-tercéisateur dans un institut de formation en ostéopathie français
(Facilitating curricular changes towards the competency-based approach in health education : study of a pragmatic change strategy supported by a third-party with terceisation function in an osteopathic training institute)
Quesnay, P.
Unpublished PhD thesis, 2023/06
383

Pharmacology Education, Osteopathic Principles Integration, Osteopathic Manipulation Treatment relations: Osteopathic Graduating Seniors' Perception
Eldeeb, K.
Journal of Pharmacology and Experimental Therapeutics, 2023/06
384

Assessing Clinical Reasoning in Medical Students Using a Virtual Patient Simulator
Abdulnour, R., O'Rourke, M., Smith, T.
Diagnosis, 2023/05
385

Virtual Deliberate Practice: Assessing Clinical Reasoning Using an Illness Script-based Simulator
Abdulnour, R. E., Furfaro, D., Sternschein, R., Smith, T. M., Drazen, J. M.
American Journal of Respiratory and Critical Care Medicine, 2023/05
386

Allopathic and Osteopathic Residents Perform Similarly on the Orthopedic In-Training Examination (OITE)
Gomez, C., Ranson, R., Gianakos, A., Miskimin, C., Mulcahey, M. K.
Journal of Surgical Education, 2023/05
Free full text
387

Effect of a Stress Management Module on First-Year Osteopathic Medical Students’ Stress Levels
Hill, Y. M.
Unpublished PhD thesis, 2023/05
388

Identifying Predictors of Eventual Rural Practice Among Female Osteopathic Medical Students
Kahl, D.
Unpublished Dissertation, 2023/05
389

Beyond burnout: a four-year survey of osteopathic medical student mental health and the implications for the development of wellness and mental health programs
Ley, A. F., Han, J. J., Hare, E., Sikorskii, A., Taylor, J. R., Shahed, A., Guro, C.
Journal of Osteopathic Medicine, 2023/05
Free full text
390

Is there a mean difference in attitude when care for LGBTQ patients between primary care provider subgroups?
Doan, T.
Unpublished MSc thesis, 2023/05
Free full text
391

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists : An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/05
392

Medical Education Fellowship: Who's Doing It and Why?
Cueva, J., Jobeun, N., Mody, S.
Western Journal of Emergency Medicine, 2023/05
Free full text
393

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match. Letter
Bohler, F., Aggarwal, N. D.
The Journal of Urology, 2023/04
Free full text
394

A New Barrier in the Urology Residency Application Process For Students: Growth of U.S. Medical Schools Increasingly Outpaces the Development of Urology Programs
Nelwan, D., Donato, U., Patel, T., Imam, A. S.
The Journal of Urology, 2023/04
395

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match
Bohler, F., Aggarwal, N. D.
The Journal of Urology, 2023/04
396

Realistic Assessment of Research Publications by Neurosurgery Residency Applicants
Hasley, H. L., O'Malley, G. R., Jr., Bala, S., Weisman, H. E., Roth
World Neurosurgery, 2023/04
397

Barriers to research opportunities among osteopathic medical students
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2023/04
Free full text
398

Understanding and preference toward DOs and OMT before and after an osteopathic principles and practice fellow lecture series
Ellson, L., Wong, N., Harper, J., Williamson, G., Zapata, I., Putnam, K., Roberts, J.
Journal of Osteopathic Medicine, 2023/03
Free full text
399

Interventional Radiology in Osteopathic Medical Education
Cyphers, E., Groskreutz, D., Grilli, C., Ahuja, R.
Journal of Vascular and Interventional Radiology, 2023/03
400

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text
401

Response to Lo et al. regarding “The role of 3D digital applications in Manual Therapy Education – A scoping review”
Kovanur Sampath, K., Arumugam, A., Jull, G.
International Journal of Osteopathic Medicine, 2023/03
Free full text
402

Letter to the editor, regarding: The role of 3D digital applications in manual therapy education – A scoping review
Lo, C. N.
International Journal of Osteopathic Medicine, 2023/03
403

Osteopathic education: A scoping review protocol
MacMillan, A., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/03
404

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03
405

Evaluating the impact of a curriculum intervention using an assessment rubric for communication skill development of osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2023/03
406

The Early Impact of Deciding to Take the United States Medical Licensing Examination Step 1 for Osteopathic Medical Students in the Pass/Fail Era
Hedgepeth, D., Wlasowicz, S., Lott, R., Smith, T.
Cureus, 2023/03
Free full text
407

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text
408

Pilot of an Interprofessional Functional Nutrition and Lifestyle Medicine Elective with Community Cooking Classes during Covid-19 Pandemic
Jones, G. M., Stevenson, T.
Journal of Integrative and Complementary Medicine, 2023/02
409

Perceived Value of Osteopathic Recognition
Maier, R., Weaver, J., Ginoza, J. A., Meyer, D., Gothard, D.
Family Medicine, 2023/02
Free full text
410

To the Editor: COMLEX-USA vs USMLE? Irrelevant
Terry, R., Lavertue, S.
Journal of Graduate Medical Education, 2023/02
Free full text
411

The assessment of point-of-care-ultrasound (POCUS) in acute care settings is benefitted by early medical school integration and fellowship training
Kern, J., Scarpulla, M., Finch, C., Martini, W., Bolch, C. A., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2023/02
Free full text
412

Factors Leading to Successful Performance on U.S. National Licensure Exams for Medical Students: A Scoping Review
Jeyaraju, M., Linford, H., Bosco Mendes, T., Caufield-Noll, C., Tackett, S.
Academic Medicine, 2023/01
413

Including LGBTQIA+ Healthcare Education in the Pre-Clinical Curriculum at Osteopathic Medical Schools
Harrison, C. C.
Unpublished Dissertation, 2023/01
414

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12
415

A randomized, controlled study to assess if allopathic-osteopathic collaboration influences stereotypes, interprofessional readiness, and doctor-patient communication
Jones, I. A., LoBasso, M., Shapiro, J., Amin, A.
PLoS One, 2022/12
Free full text
416

Die Geschichte der Osteopathie in Deutschland
(The history of osteopathy in Germany)
Engel, M.
Osteopathische Medizin, 2022/12
417

Evocations of Osteopathy's founder and questions for contemporary osteopathic professional identity: A thematic analysis
Skinner, D., Esber, T., Walkowski, S.
International Journal of Osteopathic Medicine, 2022/12
418

A Case Study Examining Women in Leadership at a College of Osteopathic Medicine
Kelley, S.
Unpublished Dissertation, 2022/12
419

A web-based review of global health programs in U.S. allopathic and osteopathic medical schools
Edwards, M. K., An, C., Rohrbaugh, R., Peluso, M. J., Lam, S. K.
Medical Teacher, 2022/12
420

Gender Differences in Stress, Anxiety, and Depression Perceived by Osteopathic Medical Students Within the Context of the COVID-19 Pandemic
Herr, V., Emanuel, J., Farid, A., Morris, A., Balentine, J., Blazey, W., Krishnamachari, B.
Journal of Osteopathic Medicine, 2022/12
421

A Peer-led Program to Increase Diversity in Osteopathic Medical Schools: Three Year Update
Hu, J., Smart, H., Garo, J. A., Rachdi, O., Fernandes Paul, M.
Journal of Osteopathic Medicine, 2022/12
422

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12
423

Student Developed Didactic Series Rooted in Osteopathic Philosophy
Newman, N., Ahmed, S., Shiffler, V., Sinitsa, I., Harold, Z., Naeem, A., Lovett, G., Nazar, A.
Journal of Osteopathic Medicine, 2022/12
424

Comments on “Mini-medical school programs decrease perceived barriers of pursuing medical careers among underrepresented minority high school students“
Berreta, K.
Journal of Osteopathic Medicine, 2022/11
Free full text
425

Measuring the Perception of Readiness with an EHR Training: A Look into Primary Care
Saldivar, E.
Unpublished Dissertation, 2022/11
Free full text
426

The Austrian Osteopathic Practitioners Estimates and RAtes (OPERA): A cross-sectional survey
van Dun, P. L. S., Arcuri, L., Verbeeck, J., Esteves, J. E., Cerritelli, F.
PLoS One, 2022/11
Free full text
427

A Systematic Review on Spinal Asymmetries in Case Studies of Unilateral Nephroptosis from a Viscerosomatic Point of View
Oliva-Pascual-Vaca, Á, Castillo-Cañuelo, M. J., Oliva-Pascual-Vaca, J., Pérez-Montalbán, M., Ordonez, F. J., Martínez-Fernández, J. A.
Healthcare, 2022/11
Free full text
428

Podiatric Medical Resident Wellness: A Group Survey Study
Deheer, P. A., Wolfe, W., Nichols, J. A., Badell, B. J., Patel, N. A.
Journal of the American Podiatric Medical Association, 2022/11
429

Comments on “Reported completion of the USMLE Step 1 and match outcomes among senior osteopathic students in 2020“
Boulet, J. R., Gimpel, J. R., Sandella, J. M., Turner, M. D.
Journal of Osteopathic Medicine, 2022/10
Free full text
430

The Profile of Belgian Osteopaths: A Cross-Sectional Survey
van Dun, P. L. S., Verbeeck, J., Arcuri, L., Esteves, J. E., Cerritelli, F.
Healthcare, 2022/10
Free full text
431

Multisite assessment of emergency medicine resident knowledge of evidence-based medicine as measured by the Fresno Test of Evidence-Based Medicine
Katsilometes, J., Galuska, M., Kraus, C. K., Levitin, H. W., Leuchten, S., Daugherty-Luck, J., Lata, J., Brannan, G., Santarelli, A., Ashurst, J.
Journal of Osteopathic Medicine, 2022/10
Free full text
432

Response to “Comments on 'Reported completion of the USMLE Step 1 and match outcomes among senior osteopathic students in 2020'“
Nikolla, D. A., Stratford, C. V., Bowers, K. M.
Journal of Osteopathic Medicine, 2022/10
Free full text
433

Further insight on AOA ophthalmology residency program closure data
Bradshaw, J. T., Gawrys, S. P., Wong, W. J., Parker, L. M.
Journal of Osteopathic Medicine, 2022/09
Free full text
434

UGRC 2021 recommendations on GME transition: pros and cons, opportunities and limitations
Gimpel, J. R., Swails, J. L., Bienstock, J. L., Lin, G. L., Roett, M. A., Patel, J. K., Giang, D. W.
Journal of Osteopathic Medicine, 2022/09
Free full text
435

A Thematic Analysis of Osteopathic Physicians' Identities and Experiences in North American Professional Sports
Blacha, K., Cade, A., Russell, T., Skinner, D.
Open Access Journal of Sports Medicine, 2022/09
Free full text
436

The utilisation and attitudes to patient reported outcome measures by Australian osteopaths: A cross sectional study
Fleischmann, M., Fryer, G
International Journal of Osteopathic Medicine, 2022/09
437

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text
438

The Predictive Value of the Residency AOBFP In-Service Exam, Produced and Administered by ACOFP
Torres, J. W., Bowling, J. R., Zipp, C., Williams, N., Sandella, J. M., Martinez, L., Moore, B.
Family Medicine, 2022/09
Free full text
439

Response to “Further insight on AOA ophthalmology residency program closure data“
Ahmed, H., Vo, K., Robbins, W.
Journal of Osteopathic Medicine, 2022/09
Free full text
440

Student Attitudes About Osteopathic Medical Schools: Increasing Student Willingness to Apply
Mattiace, S. M.
Unpublished Dissertation, 2022/08
Free full text
441

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text
442

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08
443

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text
444

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/08
Free full text
445

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07
446

Osteopathic practice in the United Kingdom: A retrospective analysis of practice data
Plunkett, A., Fawkes, C., Carnes, D.
PLoS One, 2022/07
Free full text
447

Im Gespräch mit … Christian Hartmann
(In dialog with ... Christian Hartmann)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
448

Die Osteopathie aus Sicht der ärztlichen Osteopathen – eine qualitative Interviewstudie
(Osteopathy from the point of view of medical osteopaths - a qualitative interview study)
Waubert de Puiseau, A., Belz, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
449

Osteopathic medical students’ understanding of race-based medicine
Jivens, M., Okafor, I., Beverly, E. A.
Journal of Osteopathic Medicine, 2022/06
Free full text
450

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text
451

Durch dissipative Strukturierung zu Kohärenzgefühl und Gesundsein?
(Through dissipative structuring to a sense of coherence and being healthy?)
Pelz, H.
Osteopathische Medizin, 2022/06
452

„Das philosophische Fundament Stills in die heutige Zeit überführen“
(“Bringing Still's philosophical foundation into the modern times.“)
Prediger, G., Buekens, J.
Osteopathische Medizin, 2022/06
453

To the Editor: Limitations and Alternative Solutions to a USMLE COMLEX-USA Concordance
Jurich, D., Liu, C., Clauser, A.
Journal of Graduate Medical Education, 2022/06
Free full text
454

To the Editor: Response to: Limitations and Alternative Approaches to a USMLE COMLEX-USA Concordance
Sandella, J., Boulet, J., Barnum, S., Tsai, T. H., Wang, Y.
Journal of Graduate Medical Education, 2022/06
Free full text
455

Professional identity in osteopathy: A scoping review of peer-reviewed primary osteopathic research
Phillips, A. R.
International Journal of Osteopathic Medicine, 2022/06
Free full text
456

Relevance of historical osteopathic principles and practices in contemporary care: Another perspective from traditional/complementary and alternative medicine
Vogel, S., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2022/06
Free full text
457

Cross-Sectional Study of Osteopathic General Surgeons in University-Based General Surgery Departments
Khan, M. T., Patnaik, R., Wheeler, C., Ibrahim, M., Wolf, H., Baumgardner, K. C., Lovely, R. S.
Cureus, 2022/05
Free full text
458

Advocacy for Change: An Osteopathic Review of Traumatic Brain Injury Among Combat Veterans
Pendlebury, G. A., Oro, P., Haynes, W., Byrnes, T. R., Keane, J., Goldstein, L.
Cureus, 2022/05
Free full text
459

The Effect of Clinical Anatomy Integration on Medical Student Academic Performance and Learning Approach
Stoudemire, Claire, Terrell, Mark, McCarthy, Sarah, Gulati, Raj, Fonner, Christopher, Kulesza, Randy
FASEB journal, 2022/05
Free full text
460

Parental leave in medical school: supporting students as parents
Ortega, S. R., Barnes, J. M., Waller, J. D.
Journal of Osteopathic Medicine, 2022/05
Free full text
461

Assessing the United States' most frequently asked questions about osteopathic medicine, osteopathic education, and osteopathic manipulative treatment
Sajjadi, N. B., Ottwell, R., Shepard, S., Bray, N., Dyer, R., Wilson, J., Vassar, M., Hartwell, M.
Journal of Osteopathic Medicine, 2022/05
Free full text
462

Osteopathy as a complementary/alternative medicine for breast cancer: a Canadian case study and comprehensive review
Fortin, J., Beaupré, A., Thamar Louis, L. A., Roy, C.A., Bourque, M. A., Cappeliez, S., Fadhlaoui, A.
Breast Cancer Management, 2022/04
Free full text
463

Attracting Medical Students to Family Medicine: An Historical View
Young, R. A., Tinger, S.
Family Medicine, 2022/04
Free full text
464

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) residency curriculum guidelines to meet Accreditation Council for Graduate Medical Education (ACGME) milestones
Balyakina, E. S., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2022/04
Free full text
465

A Content Analysis of Osteopaths' Attitudes for a More Inclusive Clinical Practice towards Transgender People
Baldin, I., Esteves, J. E., Tramontano, M., Macdonald, M., Baroni, F., Lunghi, C.
Healthcare, 2022/03
Free full text
466

Student Perception of an OMM Virtual Practical Examination: In the Setting of Social Distancing
Berenbeim, G., Metzler, I., Lewis, D., Jie, C.
The AAO Journal, 2022/03
Free full text
467

Impressionen von A.T. Stills Osteopathie
(Impressions of A.T. Stills osteopathy)
Stecker, D.
Osteopathische Medizin, 2022/03
468

Patellofemoral pain syndrome: a review of the literature with osteopathic emphasis
Balint, T., Jones, J., Paquette, M., Amalfitano, J.
The AAO Journal, 2022/03
Free full text
469

A Concordance Study of COMLEX-USA and USMLE Scores
Barnum, S., Craig, B., Wang, X., Sandella, J., Tsai, T.H., Boulet, J., Wang, Y.
Journal of Graduate Medical Education, 2022/03
Free full text
470

Vom Selbsterleben osteopathischer Praxis im Wirk-Bündnis der Tastwelt: Phänomenologisch-anthropologischer Bericht einer tastenden Praxis
(From the self-perception of osteopathic practice in the active alliance of the world of touch: Phenomenological-anthropological report of a practice of touching)
Kaiser, A. K.
Osteopathische Medizin, 2022/03
471

The AOA/ACGME Single Accreditation System and Its Immediate and Future Impact on Family Medicine
Fugazzi, L., Cummings, M.
Family Medicine, 2022/02
Free full text
472

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text
473

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text
474

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02
475

20/20 Vision
Finch, T.
Health Communication, 2022/01
Free full text
476

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
477

Im Zwischen – eine am Leib orientierte osteopathische Besprechung
(In between - An osteopathic discussion oriented toward the body)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
478

O papel das citocinas no apoio à monitorização e diagnóstico das condições alvo ao tratamento osteopático: Revisão sistemática da literatura
(The role of cytokines in supporting the monitoring and diagnosis of conditions targeted for osteopathic treatment: A systematic review of the literature)
Coelho, D.
Unpublished thesis, 2022
Free full text
479

Undergraduate pre-requisite coursework: Six important tips for pre-medical students considering Osteopathic Medical school in the USA
Kadavakollu, S., Moullet, Z., Yoshida, M., Qureshi, M., Graneto, J., Boyanovsky, B.
International Journal of Osteopathic Medicine, 2021/12
480

Mini-medical school programs decrease perceived barriers of pursuing medical careers among underrepresented minority high school students
Abdulrazzak, A., Chandler, A., Lu, R., Mobarakai, O., Lebron, B., Ingram, N., Sheth, A., Patel, N., Parikh, S., Kumar, R., Bedi, J., Diaw, N. K., Abonamah, A., Lomiguen, C., Fanning, S. L.
Journal of Osteopathic Medicine, 2021/12
Free full text
481

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text
482

Adaptation and validation of the SEGUE checklist to assess osteopathy students' clinical communication skills
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2021/12
483

Wissenschaft und Forschung in der Osteopathie: Teil 2: Forschung in der Osteopathie
(Science and research in osteopathy - Part 2: Research in osteopathy)
Stecker, D., Scheuchl, F.
Osteopathische Medizin, 2021/12
484

Perceptions of COVID-19 vaccines among osteopathic medical students (OMS)
Al Janabi, T., Chinsky, R., Pino, M. A.
International Journal of Osteopathic Medicine, 2021/12
Free full text
485

Pain knowledge and fear-avoidance beliefs of French osteopathy students and educators towards chronic low back pain: An osteopathic educational institution-based cross-sectional survey
Mhadhbi, H., Thierry-Hildenbrand, B., Draper-Rodi, J., Esteves, J. E., Ménard, M.
International Journal of Osteopathic Medicine, 2021/12
486

How does French initial osteopathic training value relational competency, patient education, and the competency-based approach? A cross-sectional survey
Quesnay, P., Poumay, M., Gagnayre, R.
International Journal of Osteopathic Medicine, 2021/12
487

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) Residency Curriculum Guidelines to meet ACGME Milestones
Balyakina, E., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2021/12
488

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12
489

Factors Influencing Osteopathic Medical Students’ Decision to Pursue a Surgical Specialty
Keever, K., Kiernan, R. N., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12
490

Factors Affecting Osteopathic Medical Students’ Specialty Choice in Light of a Future Pass/Fail COMLEX Level 1 and USMLE Step 1
Kiernan, R. N., Keever, K., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12
491

Understanding medical student perspectives in virtual osteopathic manipulative medicine education during the COVID pandemic
Liu, T., Torrents, M., Sharma, S., Burke, D., Giovanis, A.
Journal of Osteopathic Medicine, 2021/12
492

A Pilot Study to Examine Medical Students’ Perception of their Osteopathic Manipulative Therapy Education
Mazzi, J., Leavitt, N., Kisby, G.
Journal of Osteopathic Medicine, 2021/12
493

Improving Upon Osteopathic Palpatory Skills using a 3D Printed Rotational Lumbar Spine Model
Rey, T., Thomas, A., Nolin, J., Sanders, J. G., Cedoz, K., Berwick, R.
Journal of Osteopathic Medicine, 2021/12
494

The Importance of Dermatology Education During Osteopathic Preclerkship Curriculum
Tan, V., Schukow, C., Vitale, V., Restini, C.
Journal of Osteopathic Medicine, 2021/12
495

MD and DO: Differing Medical Degrees and the Associated Perceptions
Harfouch, N., Grunhut, J., Hsu, A., Pinsky, S., Chacko, J., Raden, M., Slanetz, P. J., Sarkany, D.
Current Problems in Diagnostic Radiology, 2021/11
496

“If you don't use or understand visceral osteopathy you're not a real osteopath“: Professional identity in Australian osteopathy through the lens of a single traditional technique
Grace, S., Fleischmann, M., Vaughan, B.
Explore (NY), 2021/11
497

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text
498

Analyzing the cost of medical student virtual conference registration by specialty during the COVID-19 pandemic
Veyg, D., Gurevich, R.
Journal of Osteopathic Medicine, 2021/11
Free full text
499

A Missing Voice: The Lingual Complex and Osteopathic Manual Medicine in the Context of Five Osteopathic Models
Bordoni, B., Escher, A. R.
Cureus, 2021/10
Free full text
500

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text
501

Comprehensive Reform and Greater Equity in Applying to Residency-Trainees' Mixed Responses to a Pass/Fail USMLE Step 1
Ganesh Kumar, N., Pontell, M. E., Makhoul, A. T., Drolet, B. C.
Journal of Graduate Medical Education, 2021/10
Free full text
502

Geist-Körper-Interdependenz in der osteopathischen Behandlung
(Mind-body interdependence in osteopathic treatment)
Liem, T., Van Den Heede, P.
Osteopathische Medizin, 2021/09
503

Klassische Osteopathie – ein ganzheitlicher Ansatz
(Classical osteopathy - a holistic approach)
Williams, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
504

The Challenges of Implementing a Joint Interprofessional Education Program Between a Pharmacy College and an Osteopathic Medical College: A Case Study
Huggins, C., Basu, P., Senhaji-Tomza, B., Warwick, S., Anthony, M. E.
International Journal of Osteopathic Medicine, 2021/09
505

Wissenschaft und Forschung in der Osteopathie: Teil 1: Der Begriff der Wissenschaft in der Osteopathie
(Science and research in osteopathy - Part 1: The concept of science in osteopathy)
Stecker, D., Scheuchl, F.
Osteopathische Medizin, 2021/09
506

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text
507

Embracing industry sponsored research to expand osteopathic medical student research experiences
Morehouse, Z. P., Nash, R. J.
Journal of Osteopathic Medicine, 2021/09
Free full text
508

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09
509

Kognitive Fähigkeiten und Berufsrollen von Osteopath*innen nach A.T. Still: Teil 1: Philosophisch-ethischer Hintergrund
(Cognitive skills and professional roles of osteopaths according to A.T. Still - Part 1: Philosophical-ethical background)
Engel, M., Krause, K. C.
Osteopathische Medizin, 2021/09
510

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09
511

Resident opinions of diabetes management in training: a survey
Healy, A. M., Uhrig, J. L., Shubrook, J. H., Aung, N. L., Sadhu, A. R.
Journal of Osteopathic Medicine, 2021/09
Free full text
512

Practicing Medicine in Underserved Areas: Differences that Make a Difference in Vocational Anticipatory Socialization
Walker, T. M.
Unpublished PhD thesis, 2021/08
Free full text
513

Practitioner and practice characteristics of Australian osteopaths who discuss lifestyle factors with patients: Findings from a national practice-based research network
Adams, J., Sibbritt, D., Steel, A., Peng, W.
Health & Social Care in the Community, 2021/08
514

Response to “COMSAE phase 1: value added“
Sandella, J. M., Craig, B., Tsai, T. H., Fleury, M., Clem, A.
Journal of Osteopathic Medicine, 2021/08
Free full text
515

COMSAE Phase 1: value added
Sefcik, D., Petsche, E. M.
Journal of Osteopathic Medicine, 2021/08
Free full text
516

Single Accreditation Does Not Mean Double Jeopardy for Osteopathic Medical Students
Gimpel, J. R.
Academic Medicine, 2021/08
Free full text
517

Arkansas College of Osteopathic Medicine Simulated Emergency Response Team: A Student Driven Pilot Program
Newman, C. W., Ackerman, R., Brown, T., Ramsey, H., Spector, D., Carson, J., Sanders, K., Daniels, D., Potts, H.
Southern Medical Journal, 2021/08
518

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text
519

Implications of the United States Medical Licensing Examination Step 1 Examination Transition to Pass/Fail on Medical Students Education and Future Career Opportunities
Ehrlich, H., Sutherland, M., McKenney, M., Elkbuli, A.
The American Surgeon, 2021/08
520

Effect of a required online graded curriculum in the clerkship years on medical student national standardized examination performance
Glaser, K., Pazdernik, V. K., Sackett, D., Sheridan, V.
Journal of Osteopathic Medicine, 2021/08
Free full text
521

White Coat Remediation: Understanding Medical Students’ Academic Remediation Experiences
Daly, L. E.
Unpublished PhD thesis, 2021/08
Free full text
522

Reconsidering the Role of Synchronous Feedback in Learning Diagnostic Skills: Identifying the Impact of the Instructor
Jarman, S.
Unpublished MSc thesis, 2021/07
Free full text
523

Osteopathic Principles and Practice: Essential Training for the Primary Care Physician of Today and Tomorrow
Misra, S.
Family medicine, 2021/07
Free full text
524

Physician wellbeing - what do physicians want?
Ryan, E. P.
Journal of Osteopathic Medicine, 2021/07
Free full text
525

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text
526

Knowledge of osteopathic manipulative medicine and osteopathic physicians in a New York South Asian community
Lee, J., Maung, C., Espares, J., Chen, J., Yip, F., Lin, W., Zhao, L., Li, T. S.
Journal of Osteopathic Medicine, 2021/07
Free full text
527

Adverse childhood experiences and trauma informed care: treating the whole patient with a more complete osteopathic approach
Marcoux, T. B.
Journal of Osteopathic Medicine, 2021/07
Free full text
528

Cultural self-awareness: An analysis of the cultural self-awareness in student osteopaths at the Unitec Institute of Technology in Aotearoa/New Zealand
Solomon, C.
Unpublished MSc thesis, 2021/07
Free full text
529

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07
530

The use of visceral techniques in Australian osteopathic practice: A descriptive cross-sectional study
Fleischmann, M., Vaughan, B., Grace, S., Stewart, A., Hart, C., Brew, E., Masters, G., Smeeton, L., Thompson, L., Brooks, M.
Advances in Integrative Medicine, 2021/07
531

Conceptions de la santé et de la pratique des manipulations vertébrales d’étudiants en ostéopathie au cours de leur formation
(Conceptions of health and spinal manipulation practice of osteopathic students during their training)
Javerliat, P.
Unpublished PhD thesis, 2021/06
Free full text
532

Efficacy of implementing intermittent STOP THE BLEED® reviews on long term retention of hemorrhage control skills of first year medical students
Sainbayar, E., Holt, N., Jacobson, A., Bhatia, S., Weaver, C.
Journal of Osteopathic Medicine, 2021/06
Free full text
533

“Understanding patients' narratives” A qualitative study of osteopathic educators’ opinions about using Medical Humanities poetry in undergraduate education
Maretic, S., Abbey, H.
International Journal of Osteopathic Medicine, 2021/06
534

The development and application of a remediation process in an osteopathic curriculum
Aubin, A., Boulanger, C., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2021/06
535

Inclusivity and accessibility in undergraduate osteopathic education for students with disability: A scoping review
MacMillan, A., Corser, A., Clark, Z.
International Journal of Osteopathic Medicine, 2021/06
536

The importance of osteopathic physician scientist training programs
Doyle, S. J.
Journal of Osteopathic Medicine, 2021/06
Free full text
537

Diversity and Inclusion on General Surgery, Integrated Thoracic Surgery, and Integrated Vascular Surgery Residency Program Websites
Mortman, R., Frazier, H. A., Haywood, Y. C.
Journal of Graduate Medical Education, 2021/06
Free full text
538

Albrecht Kaisers Appell wird nicht gehört
(Albrecht Kaiser's appeal is not heard)
Sonntag, M.
Osteopathische Medizin, 2021/06
539

(Albrecht Kaiser's appeal is not heard)
Albrecht Kaisers Appell wird nicht gehört
Sonntag, M.
Osteopathische Medizin, 2021/06
540

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 2: Diagnostik und Therapie
(Positional plagiocephaly and its osteopathic intervention. Part 2: Diagnostics and therapy)
Engel, M.
Osteopathische Medizin, 2021/06
541

The Pediatric Workforce: Recent Data Trends, Questions, and Challenges for the Future
Vinci, R. J.
Pediatrics, 2021/06
542

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06
543

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text
544

Scholar 12: Beta Trial of an Osteopathic Research Cultural Development Computer Application
Rowane, M.J., Hellmann, D. E., Branning, R. A., Cola, H. M., Fahoum, J. M., Snyder, B. M., Healy, A. M., Qi-Lytle, X., Rowane, M. P., Terrell, M. A., Hostoffer, R. W.
The AAO Journal, 2021/06
Free full text
545

Current state of nutrition and nutritional supplement training in medical schools
Lowther, D. P.
Unpublished PhD thesis, 2021/05
Free full text
546

The importance of epistemological consideration in the reporting of evidence for osteopathic care in Covid-19 papers
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/05
Free full text
547

Organizational behavior among academic medical school faculty
Hoegerl, C.
Journal of Osteopathic Medicine, 2021/05
Free full text
548

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
549

Osteopathic Medicine: What Radiologists Need to Know
Gunderman, L. D., Gunderman, R. B.
Academic Radiology, 2021/05
550

Die Phänomenologie als wissenschaftliche Grundlage der Osteopathie
(Phenomenology as the scientific basis of osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/04
551

Evidence-based assessment of potential therapeutic effects of adjunct osteopathic medicine for multidisciplinary care of acute and convalescent COVID-19 patients
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/04
Free full text
552

Dietary views and habits of students in health professional vs. non-health professional graduate programs in a single university
Downing, M. A., Bazzi, M. O., Vinicky, M. E., Lampasona, N. V., Tsvyetayev, O., Mayrovitz, H. N.
Journal of Osteopathic Medicine, 2021/04
Free full text
553

Telemanagement of Home-Isolated COVID-19 Patients Using Oxygen Therapy With Noninvasive Positive Pressure Ventilation and Physical Therapy Techniques: Randomized Clinical Trial
Adly, A. S., Adly, M. S., Adly, A. S.
Journal of Medical Internet Research, 2021/04
Free full text
554

Teleclerkships? The role of telemedicine in medical student education during COVID-19 and beyond
Vadhan, J. D., Crispino, L. J., Carmody, J. B.
Journal of Osteopathic Medicine, 2021/04
Free full text
555

Direct measurement of the rhythmic motions of the human head identifies a third rhythm
Rasmussen, T. R., Meulengracht, K. C.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text
556

Formation and development of osteopathy as a scientific discipline
(Становление и развитие остеопатии как научной дисциплины)
Novikov, Y. O., Mokhov, D. E., Tregubova, E. S.
Russian Osteopathic Journal, 2021/04
Free full text
557

Using contact-based education to destigmatize opioid use disorder among medical students
Mort, S. C., Díaz, S. R., Beverly, E. A.
Teaching and Learning in Medicine, 2021/04
558

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04
559

Mentors’ experiences in an osteopathic medical student research program
Hamby, T., Bowman, W. P., Wilson, D. P., Basha, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
560

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 1: Die Grundlagen
(Positional plagiocephaly and its osteopathic intervention. Part 1: Basics)
Engel, M.
Osteopathische Medizin, 2021/03
561

The Philadelphia surgery conference: a value analysis of a hands-on surgical skill-building event
DiPasquale, L., Libera, R., Do-Nguyen, C. C., Brehman, E., Tatagari, V., Waring, H., Appelt, D., Sesso, A.
Journal of Osteopathic Medicine, 2021/03
Free full text
562

Predictors of research self efficacy in first-year osteopathic medical students
Jacobs, R. J., Kane, M. N.
International Journal of Osteopathic Medicine, 2021/03
563

The Impact of the ACGME/AOA Single Accreditation System on Osteopathic Surgical Specialties, Residents, and DO Students
Cummings, M.
Journal of Surgical Education, 2021/03
564

Objectivation of an Educational Model in Cranial Osteopathy Based on Experience
Requena-García, J., García-Nieto, E., Varillas-Delgado, D.
Medicina (Kaunas), 2021/03
565

Impact of different types of revision materials on the learning of musculoskeletal techniques
Launay, F., Ménard, M., Bourgin, M., Mhadhbi, H., Sutre, F., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2021/03
566

Abwehrreaktionen aus Sicht der viszeralen Osteopathie – Teil 2: Diskussion und Implikationen für die viszerale Osteopathie
(Defense reactions from the perspective of visceral osteopathy - Part 2: Discussion and implications for visceral osteopathy)
Wyvekens, J., Wyvekens, M., Hirth, T.
Osteopathische Medizin, 2021/03
567

Thomas L. Northup Lecture: Accepting the Death of Osteopathy: A New Beginning
Jealous, J. S.
The AAO Journal, 2021/03
Free full text
568

Poor match rates of osteopathic applicants into ACGME dermatology and other competitive specialties
Craig, E., Brotzman, E., Farthing, B., Giesey, R., Lloyd, J.
Journal of Osteopathic Medicine, 2021/03
Free full text
569

Osteopathic students and graduates matching into pathology residency, 2011–2020
Jajosky, R. P., Coulson, H. C., Rosengrant, A. J., Jajosky, A. N., Jajosky, P. G.
Journal of Osteopathic Medicine, 2021/02
Free full text
570

The history of medical education: a commentary on race
Daher, Y., Austin, E. T., Munter, B. T., Murphy, L., Gray, K.
Journal of Osteopathic Medicine, 2021/02
Free full text
571

The flipped classroom: a novel approach to physical examination skills for osteopathic medical students
Bhai, S. A., Poustinchian, B.
Journal of Osteopathic Medicine, 2021/02
Free full text
572

Diversity in osteopathic medical school admissions and the COMPASS program
Dady, N., Mungroo, K. A., Young, T., Akinsanya, J., Forstein, D.
Journal of Osteopathic Medicine, 2021/02
Free full text
573

Predictors of emotional wellbeing in osteopathic medical students in a COVID-19 world
Jacobs, R., Lanspa, M., Kane, M., Caballero, J.
Journal of Osteopathic Medicine, 2021/02
Free full text
574

Mindfulness: Principles and Application to Decrease Opiate Use in Primary Care With an Osteopathic Component
Frasca, D. J.
Osteopathic Family Physician, 2021/02
Free full text
575

Should Osteopathic Medical Students Take the USMLE?
Lenchus, J.
Academic Medicine, 2021/02
Free full text
576

Education, Perceptions, and Delivery: Factors Shaping the Perceived Role in the Pre-Exposure Prophylaxis (PrEP) Care Continuum Among a Sample of Osteopathic Medical Students
O'Neil, A. M., Meyers, H. J., DeBoy, K. R., Stowe, M., Hamrick, J., Giano, Z., Hubach, R. D.
AIDS Education and Prevention, 2021/02
577

Associations between stress, anxiety, depression, and emotional intelligence among osteopathic medical students
Doyle, N. A., Davis, R. E., Quadri, S. S. A., Mann, J. R., Sharma, M., Wardrop, R. M., Nahar, V. K.
Journal of Osteopathic Medicine, 2021/02
Free full text
578

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Spanish osteopaths
Alvarez, G., Justribo, C., Sundberg, T., Thomson, O. P., Leach, M. J.
BMC Health Services Research, 2021/02
Free full text
579

Forschung in der Osteopathie. Eine qualitative, phänomenologische und systematische Studie.
(Research in Osteopathy. A qualitative, phenomenological and systematic study.)
Stecker, D.
unpublished MSc thesis, 2021/02
Free full text
580

Die Osteopathie aus Sicht der Allgemeinmediziner – eine qualitative Interviewstudie
(Osteopathy from the point of view of general practitioners - a qualitative interview study)
Waubert de Puiseau, A., Hörcher, M., Belz, S., Esch, S.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
581

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01
582

Transforming a clerkship with telemedicine
Bhatia, R. K., Cooley, D., Collins, P. B., Caudle, J., Coren, J.
Journal of Osteopathic Medicine, 2021/01
Free full text
583

Journal of Osteopathic Medicine: a refreshed and refocused publication for our profession
Zafonte, R. D.
Journal of Osteopathic Medicine, 2021/01
Free full text
584

A Class By Themselves: Texas' Newest Med Schools Adjust to COVID-19
Price, S.
Texas Medicine, 2021/01
585

Perceptions of the Osteopathic Profession in New York City's Korean Communities
Justin Chin, D. O., Haeinn Woo, Oms-Iv, Diane Choi, O. M. S., III, Emily Dube, M. S., Mikhail Volokitin, Md Do, Christine Lomiguen
Osteopathic Family Physician, 2021/01
Free full text
586

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text
587

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text
588

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text
589

Professionnalisation des formateurs en ostéopathie à travers l'analyse de leur activité
(Professionalization of osteopathic teachers through analysis of their activity)
Garnier, F.
Unpublished PhD thesis, 2020/12
Free full text
590

Psychosomatische Osteopathie bei Trauma am Beispiel der bifokalen Integration
(Psychosomatic osteopathy in trauma using the example of bifocal integration)
Liem, T., Neuhuber, W.
Osteopathische Medizin, 2020/12
591

The importance of rigour in the reporting of evidence for osteopathic care in Covid-19 papers
Draper-Rodi, J., Vaucher, P., Thomson, O. P.
Explore (NY), 2020/12
Free full text
592

Comparison of State Medical Licensing Board Disclosures Regarding Resident Performance for United States Allopathic, Osteopathic, and Foreign Medical Graduates
Gajewski, M., Hillen, M., Matassa, D., Kunac, A., Anana, M., Pompeo, L., Kothari, N., Murano, T.
The Journal of the American Osteopathic Association, 2020/12
Free full text
593

Osteopatia in Italia. Passato, presente e prospettive future: parte I
(Osteopathy in Italy. Past, present and future perspectives. Part 1)
Civitillo, C., Marasco, M. L., D&rsquo, Onofrio, R.
GIOSBE Journal, 2020/12
Free full text
594

Wissenschaftlich fundiert oder fragwürdiger Mythos?: Osteopathische Behandlungserfolge im Vergleich zur Schulmedizin während der Spanischen Grippe in den USA
(Scientifically substantiated or questionable myth?: Comparison between osteopathic treatment successes and conventional medicine during the Spanish flu in the USA)
Schwerla, F., Franke, H.
Osteopathische Medizin, 2020/12
595

Motivating High School Students From Rural Areas to Attend College and Pursue Careers as Osteopathic Physicians
Kadavakollu, S., Shindi, R. S., Nummerdor, H. R., Singh, V. K., Pillai, S. B., Ontiveros, S. J., Boyanovsky, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
596

Training Osteopathic Medical Students for Drastic 2021 Health Record Documentation Policy Changes
Bains, R., Gill, A., Singh, J., Antos, A., Lim, S., Molga, H., Malik, A., St. Pierre, S., Davis, G., Warner, M.
The Journal of the American Osteopathic Association, 2020/12
597

Hand Model Utility for Osteopathic Pelvic Diagnosis in a Remote Learning Setting
Burg, B. J., Ketigian, L. A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/12
598

Effects of the COVID-19 Pandemic on Osteopathic Medical Students’ Screen Time
Edimo, C. O., Espares, J. K., Falus, N. A., Bupathi, S. K., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12
599

Prevalence of Computer Vision Syndrome (CVS) Symptoms on Osteopathic Medical Students
Espares, J. K., Edimo, C. O., Bupathi, S. K., Falus, N. A., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12
600

Burn-out in Osteopathic Medical Students: The Effects of Meditation Before and After the Arrival of the COVID-19 Pandemic
Krishnamachari, B., Morris, A., Chinsky, R., Pendyala, R., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2020/12
601

Levels of Resilience & Coping of Osteopathic Medical Students during COVID-19: Implications for Mental Health Innovations for Physicians in Training
Lanspa, M. E., Jacobs, R. J., Patel, K. C.
The Journal of the American Osteopathic Association, 2020/12
602

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
603

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
604

Toward Resilience: Medical Students' Perception of Social Support
Casapulla, S., Rodriguez, J., Nandyal, S., Chavan, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
605

Die Brustdrüse aus osteopathischer Sicht: Teil 2: Praktische Anwendung
(The mammary gland from an osteopathic point of view - Part 2: Practical application)
Frühwein, J.
Osteopathische Medizin, 2020/12
606

[PREPRINT] “Somebody Who Does Something Other Than Osteopathy“
Sajjadi, N. B., Shepard, S.
The Journal of the American Osteopathic Association, 2020/11
Free full text
607

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
608

Status of Entrustable Professional Activities (EPA) Implementation at Colleges of Osteopathic Medicine in the United States and Future Considerations
Linsenmeyer, M., Wimsatt, L., Speicher, M., Basehore, P., Sexton, P. S.
The Journal of the American Osteopathic Association, 2020/11
609

Evaluating the quality of clinical teaching in osteopathy
Vaughan, B.
Unpublished PhD thesis, 2020/10
Free full text
610

New investigator editorial: the osteopathic medical student perspective on research
Persand, D., Maddie, N.
American Journal of Physiology. Heart and Circulatory Physiology, 2020/10
Free full text
611

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text
612

Osteopathie in Norwegen
(Osteopathy in Norway)
Becher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
613

Im Gespräch mit … Diana Stöckl
(In dialog with … Diana Stöckl)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
614

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht Teil 2: Was wirkt im Wirk-Bündnis der Osteopathie?
(Who and what constitutes connection within osteopathic treatment? A medical-philosophical contribution from the osteopathic point of view. Part 2: What works in the active alliance of osteopathy?)
Kaiser, A. K.
Osteopathische Medizin, 2020/09
615

Erweiterung des biopsychosozialen Modells für die muskuloskelettale Praxis: Teil 2: Klinische Bedeutung für die muskuloskelettale Behandlung (German translation)
(Extension of the biopsychosocial model for musculoskeletal practice. Part 2: Clinical significance for musculoskeletal treatment)
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
Osteopathische Medizin, 2020/09
616

Aquatic Osteopathy Treatment Assessment by Infrared Thermography on Healthy Subjects After Thermoneutral Water Immersion
Maxel, X., Girollet, F., Stubbe, L., Boudot, E., Darraillans, L., Bodnar, J. L.
Journal of Chiropractic Medicine, 2020/09
Free full text
617

„Der Dampf des Lebens“: Das Blut im Kontext der (klassischen) Osteopathie
“The steam of life“: The blood in the context of (classical) osteopathy
Engel, M.
Osteopathische Medizin, 2020/09
618

Osteopathie für Neugeborene in der Klinik?: Eine qualitative Studie
Osteopathy for newborns in hospitals?: A qualitative study
Brintrup, V., Hartmann, M., Herrmann, H., Belz, S., Esch, S.
Osteopathische Medizin, 2020/09
619

Die Brustdrüse aus osteopathischer Sicht: Teil 1: Grundlagen
(The mammary gland from an osteopathic point of view. Part 1: Fundamentals)
Frühwein, J.
Osteopathische Medizin, 2020/09
620

Utilizing Health Professional Students’ Knowledge, Attitudes, and Beliefs to Inform the Development of a Contact-Based Educational Approach to Address the Opioid Epidemic
Mort, S. C.
Unpublished PhD thesis, 2020/08
Free full text
621

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text
622

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text
623

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text
624

Vestibular failure managed with osteopathic manipulative treatment: A report of two cases
Origo, D., Tarantino, A. G., Romagnoli, M.
Journal of Bodywork and Movement Therapies, 2020/07
625

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07
626

Services and staffing practices in academic health sciences libraries serving college of osteopathic medicine programs: a mixed methods study
Muellenbach, J. M., Duncan, W. C., Vanier, C., Ennis, L. A., Yang, A.
Journal of the Medical Library Association, 2020/07
Free full text
627

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht, Teil 1: Was ist ein Osteopath?
(Who and what work in the effective therapeutic alliance of osteopathy? - A medical-philosophical contribution from the point of view of osteopathy. Part 1: What is an osteopath?)
Kaiser, A. K.
Osteopathische Medizin, 2020/06
628

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
629

OMT bei der Behandlung von Infektionskrankheiten zu Beginn des 20. Jahrhunderts: Mit Anmerkungen aus aktuellen Forschungen und Behandlungsmodalitäten
(OMT in the treatment of infectious diseases at the beginning of the 20th century: With comments from current research and treatment modalities)
Liem, T.
Osteopathische Medizin, 2020/06
630

‘We need one more hour solely based on anatomy… Give us anatomy!’: Early-year learner perceptions of anatomy within an integrated & case-based learning osteopathy curriculum
Johnston, S. L., Vaughan, B.
International Journal of Osteopathic Medicine, 2020/06
631

Das Konzept „Hotelzimmer Uterus” möchte als anschauliche Allegorie dem Osteopathen und der (werdenden) Mutter aufzeigen, dass potenzielle Schockenergien, insbesondere in den Uteruswänden, einen negativen Effekt auf ein Ungeborenes haben oder sogar eine erfolgreiche Schwangerschaft verhindern kann. Es werden insbesondere Themen wie Kindsverlust und sexuelle Übergriffe angesprochen, da sie erfahrungsgemäß am ehesten gespeicherte (potenzielle) Schockenergien im gynäkologischen System hinterlassen. Das Phänomen Schockenergie wie auch die therapeutischen Ansätze zu deren Ausleitung werden kurz erläutert, insbesondere auch eventuelle Risiken bei der Behandlung in der Schwangerschaft.
(Shock in the uterus: The “hotel room“ phenomenon)
Muntinga, E.
Osteopathische Medizin, 2020/06
632

Does Empathy Decline in the Clinical Phase of Medical Education? A Nationwide, Multi-Institutional, Cross-Sectional Study of Students at DO-Granting Medical Schools
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
Academic Medicine, 2020/06
Free full text
633

Pain knowledge, attitudes and beliefs of Australian osteopaths drawn from a nationally representative sample of the profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Austin, P.
Journal of Bodywork and Movement Therapies, 2020/06
634

Kleine Geburten – und wie wir sie begleiten können
(Miscarriages - and how we can attend to them)
Wikus, P., Ossberger, C.
Osteopathische Medizin, 2020/06
635

Chiropractic and osteopathic students' perceptions of readiness for transition to practice: The educational value of university clinic vs community and private clinics
Haworth, N. G., Horstmanshof, L., Moore, K. M.
The Journal of Chiropractic Education, 2020/06
Free full text
636

Osteopathic medicine: A judicial section for one specific profession
Beaume, S.
Medecine et Droit, 2020/06
637

PROMIS® General Life Satisfaction scale: construct validity in musculoskeletal pain patients
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/06
Free full text
638

Efficacy of osteopathic manipulative treatment on postural control in Parkinsonian patients with Pisa syndrome: A pilot randomized placebo-controlled trial
Zarucchi, A., Vismara, L., Frazzitta, G., Mauro, A., Priano, L., Maestri, R., Bergna, A., Tarantino, A. G.
NeuroRehabilitation, 2020/06
639

Osteopathic Manipulative Medicine Practice Patterns of Third-Year and Fourth-Year Osteopathic Medical Students: An Educational Research Project
Snider, K. T., Couch, R., Bhatia, S.
The Journal of the American Osteopathic Association, 2020/05
Free full text
640

Double Jeopardy: The USMLE for Osteopathic Medical Students
Ahmed, H., Carmody, J. B.
Academic Medicine, 2020/05
Free full text
641

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text
642

Osteopathie auf dem Prüfstand
[Osteopathy under scrutiny]
Dräger, K., Heller, R.
Bundesgesundheitsblatt Gesundheitsforschung Gesundheitsschutz, 2020/05
643

Doctors Wanted: Women Encouraged to Apply. A Historical Analysis of Women in Osteopathic Medical Education
Karacay, K. C.
Unpublished PhD thesis, 2020/05
644

Transitions in Undergraduate Medical Education
Baker, J., Wright, A.
The Journal of the American Osteopathic Association, 2020/05
645

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04
646

Understanding the professional identity development of undergraduate osteopathic students in the UK
McKenna, B.
Unpublished PhD thesis, 2020/04
Free full text
647

More Information on Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/04
Free full text
648

Severe Postoperative Chronic Constipation Related to Anorectal Malformation Managed with Osteopathic Manipulative Treatment
Vismara, L., Cozzolino, V., Pradotto, L. G., Gentile, R., Tarantino, A. G.
Case Reports in Gastroenterology, 2020/04
Free full text
649

Empathy in MedicineCultivating an Empathetic Professional Identity in Osteopathic Medical Students Through Service Learning: A Qualitative Analysis of Reflective Essays
Chrisman-Khawam, L. M., Manzi, J. A.
The Journal of the American Osteopathic Association, 2020/04
Free full text
650

A new perspective for Somatic Dysfunction in Osteopathy: the Variability Model
Bergna, A., Vismara, L., Parravicini, G., Farra, F.
Journal of Bodywork and Movement Therapies, 2020/03
651

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text
652

Life satisfaction and musculoskeletal complaints in a population seeking osteopathy care: consecutive sample of 611 patients
Vaughan, B., Mulcahy, J., Allen, T., Coupe, E., Gobbo, D., Nasser, L., Pain, K., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/03
653

Can referrals to a pediatric Osteopathic Manipulative Medicine (OMM) clinic be increased through provider education?
Sinha, A., Jimenez, E. Y.
UNMs Digital Repository, 2020/03
654

Pre-professional reflective practice: Strategies, perspectives and experiences
McLeod, G. A., Vaughan, B., Carey, I., Shannon, T., Winn, E.
International Journal of Osteopathic Medicine, 2020/03
655

The Intraosseous Dysfunction in the Osteopathic Perspective: Mechanisms Implicating the Bone Tissue
Bicalho, E.
Cureus, 2020/03
Free full text
656

Etude exploratoire de la sante musculo-squelettique du rachis d'etudiants en osteopathie.
[Exploratory study on spinal musculoskeletal health of osteopathy students]
Javerliat, P., Pizon, F., Gerbaud, L.
Revue d'epidemiologie et de sante publique, 2020/02
657

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
658

Attitudes Toward Osteopathic Recognition Under the Single GME Accreditation System: A Survey of Deans at Colleges of Osteopathic Medicine and Chairs of Osteopathic Manipulative Medicine Departments
Dougherty, J. J., Bray, N. N., Vanier, C. H.
The Journal of the American Osteopathic Association, 2020/01
Free full text
659

Perceptions of the osteopathic profession in New York City’s Chinese Communities
Chin, J., Li, S., Yim, G., Zhou, Y. Q., Wan, P., Dube, E., Volokitin, M., Sahni, S., Terrell, M., Lomiguen, C.
Family Medicine and Community Health, 2020/01
Free full text
660

The architecture and spatial organization of the living human body as revealed by intratissular endoscopy – An osteopathic perspective
Armstrong, C.
Journal of Bodywork and Movement Therapies, 2020/01
Free full text
661

The use of complementary medicine in palliative care in France: an observational cross-sectional study
Filbet, M., Schloss, J., Maret, J.-B., Diezel, H., Palmgren, P. J., Steel, A.
Supportive care in cancer, 2020/01
662

Determinants of health, health behaviours and demographic profile of patients attending an Australian university student-led osteopathy clinic
Vaughan, B., Fitzgerald, K., Fleischmann, M., Mulcahy, J.
Chiropractic & Manual Therapies, 2020/01
Free full text
663

Im Gespräch mit … Professor Karl-Ludwig Resch
(In dialog with...Professor Karl-Ludwig Resch)
Engemann, K. Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
664

Global review of osteopathic medicine and osteopathy 2020
, 2020
665

Influence of Future Prescribers’ Personal and Clinical Experiences With Opioids on Plans to Treat Patients With Opioid Use Disorder
Mort, S. C., Díaz, S. R., Miller, C., Bowlby, M., Henderson, D., Beverly, E. A.
The Journal of the American Osteopathic Association, 2019/12
Free full text
666

An Osteopathic Approach to Traumatically Induced Mechanical Dyspnea: A Case Report
Kanze, D. M.
The AAO Journal, 2019/12
Free full text
667

Characteristics, Opportunities, and Challenges of Osteopathy (COCO) in the Perceptions of Osteopaths in Germany, Austria, and Switzerland: Protocol for a Comprehensive Mixed Methods Study
Porthun, J., Manschel, J.
JMIR Research Protocols, 2019/12
Free full text
668

Self-directed learning and practice of Italian osteopathic students during summer break: a cross-sectional survey
D'Alessandro, G., Consorti, G., Cerritelli, F.
BMC Complementary and Alternative Medicine, 2019/12
Free full text
669

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12
670

Perceptions and Awareness of Osteopathic Medicine Among Students in Other Health Professions
Dyches, R. P., Ruck, L. D., Stein, A. B., Gailius, G. C., Worden, K.
The Journal of the American Osteopathic Association, 2019/12
671

Meditation and Empathy in Osteopathic Medical Students: A Longitudinal Randomized Controlled Trial
Krishnamachari, B., Ramya, P., Shermon, S., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2019/12
672

Osteopathic Medical Students: Promoting Physical Activity
Law, A., Hollar, L., Sklar, E., Sprague, P.
The Journal of the American Osteopathic Association, 2019/12
673

The Efficacy of Treating Thoracic Cage Counterstrain Tender Points With Varied Mobile Point Time Durations in a Classroom Setting
Smith, J. M., Docherty, J., Kooyman, P., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12
674

Experience with and perception of research among first year osteopathic medical students
Jackson, K., Ogunbekun, O., Zahl, S., Lowery, J.
Poster presentation, 2019/11
675

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10
676

Medical Students' Knowledge About Children With Disabilities, Special Education Laws, and Social Services: A Preliminary Scale Development and Pilot Study
Vitalone-Raccaro, N., Sheppard, M. E., Kaari, J. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text
677

Effects of Osteopathic Visceral Treatment in Patients with Gastroesophageal Reflux: A Randomized Controlled Trial
Eguaras, N., Rodriguez-Lopez, E. S., Lopez-Dicastillo, O., Franco-Sierra, M. A., Ricard, F., Oliva-Pascual-Vaca, A.
Journal of Clinical Medicine, 2019/10
678

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10
679

Exploring the lived experience of osteopathy students making the transition from working in student clinic (8 hours per week) to working full-time (40 hours per week) during the summer holiday break
Garelja, D.
Unpublished MSc thesis, 2019/10
Free full text
680

Rezidivierende Harnwegsinfekte und Reizblase
(Recurrent urinary tract infections and irritable bladder)
Kilian-von Hofe, K.
Osteopathische Medizin, 2019/09
681

Engaging with evidence-based practice in the osteopathy clinical learning environment: A mixed methods pilot study
Vaughan, B., Grace, S., Gray, B., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2019/09
682

Developing teamwork skills in pre-registration osteopathy education: A qualitative pilot investigation
Vaughan, B., Grace, S., Yoxall, J.
International Journal of Osteopathic Medicine, 2019/09
683

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text
684

Evaluating the Influence of Research on Match Success for Osteopathic and Allopathic Applicants to Residency Programs
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M., Roberts, M. B.
The Journal of the American Osteopathic Association, 2019/09
Free full text
685

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text
686

Osteopathic approach with a patient undergoing cardiac transplantation: the five diaphragms
Bordoni, B., Morabito, B., Simonelli, M., Nicoletti, L., Rinaldi, R., Tobbi, F., Caiazzo, P.
International medical case reports journal, 2019/09
Free full text
687

Patient Education of Osteopathic Manipulative Medicine as a Gateway to Treatment: A Pilot Study
Majetich, S. A., Majetich, M. W., Clegg, J. M., Ratay, S. M.
The AAO Journal, 2019/09
Free full text
688

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09
689

Enhancing Culturally Sensitive Curriculum in an Osteopathic Medical School
Lopez-Hernandez, G. Y.
Missouri Medicine, 2019/09
Free full text
690

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text
691

Expanding options: Supporting skills transfer from a post-graduate osteopathy program to clinical practice
Macfarlane, C., Cornall, D.
International Journal of Osteopathic Medicine, 2019/09
692

Introduction to Clerkship: Bridging the Gap Between Preclinical and Clinical Medical Education
Butts, C. A., Speer, J. J., Brady, J. J., Stephenson, R. J., Langenau, E., DiTomasso, R., Fresa, K., Becker, M., Sesso, A.
The Journal of the American Osteopathic Association, 2019/09
693

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy for somatoform disorders - a systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
694

Using the Multitheory Model to Predict Initiation and Sustenance of Physical Activity Behavior Among Osteopathic Medical Students
Nahar, V. K., Wilkerson, A. H., Stephens, P. M., Kim, R. W., Sharma, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
695

Ergojump evaluation of the explosive strength in volleyball athletes pre- and post-fascial treatment
Buscemi, A., Petralia, M. C., Ramaci, T., Rapisarda, A., Provazza, C., Di Corrado, D., Perciavalle, V., Perciavalle, V., Coco, M.
Experimental and Therapeutic Medicine, 2019/08
Free full text
696

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
697

Influence of Osteopathic Medical Students’ Personal Health on Attitudes Toward Counseling Obese Pediatric Patients
Whipps, J., Mort, S. C., Beverly, E. A., Guseman, E. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text
698

Novel Approach to Introducing an Ultrasonography Curriculum With Limited Instructor Resources
Evans, D. K., Thiessen, M. E. W.
The Journal of the American Osteopathic Association, 2019/08
Free full text
699

Empathy in Medicine National Norms for the Jefferson Scale of Empathy: A Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text
700

WVSOM Anatomy Lab Tour Program: An Osteopathic Medicine Pipeline With Student Teaching Opportunities
Wines, K. S.
The Journal of the American Osteopathic Association, 2019/07
Free full text
701

Student academic performance factors affecting matching into first-choice residency and competitive specialties
Mitsouras, K., Dong, F., Safaoui, M. N., Helf, S. C.
BMC Medical Education, 2019/07
Free full text
702

Differences in Function and Comorbidities Between Older Adult Users and Nonusers of Chiropractic and Osteopathic Manipulation: A Cross-sectional Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2019/07
703

Simulation can offer a sustainable contribution to clinical education in osteopathy
Fitzgerald, K. M., Denning, T., Vaughan, B., Fleischmann, M. J., Jolly, B. C.
Chiropractic & Manual Therapies, 2019/07
Free full text
704

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text
705

The Combined Shoulder Technique: A Novel Approach in the Treatment of Scapular Dysfunction—A Case Report
Kanze, D. M.
The AAO Journal, 2019/06
Free full text
706

Restoring Full Squat Range of Motion by Applying OMT to Superior Innominate Shear: A Case Report
Lewis, D. D., Pickos, J.
The AAO Journal, 2019/06
Free full text
707

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06
708

Osteopathische Medizin: Versuch einer zeitgemäßen Definition
(Osteopathic medicine: Attempt at a contemporary definition)
Mayer, J., Pelz, H., Riedel, M.
Osteopathische Medizin, 2019/06
709

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06
710

Identifying a need and knowledge gap of osteopathic medicine in pediatric oncology providers
Belsky, J., Stanek, J., Gerhardt, C., Rose, M.
Pediatric Blood & Cancer, 2019/06
711

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06
712

Étude randomisée monocentrique évaluant l’efficacité de l’ostéopathie dans la prise en charge des douleurs chroniques après chirurgie mammaire en oncologie
(Osteopathy for chronic pain after breast cancer surgery: a monocentric randomised study)
Chvetzoff, G., Berthier, A., Blanc, E., Bourne Branchu, V., Millaret, A., Cropet, C., Pérol, D.
Bulletin du Cancer, 2019/06
713

Learning and teaching of patient-centred communication skills in allied healthcare manual therapy students: A systematic review
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2019/06
714

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06
715

A Case of Venous Thoracic Outlet Syndrome: Primary Care Review of Physical Exam Provocative Tests and Osteopathic Manipulative Technique Considerations
Yuschak, E., Haq, F., Chase, S.
Cureus, 2019/06
Free full text
716

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text
717

A National Evaluation of Scholarly Activity Requirement in Osteopathic EM Residency Programs: Survey of EM Program Directors
Kirkpatrick, A., Doran, T., Mullins, D., Gnugnoli, D., Ashurst, J.
Southern Medical Journal, 2019/05
718

Cynefin Framework for Evidence-Informed Clinical Reasoning and Decision-Making
Lunghi, C., Baroni, F.
The Journal of the American Osteopathic Association, 2019/05
Free full text
719

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05
720

Can Osteopathic Medical Students Accurately Measure Abdominal Aortic Dimensions Using Handheld Ultrasonography Devices in the Primary Care Setting?
Hower, K., Young, C. F., Wagner, A., Thorsen, D., Dugan, J.
The Journal of the American Osteopathic Association, 2019/05
Free full text
721

Comprehensive Medical College Admission Test Preparatory Course as a Strategy to Encourage Premedical Students to Pursue Osteopathic Medicine in Rural Areas
Shipley, T. W., Phu, N., Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2019/04
Free full text
722

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text
723

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text
724

Empathy, Religious Affiliation, and the Growth of Osteopathic Medicine
Cunningham, B.
Unpublished PhD thesis, 2019/04
Free full text
725

Timing of oral feeding changes in premature infants who underwent osteopathic manipulative treatment
Vismara, L., Manzotti, A., Tarantino, A. G., Bianchi, G., Nonis, A., La Rocca, S., Lombardi, E., Lista, G., Agosti, M.
Complementary Therapies in Medicine, 2019/04
726

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text
727

Evaluation of teaching in a student-led clinic environment: Assessing the reliability of a questionnaire
Vaughan, B.
International Journal of Osteopathic Medicine, 2019/03
728

Rescued Root Canal: A Case Report on OMT for Jaw Pain Following Repeat Root Canal Procedure
Fong, K. F., Rummel, T. B.
The AAO Journal, 2019/03
Free full text
729

Le modèle bio-psycho-social dans l’enseignement de l’ostéopathie : projet de recherche
(The bio-psycho-social model in osteopathic education: a research project)
Simonin, A.
Unpublished MSc thesis, 2019/03
Free full text
730

Die Kinderosteopathie aus Sicht der Kinderärzte. Eine qualitative Interview-Studie
(Pediatric osteopathy: What registered pediatricians think about it - A qualitative interview study)
Seidner, K., Belz, S.
Osteopathische Medizin, 2019/03
731

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text
732

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text
733

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text
734

Osteopathic Manipulative Treatment: A Primary Care Approach
Bodine, W. A.
American Family Physician, 2019/02
735

Assessment of the Efficacy of An Osteopathic Treatment in Infants with Biomechanical Impairments to Suckling
Herzhaft-LeRoy, J., Xhignesse, M., Gaboury, I.
Journal of Visualized Experiments, 2019/02
736

To what extent do New Zealand osteopathic students meet the national requirements for clinical record keeping: an audit
Dyer, B. D.
Unpublished MSc thesis, 2019/02
Free full text
737

Medical Degree Disparity Among Authors in Obstetrics and Gynecology Journals
Merritt, B., Simunich, T., Ashurst, J.
The Journal of the American Osteopathic Association, 2019/02
Free full text
738

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text
739

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text
740

Zentralbahnhof Thorax
(Central station: thorax)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
741

Investigating interpretation of ACC claims in an osteopathy teaching clinic
Urgert, C.
Unpublished MSc thesis, 2019/01
Free full text
742

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text
743

Osteopathic Physical Exam Findings in Chronic Hepatitis C: A Case Study
Chin, J., Francis, M., Lavalliere, J. M., Lomiguen, C. M.
Cureus, 2019/01
Free full text
744

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text
745

Exodus From the Classroom: Student Perceptions, Lecture Capture Technology, and the Inception of On-Demand Preclinical Medical Education
Ikonne, U., Campbell, A. M., Whelihan, K. E., Bay, R. C., Lewis, J. H.
The Journal of the American Osteopathic Association, 2018/12
746

Attitudes, skills and use of evidence-based practice among UK osteopaths: a national cross-sectional survey
Sundberg, T., Leach, M. J., Thomson, O. P., Austin, P., Fryer, G., Adams, J.
BMC Musculoskeletal Disorders, 2018/12
Free full text
747

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
748

Die Osteopathie nimmt noch nicht den ihr gebührenden Platz in der Welt der Medizin ein
(Osteopathy is not yet taking its appropriate place in the world of medicine. Interview with Renzo Molinari)
Engel-Schulmeyer, A.
Osteopathische Medizin, 2018/12
749

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text
750

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text
751

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text
752

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text
753

The Émigré Physicians’ Experiences Before, While, and After Attending an American Osteopathic Medical School: A Cross-Sectional, Mixed Methods Study, Convergent Design
Burg, B. J., Goldstein, L., Sheflin, K., Jeger, A.
The Journal of the American Osteopathic Association, 2018/11
754

Clinically Based OMM Competency Standards for Physicians in Residencies Designated With Osteopathic Recognition in the Single Accreditation System for GME
Cooper Rau Jr., D., Merritt, M.
The Journal of the American Osteopathic Association, 2018/11
755

The Influence of Medical School Debt on Specialty Choice: An Analysis of Colleges of Osteopathic Medicine
Dyches, R. P., Speicher, M. R.
The Journal of the American Osteopathic Association, 2018/11
756

Regulatory and practice issues related to the acquisition of practical osteopathic skills for paediatric care
Evans, B.
Unpublished MSc thesis, 2018/11
Free full text
757

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
758

Using Team-Based Learning in Osteopathic Medical Education to Improve Understanding and Communication Regarding Chronic Diseases
Harp, E., Rutledge, A.
The Journal of the American Osteopathic Association, 2018/11
759

Current Trends in COMLEX-USA Level 1 and Level 2-CE Study Resources
McMurray, M., Bires, S.
The Journal of the American Osteopathic Association, 2018/11
760

Integration of Pressure Sensors in Lumbar Palpation Education
Panchmatia, J. H., Docherty, J., Kooyman, P., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
761

Where Comfort and Confidence Diverge: Missed Opportunities for Sexual and Gender Minority Competency in Osteopathic Education
Rashid, H., Schenck-Smith, N., Weirich, E., Lenox, A., Sheikh, H., Boesler, D.
The Journal of the American Osteopathic Association, 2018/11
762

Structure and Function in Medical Education: Trend Analysis of Osteopathic Medical Student Emotional Intelligence (EI) Suggests Curricular Modifications May Improve Functional Traits
Singer-Chang, G., Dong, F., Nevins, N., Seffinger, M., Blumer, J., Darmani, N., Helf, S.
The Journal of the American Osteopathic Association, 2018/11
763

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11
764

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text
765

Professional trust in osteopathy: a theory for educational practice
Mackay Tumber, L.
Unpublished Dissertation, 2018/10
Free full text
766

An Osteopathic Approach to Diagnosis and Management of Sacroiliac Joint Dysfunction
Glover, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/10
Free full text
767

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text
768

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text
769

Osteopathic Evaluation of Urinary Retention Caused by Atypical Presentation of Invasive Cervical Cancer Mimicking Primary Urothelial Tumor
Martingano, D., Ramirez, L. C., Bjurlin, M. A.
The Journal of the American Osteopathic Association, 2018/10
Free full text
770

Meralgia paresthetica: A 5 model osteopathic approach
Torrents, M., Malik, R.
Osteopathic Family Physician, 2018/10
Free full text
771

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10
772

Validity of the Rule of Threes and Anatomical Relationships in the Thoracic Spine
Oakley, C. K., Janssen, S. A. K., Pankratz, J. P., McCumber, T. L., Treffer, K. D., Olinger, A. B.
The Journal of the American Osteopathic Association, 2018/10
Free full text
773

Empathy and Osteopathic Manipulative Medicine: Is It All in the Hands?
Rizkalla, M. N., Henderson, K. K.
The Journal of the American Osteopathic Association, 2018/09
Free full text
774

It depends on how things are to you
Vogel, S.
International Journal of Osteopathic Medicine, 2018/09
Free full text
775

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
776

Von A.T. Stills Theorie der osteopathischen Läsion zur somatischen Dysfunktion
(From A.T. Still's theory of the osteopathic lesion based on somatic dysfunction: Historical development and evidence-based models that support the current concept of somatic dysfunction)
Liem, T.
Osteopathische Medizin, 2018/09
777

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09
778

Learning through multiple lenses: analysis of self, peer, near-peer and faculty assessment of a clinical history taking task in Australia
Fitzgerald, K., Vaughan, B.
Journal of Educational Evaluation for Health Professions, 2018/09
Free full text
779

The role of osteopathy in the Swiss primary health care system: a practice review
Vaucher, P., Macdonald, R. J. D., Carnes, D.
BMJ Open, 2018/09
Free full text
780

Preparing Osteopathic Students for the Single Graduate Medical Education Accreditation System: Evaluating Factors for Match Success in Emergency Medicine
Stobart-Gallagher, M., O', Connell, A.
Western Journal of Emergency Medicine, 2018/09
Free full text
781

Association of Mindfulness With Residency Preference and Curriculum Selection in Preclinical Osteopathic Medical Students
Nayyar, N., Saggio, G., Plummer, M., Jung, M. K., Kappenberg, J.
The Journal of the American Osteopathic Association, 2018/09
Free full text
782

History of Research at Midwestern University/Chicago College of Osteopathic Medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2018/09
Free full text
783

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text
784

Die Ausübung der Gesundheitsfürsorge aus Patienten- und Therapeutensicht – eine Grounded-Theory-Analyse
(The health care practice from a patient's and practitioner's perspective - A grounded theory analysis)
Günther, F., Belz, S.
Osteopathische Medizin, 2018/09
785

Design and development of an e-learning programme: An illustrative commentary
Draper-Rodi, J., Vogel, S., Bishop, A.
International Journal of Osteopathic Medicine, 2018/09
786

Sleep and Lifestyle Habits of Osteopathic Emergency Medicine Residents During Training
Hughes, K. E., Hughes, P. G., Hughes, M. J.
The Journal of the American Osteopathic Association, 2018/08
Free full text
787

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
listed, , No authors
The Journal of the American Osteopathic Association, 2018/08
Free full text
788

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text
789

Evaluating the effectiveness of teaching osteopathy in a combined didactics setting
Eilerman, A., Keller, M. E., Hixson, D., II, Gupta
Osteopathic Family Physician, 2018/08
790

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text
791

Resident Duty Hour Restrictions: The Implications Behind the New Data Ahead of the Single Accreditation System
Berry, A. C., McClain, E. K.
The Journal of the American Osteopathic Association, 2018/08
Free full text
792

Oral Health Training in Osteopathic Medical Schools: Results of a National Survey
Simon, L., Silk, H., Savageau, J., Sullivan, K., Riedy, C.
The Journal of the American Osteopathic Association, 2018/07
Free full text
793

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07
794

Medical Students' Knowledge, Attitudes, and Behaviors With Regard to Skin Cancer and Sun-Protective Behaviors
Ivanov, N. N., Swan, A., Guseman, E. H., Whipps, J., Jensen, L. L., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text
795

UK trained osteopaths' relationship to evidence based practice - An analysis of influencing factors
Weber, V., Rajendran, D.
International Journal of Osteopathic Medicine, 2018/07
796

Blood pressure screening in an Australian osteopathy student-led clinic
Vaughan, B., Cannon, N., Davies, D., Kourtis, N., Neophitou, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2018/06
797

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text
798

First-Year Osteopathic Medical Students' Knowledge of and Attitudes Toward Physical Activity
Guseman, E. H., Whipps, J., Howe, C. A., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/06
Free full text
799

The Lancet Low Back pain series: A call to action for osteopathy?
Fitzgerald, K., Vaughan, B., Austin, P., Grace, S., Orchard, D., Orrock, P.l, Fleischmann, M.
International Journal of Osteopathic Medicine, 2018/06
800

Anastamosis
Ackert, K.
The Journal of the American Osteopathic Association, 2018/06
Free full text
801

Letter to the editor on Holism in Osteopathy - Bridging the gap between concept and practice: A grounded theory study
Morelli, R.
International Journal of Osteopathic Medicine, 2018/06
802

Reducing Health Disparities: Understanding the Unintended Effects of Health Care Professional and Patient Characteristics on Treatment
Nazione, S., Nazione, A.
The Journal of the American Osteopathic Association, 2018/06
Free full text
803

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text
804

Evidence, alternative facts and narrative: A personal reflection on person-centred care and the role of stories in healthcare
Tyreman, S.
International Journal of Osteopathic Medicine, 2018/06
Free full text
805

Palpation - Eine Fähigkeit des Gehirns?
(Palpation: An ability of the brain?)
Krause, R.
Osteopathische Medizin, 2018/05
806

Types of articles published in journals of osteopathy: a quantitative analisys from 2009 to 2013
Civitillo, C., Armeni, M., Leggio, M.
GIOSBE Journal, 2018/05
807

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05
808

A workforce survey of Australian osteopathy: analysis of a nationally-representative sample of osteopaths from the Osteopathy Research and Innovation Network (ORION) project
Adams, J., Sibbritt, D., Steel, A., Peng, W.
BMC Health Services Research, 2018/05
Free full text
809

Fibromyalgia Symptoms Reduced by Osteopathic Manipulative Medicine and Gabapentin
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
810

Cervical Osteopathic Manipulation Shown to Affect Median Nerve Function
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
811

The perceptions and experiences of osteopathic treatment among cancer patients in palliative care: a qualitative study
Steel, A., Tricou, C., Monsarrat, T., Ruer, M., Deslandes, C., Sisoix, C., Filbet, M.
Supportive Care in Cancer, 2018/05
812

Exploring the measurement properties of the osteopathy clinical teaching questionnaire using Rasch analysis
Vaughan, B.
Chiropractic & Manual Therapies, 2018/05
Free full text
813

Faculty Vitality in Osteopathic Medical Schools: A Pilot Study
Ables, A. Z., Shan, L., Broyles, I. L.
The Journal of the American Osteopathic Association, 2018/05
Free full text
814

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
815

Factors Associated With Osteopathic Primary Care Residency Choice Decisions
Dogbey, G. Y., Collins, K., Russ, R., Brannan, G. D., Mivsek, M., Sewell, S.
The Journal of the American Osteopathic Association, 2018/04
Free full text
816

Appendix 2: American Osteopathic Association Specialty Board Certification
Wieting, J. M., Williams, D. G., Kelly, K. A., Morales-Egizi, L.
The Journal of the American Osteopathic Association, 2018/04
Free full text
817

Educational avenues to promote fascia dialog in medical curricula
Pratt, R.
FASEB Journal, 2018/04
818

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text
819

Profile of osteopathic practice in Spain: Results from a standardized data collection study
Alvarez Bustins, G., López Plaza, P. V., Carvajal, S. R.
BMC Complementary and Alternative Medicine, 2018/04
Free full text
820

Assessment Considerations for Core Entrustable Professional Activities for Entering Residency
Linsenmeyer, M., Wimsatt, L., Speicher, M., Powers, J., Miller, S., Katsaros, E.
The Journal of the American Osteopathic Association, 2018/04
Free full text
821

An investigation of attitudes and underlying beliefs toward low back pain among osteopathy students using the Back Pain Attitudes Questionnaire (Back-PAQ)
Hilbink, H.
Unpublished MSc thesis, 2018/04
Free full text
822

Educational Intervention in a Medically Underserved Area
Atance, J., Mickalis, M., Kincade, B.
The Journal of the American Osteopathic Association, 2018/04
Free full text
823

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text
824

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text
825

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03
826

Increasing Self-Awareness of Medical Students Through the Use of Ultrasonography
Sandefur, K., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
827

Influence of Transverse Process Landmark Localization on Palpation Accuracy of Lumbar Spine Models
Snider, E. J., Pamperin, K., Pazdernik, V., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text
828

Tool for Predicting Medical Student Burnout From Sustained Stress Levels: Factor Analysis of the Medical Education Hassles Scale-R
Johnson, J. C., Degenhardt, B. F., Smith, C. K., Wolf, T. M., Peterson, D. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text
829

A Mokken scale analysis of the peer physical examination questionnaire
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2018/03
Free full text
830

Work-related musculoskeletal injuries among Australian osteopaths: A preliminary investigation
McLeod, G. A., Murphy, M., Henare, T. M., Dlabik, B.
International Journal of Osteopathic Medicine, 2018/03
831

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03
832

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text
833

Morphogenese
(Morphogenesis)
Leitner, M.
Unpublished MSc thesis, 2018/03
Free full text
834

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text
835

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text
836

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text
837

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text
838

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text
839

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text
840

Conceptualizing Addiction From an Osteopathic Perspective: Dopamine Homeostasis
Baron, D., Blum, K., Chen, A., Gold, M., Badgaiyan, R. D.
The Journal of the American Osteopathic Association, 2018/02
Free full text
841

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
842

Effect of Ultrasonography on Student Learning of Shoulder Anatomy and Landmarks
de Vries, K. D., Brown, R., Mazzie, J., Jung, M. K., Yao, S. C., Terzella, M. J.
The Journal of the American Osteopathic Association, 2018/01
Free full text
843

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text
844

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text
845

OMT May Be Helpful in the Management of Benign Paroxysmal Positional Vertigo
Tegeler, L., Blumer, J.
The Journal of the American Osteopathic Association, 2018/01
Free full text
846

Lymphatic Vessels Found in the Brain-Osteopathic Considerations, Part 2: Now in Humans and Monkeys
King, H. H.
The Journal of the American Osteopathic Association, 2018/01
Free full text
847

OSTMED.DR(R), an Osteopathic Medicine Digital Library
Fitterling, L., Powers, E., Vardell, E.
Medical reference services quarterly, 2018/01
848

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01
849

Gross Anatomy Education Today: The Integration of Traditional and Innovative Methodologies
Houser, J. J., Kondrashov, P.
Missouri Medicine, 2018/01
Free full text
850

Analysis of Factors that Influence Pre-med Undergraduate Selection of Osteopathic or Allopathic Medical School
Kuizin, L. A.
Unpublished Dissertation, 2018/01
851

Osteopathic Medical Education: Answering the Call
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text
852

Gratitude: Reflections and Belonging in the Osteopathic Family
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text
853

Osteopathy as an Aid to Treatment
Riedel, M.
Deutsches Ärzteblatt International, 2018/01
Free full text
854

Die Wirklichkeit der Osteopathie. Studie zu einer am Leib orientierten Anthropologie
(The reality of osteopathy. Study of an anthropology oriented to the lived body)
Kaiser, A.K.
Dissertation, 2018
855

Neurobiology of Sexual Assault and Osteopathic Considerations for Trauma-Informed Care and Practice
Cuevas, K. M., Balbo, J., Duval, K., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/12
Free full text
856

A road to somewhere - endless debate about the nature of practice, the profession and how we should help patients
Vogel, S.
International Journal of Osteopathic Medicine, 2017/12
857

Predictors of Osteopathic Medical Students' Readiness to Use Health Information Technology
Jacobs, R. J., Iqbal, H., Rana, A. M., Rana, Z., Kane, M. N.
The Journal of the American Osteopathic Association, 2017/12
Free full text
858

Simulated learning activities as part replacement of clinical placements in osteopathy: A case study
Fitzgerald, K., Denning, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2017/12
859

OSTEHOM, recurso educativo digital para la enseñanza y aprendizaje de la cintura escapular (Hombro) en Osteopatía Estructural
(OSTEHOM: Digital educational resource for teaching and learning about the shoulder girdle in Structural Osteopathy)
Arenas Romero, M. V.
Unpublished MSc thesis, 2017/12
Free full text
860

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text
861

Defining Osteopathic Continuing Medical Education
Loveless, B.
The Journal of the American Osteopathic Association, 2017/12
Free full text
862

‘Sometimes I don't feel like an osteopath at all’- a qualitative study of final year osteopathy students' professional identities
Clarkson, H. J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2017/12
863

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text
864

Descriptive study of interprofessional collaboration between physicians and osteopaths for the pediatric population in Quebec, Canada
Morin, C., Desrosiers, J., Gaboury, I.
BMC Health Services Research, 2017/11
Free full text
865

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2017/11
866

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
867

Engaging in “Mind, Body, Spirit”—A Student Perspective on Incorporating Mindfulness in Osteopathic Medical Education Through the Wellness, Academic, Resilience and Mindfulness (WARM) Curriculum
Hu, H., Khorsand, M., Anand, R., Hendriksz, T., Velasco, H. E.
The Journal of the American Osteopathic Association, 2017/11
868

Empathy in Residency Years
Impens, A. J., Henderson, K., Rizkalla, M. N., Ivlovic, K.
The Journal of the American Osteopathic Association, 2017/11
869

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
The Journal of the American Osteopathic Association, 2017/11
870

Evolving Practice Settings for Osteopathic Graduates: How Debt Influences Anticipated Career Path
Kunz, M., Richards, J., Scheckel, C., Newman, J., Poole, K., Mi, L.
The Journal of the American Osteopathic Association, 2017/11
871

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text
872

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
873

Vital Signs of U.S. Osteopathic Medical Residency Programs Pivoting to Single Accreditation Standards
Novak, T. S.
Unpublished PhD thesis, 2017/10
Free full text
874

Entry of Medical School Graduates Into Family Medicine Residencies: 2016-2017
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text
875

Results of the 2017 National Resident Matching Program(R) and the American Osteopathic Association Intern/Resident Registration Program
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text
876

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text
877

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text
878

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text
879

Work related musculoskeletal injuries sustained by Australian osteopaths: qualitative analysis of effects on practitioner health, clinical practice, and patient care
McLeod, G. A., Annels, K., Cohen, J., Edwards, S., Hodgins, D., Vaughan, B.
Chiropractic & Manual Therapies, 2017/10
Free full text
880

Diabetes mellitus in der Osteopathie- beachten, behandeln, betreuen. Ein systematisierter Review
(Diabetes mellitus in Osteopathy-consider,treat, care. A systematized review)
Bertl, D.
Unpublished MSc thesis, 2017/10
Free full text
881

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text
882

Mother Still
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
883

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09
884

What Osteopathic Physicians Do
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2017/09
Free full text
885

Pennsylvania Otolaryngologists as a Model for the Implications of Practice Location of Osteopathic vs Allopathic Surgical Subspecialists
Griffith, S., Power, A., Strand, M.
The Journal of the American Osteopathic Association, 2017/09
Free full text
886

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text
887

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text
888

Clinical Preceptors' Perceptions of Empathy: The Empathy in Osteopathic Training and Education (EMOTE) Study
Davis, G. E., Hartwig, W. C., McTighe, A. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text
889

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text
890

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text
891

Fundamentals for an Osteopathic Obesity Designed Study: The Effects of Education on Osteopathic Medical Students' Attitudes Regarding Obesity
Gayer, G. G., Weiss, J., Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text
892

In Reply to Buser and to Shannon
Cummings, M.
Academic Medicine, 2017/08
Free full text
893

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text
894

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text
895

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text
896

Meeting ACGME Standards Under a Unified Accreditation System: Challenges for Osteopathic Graduate Medical Education Programs
Cummings, M.
Academic Medicine, 2017/07
Free full text
897

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
898

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text
899

Assessment of Research Interests of First-Year Osteopathic Medical Students
Carter, L., McClellan, N., McFaul, D., Massey, B., Guenther, E., Kisby, G.
The Journal of the American Osteopathic Association, 2017/07
Free full text
900

Video explicativo para la enseñanza y aprendizaje de los fundamentos de la osteopatía ¿ Qué es la osteopatía?
(Explanatory video for teaching and learning the basics of osteopathy - What is osteopathy?)
Moreno Rojas, E. M.
Unpublished MSc thesis, 2017/06
Free full text
901

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text
902

(Explanatory video for teaching and learning the basics of osteopathy - What is osteopathy?)
Video explicativo para la enseñanza y aprendizaje de los fundamentos de la osteopatía ¿ Qué es la osteopatía?
Moreno Rojas, E. M.
Unpublished MSc thesis, 2017/06
Free full text
903

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text
904

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text
905

A descriptive, cross-sectional study of medical student preferences for vodcast design, format and pedagogical approach
Pettit, R. K., Kinney, M., McCoy, L.
BMC Medical Education, 2017/05
Free full text
906

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text
907

Response to “Contribution of Osteopathic Training to the Primary Care Workforce“
Kozakowski, S. M., Travis, A., Bentley, A., Fetter, G.
Family Medicine, 2017/04
Free full text
908

Contribution of Osteopathic Training to the Primary Care Workforce
Malouin, R. A., Keenum, A.
Family Medicine, 2017/04
Free full text
909

Evidence-Based Redesign of the COMLEX-USA Series
Gimpel, J. R., Horber, D., Sandella, J. M., Knebl, J. A., Thornburg, J. E.
The Journal of the American Osteopathic Association, 2017/04
Free full text
910

Residency Program Directors' Interview Methods and Satisfaction With Resident Selection Across Multiple Specialties
VanOrder, T., Robbins, W., Zemper, E.
The Journal of the American Osteopathic Association, 2017/04
Free full text
911

Attitudes of Family Medicine Program Directors Toward Osteopathic Residents Under the Single Accreditation System
Hempstead, L. K., Shaffer, T. D., Williams, K. B., Arnold, L. C.
The Journal of the American Osteopathic Association, 2017/04
Free full text
912

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text
913

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text
914

Can the Humanities Humanize Health Care?
Baltonado, J., Cymet, T.
The Journal of the American Osteopathic Association, 2017/04
Free full text
915

Changes in Osteopathic Medical Education: The Journey Continues
McClain, E. K.
The Journal of the American Osteopathic Association, 2017/04
Free full text
916

Opening the Doors of Medicine to Women
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/03
Free full text
917

J Martin Littlejohn (1865–1947) and James Buchan Littlejohn (1868–1947): Two distinct directions – Osteopathy and the birth of osteopathic medicine
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2017/03
918

Achtsamkeit und ihre Relevanz in der osteopathischen Praxis
(Mindfulness and its relevance to osteopathic practice)
Andrejcic, I.
Unpublished MSc thesis, 2017/03
Free full text
919

History of Osteopathic Medicine: Still Relevant?
Orenstein, R.
The Journal of the American Osteopathic Association, 2017/03
Free full text
920

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text
921

Correlation Between United States Medical Licensing Examination and Comprehensive Osteopathic Medical Licensing Examination Scores for Applicants to a Dually Approved Emergency Medicine Residency
Kane, K. E., Yenser, D., Weaver, K. R., Barr, G. C. Jr., Goyke, T. E., Quinn, S. M., Worrilow, C. C., Burckhart, A. J., Leonetti, A. L., Yoshioka, I. E., Dusza, S. W., Kane, B. G.
The Journal of Emergency Medicine, 2017/02
922

JAOA Peer Reviewers, 2016
listed, No authors
The Journal of the American Osteopathic Association, 2017/02
Free full text
923

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text
924

Interprofessional Oral Health Education Improves Knowledge, Confidence, and Practice for Pediatric Healthcare Providers
Cooper, D.
Unpublished MSc thesis, 2017/01
Free full text
925

Examining Health Care Students' Attitudes toward E-Professionalism
Gettig, J. P., Noronha, S., Graneto, J., Obucina, L., Christensen, K. J., Fjortoft, N. F.
American Journal of Pharmaceutical Education, 2016/12
Free full text
926

Somatic dysfunction: An osteopathic conundrum
Fryer, G.
International Journal of Osteopathic Medicine, 2016/12
927

A Survey of Disaster Medical Education in Osteopathic Medical School Curricula
Parrillo, S. J., Christensen, D., Teitelbaum, H. S., Glassman, E. S.
Prehospital and Disaster Medicine, 2016/12
Free full text
928

Alternative Scheduling Models: Improving Continuity of Care, Medical Outcomes, and Graduate Medical Education in Resident Ambulatory Training
Hussain, A. J.
The Journal of the American Osteopathic Association, 2016/12
Free full text
929

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text
930

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text
931

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text
932

The Predictive Validity of the National Board of Osteopathic Medical Examiners' COMLEX-USA Examinations With Regard to Outcomes on American Board of Family Medicine Examinations
O'Neill, T. R., Peabody, M. R., Song, H.
Academic Medicine, 2016/11
Free full text
933

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text
934

T4 syndrome – A distinct theoretical concept or elusive clinical entity? A case report
Hirai, P. M., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2016/10
935

Using Patient Perspective Sessions to Increase Empathy and Recall in Preclinical Medical Students
Hendriksz, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text
936

The biomechanical model in manual therapy: Is there an ongoing crisis or just the need to revise the underlying concept and application?
Lunghi, C., Tozzi, P., Fusco, G.
Journal of Bodywork and Movement Therapies, 2016/10
937

A.T. Still’s osteopathic lesion theory and evidence-based models supporting the emerged concept of somatic dysfunction
Liem, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text
938

Effect of Medical Education on Empathy in Osteopathic Medical Students
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text
939

Correlation Between Standardize Patients' Perceptions of Osteopathic Medical Students and Students' Self-Rated Empathy
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text
940

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text
941

The use of critical reflection to foster reflective practice in student osteopaths
McLeod, G. A.
Unpublished PhD thesis, 2016/09
Free full text
942

Osteopathie in Österreich – rechtliche Grundlage und Ausblick
(Osteopathy in Austria - Legal basis and outlook)
Mitschka, M., Wikus, P.
Osteopathische Medizin, 2016/09
943

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
944

Berufsgesetz Osteopathie
(Occupational law for osteopathy)
Newiger, C.
Osteopathische Medizin, 2016/09
945

Osteopathic Manipulative Treatment in Pediatric and Neonatal Patients and Disorders: Clinical Considerations and Updated Review of the Existing Literature
Bagagiolo, D., Didio, A., Sbarbaro, M., Priolo, C. G., Borro, T., Farina, D.
American Journal of Perinatology, 2016/09
946

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
947

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text
948

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text
949

Nutrition Knowledge and Attitude Towards Nutrition Counseling Among Osteopathic Medical Students
Hargrove, E. J.
Unpublished MSc thesis, 2016/08
Free full text
950

Health literacy screening of patients attending a student-led osteopathy clinic: A pilot investigation
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Complementary Therapies in Clinical Practice, 2016/08
951

Quantitative Description of Medical Student Interest in Neurology and Psychiatry
Ramos, R. L., Cuoco, J. A., Guercio, E., Levitan, T.
The Journal of the American Osteopathic Association, 2016/07
Free full text
952

Effects of an e-learning programme on osteopaths’ back pain attitudes: a mixed methods feasibility study
Draper-Rodi, J.
Unpublished PhD thesis, 2016/07
Free full text
953

Naturheilkunde und Komplementarmedizin in medizinischen Leitlinien - konnen europaische Normen Leitlinien fur Naturheilkunde und Komplementarmedizin verdrangen?
(Naturopathy and Complementary Medicine in Medical Guidelines - Can European Standards Replace Guidelines for Naturopathy and Complementary Medicine?)
Jutte, R.
Forschende Komplementärmedizin, 2016/07
954

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text
955

The Use of COMLEX-USA and USMLE for Residency Applicant Selection
Sandella, J. M., Gimpel, J. R., Smith, L. L., Boulet, J. R.
Journal of Graduate Medical Education, 2016/07
Free full text
956

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text
957

Osteopathic Approach to the Diagnosis of Appendiceal Mucinous Cystadenocarcinoma Mimicking Primary Ovarian Malignant Neoplasm
Martingano, D., Gurm, H., Oliff, A., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2016/07
Free full text
958

Confirmatory factor analysis of the Study Process Questionnaire in an Australian osteopathy student population
Vaughan, Brett
International Journal of Osteopathic Medicine, 2016/06
959

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06
960

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text
961

Osteopathische Initiative für Flüchtlinge
(Osteopathic initiative for refugees)
Prediger, G.
Osteopathische Medizin, 2016/06
962

Red-Reflex-Test in der Osteopathie – eine systematische Literaturübersicht
(Red reflex test in osteopathy - A systematic literature review)
Rotter, G.
Osteopathische Medizin, 2016/06
963

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text
964

Sensomotorische Entwicklung und pädiatrische Osteopathie
(Sensorimotor development and pediatric osteopathy)
Ava Levin, V., Levin, P.
Osteopathische Medizin, 2016/06
965

Osteopathic medical students' perception of teaching effectiveness of their primary care clinical preceptors
Ojano Sheehan, O., Brannan, G., Dogbey, G.
International Journal of Osteopathic Medicine, 2016/06
966

(Manual medicine and osteopathic methods on the growing spine)
Kayser, R., Harke, G.
Der Orthopäde, 2016/06
967

State of affairs of osteopathy in the Benelux: Benelux Osteosurvey 2013
van Dun, P. L. S., Nicolaie, M. A., Van Messem, A.
International Journal of Osteopathic Medicine, 2016/06
968

Non-specific mechanisms in orthodox and CAM management of low back pain (MOCAM): theoretical framework and protocol for a prospective cohort study
Bradbury, K., Al-Abbadey, M., Carnes, D., Dimitrov, B. D., Eardley, S., Fawkes, C., Foster, J., Greville-Harris, M., Harvey, J. M., Leach, J., Lewith, G., MacPherson, H., Roberts, L., Parry, L., Yardley, L., Bishop, F. L.
BMJ Open, 2016/05
969

Proposed Amendments to the AOA Constitution, Bylaws, and Code of Ethics
listed, No authors
The Journal of the American Osteopathic Association, 2016/05
Free full text
970

An analysis of the effectiveness of a Midwest osteopathic medical school's pipeline programs: Graduation and GME match of URM and disadvantaged students
Rice, M. J.
Unpublished Dissertation, 2016/05
971

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text
972

Premedical Students’ Attitudes Toward Primary Care Medicine
Beverly, E. A., Wietecha, D. A., Nottingham, K., Rush, L. J., Law, T. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text
973

ENGAGE Initiative: Showcasing Osteopathic Scholarly Activity
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/05
Free full text
974

Preparation Strategies of Osteopathic Medical Students for the COMLEX-USA Level 2-PE
Sandella, J. M., Peters, A., Smith, L. L., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text
975

Advising Needs of Osteopathic Medical Students Preparing for the Match
Speicher, M. R., Pradhan, S. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text
976

Program Characteristics Influencing Allopathic Students' Residency Selection
Stillman, M. D., Miller, K. H., Ziegler, C. H., Upadhyay, A., Mitchell, C. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text
977

Effect of a Mandatory Third-Year Osteopathic Manipulative Treatment Course on Student Attitudes
Heineman, K. L., Lewis, D. D., Finnerty, E. P., Crout, S. V., Canby, C.
The Journal of the American Osteopathic Association, 2016/04
Free full text
978

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text
979

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text
980

Perceptions of US and Australian Medical Students and Instructors About Clinical Professional Attire: LAPEL Study
Bramstedt, K. A., Colaco, C. M. G., de Silva, E., Rehfield, P. L., Blumenthal-Barby, J. S.
The Journal of the American Osteopathic Association, 2016/04
Free full text
981

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text
982

„Pädiatrie und Osteopathie” – Kongress der OSD im November 2015
(“Pediatrics and Osteopathy“ - OSD Congress in November 2015)
Bäumer, C. J.
Osteopathische Medizin, 2016/03
983

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text
984

20. Europäisches Symposium der Traditionellen Osteopathie
(The 20th European Symposium of Traditional Osteopathy)
Pauler, A.
Osteopathische Medizin, 2016/03
985

The Glymphatic-Lymphatic Continuum: Opportunities for Osteopathic Manipulative Medicine
Hitscherich, K., Smith, K., Cuoco, J. A., Ruvolo, K. E., Mancini, J. D., Leheste, J. R., Torres, G.
The Journal of the American Osteopathic Association, 2016/03
Free full text
986

Evaluation of an interprofessional team-based learning nutrition and lifestyle modification course
Pogge, E.
Journal of Interprofessional Care, 2016/03
987

Letter to the Editor Regarding “A global view of osteopathy – Mirror or echo chamber”
King, H. H.
International Journal of Osteopathic Medicine, 2016/03
988

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text
989

Factors Modifying Burnout in Osteopathic Medical Students
Lapinski, J., Yost, M., Sexton, P., LaBaere, R. J.
Academic Psychiatry, 2016/02
990

Osteopathic educators' attitudes towards osteopathic principles and their application in clinical practice: A qualitative inquiry
Kasiri-Martino, H., Bright, P.
Manual Therapy, 2016/02
991

Single Accreditation System for Graduate Medical Education: An Opportunity for Lesbian, Gay, Bisexual, and Transgender Health Education Integration in Osteopathic Medicine
Lapinski, J., Diaz, K. M.
The Journal of the American Osteopathic Association, 2016/02
Free full text
992

Burnout Among Osteopathic Residents: A Cross-sectional Analysis
Chan, A. M., Cuevas, S. T., Jenkins, J.
The Journal of the American Osteopathic Association, 2016/02
Free full text
993

Osteopathic Students' Graduate Medical Education Aspirations Versus Realities: The Relationship of Osteopathic Medicine and Primary Care
Cummings, M.
Academic Medicine, 2016/01
Free full text
994

Evaluating medical student engagement during virtual patient simulations: a sequential, mixed methods study
McCoy, L., Pettit, R. K., Lewis, J. H., Allgood, J. A., Bay, C., Schwartz, F. N.
BMC Medical Education, 2016/01
Free full text
995

An indication of current views of Australian general practitioners towards chiropractic and osteopathy: a cross-sectional study
Engel, R. M., Beirman, R., Grace, S.
Chiropractic & Manual Therapies, 2016/01
Free full text
996

Management of Acute Isolated Soleal Vein Thrombosis in a Pregnant Patient With an Osteopathic Approach to Evaluation
Martingano, D., Eisenberg, J., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text
997

Gamification and Multimedia for Medical Education: A Landscape Review
McCoy, L., Lewis, J. H., Dalton, D.
The Journal of the American Osteopathic Association, 2016/01
Free full text
998

A formação em osteopatia na Europa: unidade ou diversidade? Os casos da Bélgica, França, Inglaterra e Portugal.
(Osteopathic training in Europe: unity or diversity? The cases of Belgium, France, England and Portugal)
Raimundo, I. S. P.
Unpublished MSc thesis, 2016/01
999

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text
1000

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text
1001

Osteopathie – eine kurze Einführung. Grundlagen und geschichtlicher Überblick
(Osteopathy - A short review. Principles and history)
Luthin, D.
Gynakologische Praxis, 2016
1002

GME Graduate Retention Rates: A Single Institution Study
Frieswyk, T. J.
Unpublished PhD thesis, 2015/12
Free full text
1003

Assessment in the final year clinical practicum of an Australian osteopathy program
Vaughan, B., Morrison, T.
International Journal of Osteopathic Medicine, 2015/12
1004

Rising to New Challenges: Problems and Proposed Solutions for Osteopathic Program Directors
Goldmann, S. I.
The AAO Journal, 2015/12
1005

15 Jahre Osteopathische Medizin: ein Interview mit den Gründungsherausgebern
(15 years of Osteopathische Medizin: An interview with the founding editors)
Newiger, C.
Osteopathische Medizin, 2015/12
1006

The Educational Model of Private Colleges of Osteopathic Medicine: Revisited for 2003-2013
Cummings, M.
Academic Medicine, 2015/12
Free full text
1007

A National Study of Primary Care Provided by Osteopathic Physicians
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2015/12
Free full text
1008

Top 5 largest osteopathic medical schools. Ranked by total active enrollment for the 2014-15 school year
listed, No authors
Modern Healthcare, 2015/12
1009

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text
1010

Geschichte der konservativen Wirbelsaulentherapie.
[History of conservative spinal therapy]
Kladny, B.
Der Unfallchirurg, 2015/12
1011

Incorporating Osteopathic Curriculum Into a Family Medicine Residency
Hempstead, L. K., Harper, D. M.
Family Medicine, 2015/11
1012

Development of Peer Tutoring Services to Support Osteopathic Medical Students’ Academic Success
Swindle, N., Wimsatt, L.
The Journal of the American Osteopathic Association, 2015/11
Free full text
1013

Incidence of Somatic Dysfunction in Healthy Newborns
Waddington, E. L., Snider, K. T., Lockwood, M. D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2015/11
Free full text
1014

How the distinctive cultures of osteopathic and allopathic medical schools affect the careers, perceptions, and institutional efforts of their anatomy faculties: A qualitative case study of two schools
Brokaw, J. J., Byram, J. N., Traser, C. J., Arbor, T. C.
Anatomical Sciences Education, 2015/11
1015

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11
1016

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text
1017

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text
1018

Feasibility of Using Ultrasonography to Establish Relationships Among Sacral Base Position, Sacral Sulcus Depth, Body Mass Index, and Sex
Lockwood, M. D., Kondrashova, T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/11
Free full text
1019

Job Satisfaction and Affective Commitment of Osteopathic Medical School Clinical Faculty
Yurvati, A. H.
Unpublished PhD thesis, 2015/11
1020

Patients' expectations of osteopathic care: a qualitative study
Cross, V., Leach, C. M., Fawkes, C. A., Moore, A. P.
Health Expectations, 2015/10
Free full text
1021

Person-centered osteopathic practice: patients' personality (body, mind, and soul) and health (ill-being and well-being)
Fahlgren, E., Nima, A. A., Archer, T., Garcia, D.
PeerJ, 2015/10
Free full text
1022

Antwort von Prof. Fuessl.
[Reply from Prof. Fuessl]
MMW - Fortschritte der Medizin, 2015/10
1023

Fibromyalgiesyndrom. Die Patienten fordern Osteopathie
(Fibromyalgia syndrome. Patients request osteopathy)
Zehnle, S.
MMW - Fortschritte der Medizin, 2015/10
1024

Systematische Übersichtsarbeit über die Bewegungen des Herzens in der Mobilität und in der Motilität. Systematischer Review
(Heart motion and motility. Systematic review)
Will, T.
Unpublished D.O. thesis, 2015/10
1025

Embodied Clinical Decision-making in Osteopathic Manipulative Medicine
Esteves, J. E.
The AAO Journal, 2015/09
1026

Perceived teaching quality between near-peer and academic tutors in an osteopathic practical skills class
Vaughan, B., Macfarlane, C.
International Journal of Osteopathic Medicine, 2015/09
1027

Das Rätsel der böhmischen Heiler in der Geschichte der manuellen Therapien
(The enigma of the Czech healers in the history of manual therapies)
Mildenberger, F. G.
Osteopathische Medizin, 2015/09
1028

Implementing the Single Accreditation System for Graduate Medical Education: Seeking Osteopathic Recognition
Shannon, S. C.
The AAO Journal, 2015/09
1029

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09
1030

Approaching the Single Accreditation System: Curricular Variation in Allopathic, Osteopathic, and Dually Accredited Family Medicine Residency Programs
Mims, L. D., Wannamaker, L. R., Bressler, L. C.
Journal of Graduate Medical Education, 2015/09
Free full text
1031

L'osteopathie a 1'epreuve de l'Evidence-Based Medicine.
[Osteopathy and Evidence-Based Medicine]
Dugailly, P. M.
Revue Medicale de Bruxelles, 2015/09
1032

Letter to the Editor concerning “A Global View of Osteopathic Practice – Mirror or echo chamber?”
Kerr, J.
International Journal of Osteopathic Medicine, 2015/09
1033

Integration of ultrasonography course in the students' curriculum. Is it always useful?
Garnier, H., Wisniewski, J.
Clinical Anatomy, 2015/09
1034

Improving our impact and developing high-level clinical expertise
Moran, R.
International Journal of Osteopathic Medicine, 2015/09
Free full text
1035

Effect of Table Trainer-to-Student Ratios on Outcome in Student Assessments of Cervical Muscle Energy Techniques
Snider, K. T., Dowling, D. J., Seffinger, M. A., Channell, M. K., Yao, S. C., Gustowski, S. M., Johnson, J. C., Pryor, M. J.
The Journal of the American Osteopathic Association, 2015/09
Free full text
1036

Basic Mechanisms of Osteopathic Manipulative Treatment: A Must Read
Patterson, M. M.
The Journal of the American Osteopathic Association, 2015/09
Free full text
1037

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text
1038

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text
1039

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text
1040

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text
1041

Im Gespräch mit … Jane Eliza Stark
(In dialog with Jane Eliza Stark)
Höppner, J.P., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
1042

Numbers of MD and DO Graduates in Graduate Medical Education Programs Accredited by the Accreditation Council for Graduate Medical Education and the American Osteopathic Association
Jolly, P., Lischka, T., Sondheimer, H.
Academic Medicine, 2015/07
Free full text
1043

Zwischen Traditionalisten und Reformern: Littlejohns Konzept der Anpassung
(Between traditionalists and reformers: Little Johns concept of adaptation)
Liem, T.
Osteopathische Medizin, 2015/06/01/
1044

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text
1045

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
1046

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
1047

Oral cancer knowledge, behavior, and attitude among osteopathic medical students
McCready, Z. R., Kanjirath, P., Jham, B. C.
Journal of Cancer Education, 2015/06
1048

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06
1049

Learning Environment, Preparedness and Satisfaction in Osteopathy in Europe: The PreSS Study
Luciani, E., van Dun, P. L., Esteves, J. E., Lunghi, C., Petracca, M., Papa, L., Merdy, O., Jakel, A., Cerritelli, F.
PLoS One, 2015/06
Free full text
1050

Proposed Amendments to the AOA Constitution
listed, No authors
The Journal of the American Osteopathic Association, 2015/06
Free full text
1051

A global view of osteopathic practice – mirror or echo chamber?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2015/06
1052

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text
1053

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05
1054

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text
1055

Variations in the diagnosis and treatment of somatic dysfunction between 4 osteopathic residency programs
Hon, G. A., Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/05
Free full text
1056

The extent of familial hypercholesterolemia instruction in US schools and colleges of medicine, pharmacy, and osteopathic medicine
Withycombe, B., Winden, J. C., Hassanyn, R., Duell, P. B., Ito, M. K.
Journal of Clinical Lipidology, 2015/05
1057

Student perceptions of gamified audience response system interactions in large group lectures and via lecture capture technology
Pettit, R. K., McCoy, L., Kinney, M., Schwartz, F. N.
BMC Medical Education, 2015/05
Free full text
1058

The meaning of fascia in a changing society
Adstrum, N. S.
Unpublished PhD thesis, 2015/04
1059

Transitions in osteopathic medical education
Cymet, T. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1060

Challenges of teaching live and distance audiences simultaneously
Davis, S. S., Hurtubise, L.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1061

Comparison of COMLEX-USA scores, medical school performance, and preadmission variables between women and men
Dixon, D.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1062

Evolution of AOA specialty board certification
Scheinthal, S., Wieting, J. M., Elko, E., Bowling, J., Gonzalez, F., Librizzi, R., Murcek, B., Simms, B.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1063

Relationship between residency placement and clerkship site enrollment: a retrospective analysis
Elliott, S. P., Goldstein, L. B., Meinberg, D., Jeger, A. M.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1064

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1065

President's message
Morrone, W.
Journal of Addictive Diseases, 2015/04
1066

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1067

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1068

Developing a clinical teaching quality questionnaire for use in a university osteopathic pre-registration teaching program
Vaughan, B.
BMC Medical Education, 2015/04
Free full text
1069

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1070

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1071

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1072

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1073

Osteopathic postdoctoral training institutions' 2014 annual report
Biszewski, M., Ball, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1074

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1075

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1076

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1077

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text
1078

Chiropraktik in der Bundesrepublik Deutschland von 1949 bis 1975
(Chiropractic in the Federal Republic of Germany from 1949 to 1975)
Mildenberger, F. G.
Osteopathische Medizin, 2015/03
1079

19. Europäisches Symposium der traditionellen Osteopathie
(The 19th European Symposium of Traditional Osteopathy)
Müller, F.
Osteopathische Medizin, 2015/03
1080

In reply to brock and scott
Kauffman, M.
Academic Medicine, 2015/03
Free full text
1081

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03
1082

Impact of the clinical ultrasound elective course on retention of anatomical knowledge by second-year medical students in preparation for board exams
Kondrashov, P., Johnson, J. C., Boehm, K., Rice, D., Kondrashova, T.
Clinical Anatomy, 2015/03
1083

Osteopathic medical students' understanding of the Patient Protection and Affordable Care Act: a first step toward a policy-informed curriculum
Beverly, E. A., Skinner, D., Bianco, J. A., Ice, G. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
1084

Evidence-based medicine and osteopathic medicine: no paradox
Noll, D. R.
The Journal of the American Osteopathic Association, 2015/03
Free full text
1085

Osteopathic graduates perceptions of stress and competence – A longitudinal study
Subramaniam, P., Eaton, S.A., Cranfield, J., Mulcahy, J., McLaughlin, P., Morrison, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2015/03
1086

Fluida und Osteopathie – Kongress der Osteopathie Schule Deutschland 2014
(Fluids and Osteopathy - Congress of the Osteopathic School of Germany 2014)
Hohenschurz-Schmidt, D. J.
Osteopathische Medizin, 2015/03
1087

Research in the osteopathic medical profession: roadmap to recovery-conundrums in osteopathic research require consensus and collaboration
Walkowski, S. A., Eland, D. C., Hain, S., Byron, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text
1088

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text
1089

Relationship of admissions variables and college of osteopathic medicine variables to performance on COMLEX-USA level 3
Baker, H. H., Shuman, V. L., Ridpath, L. C., Pence, L. L., Fisk, R. M., Jr., Boisvert
The Journal of the American Osteopathic Association, 2015/02
Free full text
1090

Impact of the Single Accreditation Agreement on GME Governance and the Physician Workforce
Buser, B. R.
The Journal of the American Osteopathic Association, 2015/02
Free full text
1091

Are We Ready to Lead? ACGME Merger: An Opportunity to Fulfill Osteopathy’s Mission
O'Connell, J. A.
The AAO Journal, 2015/01
1092

A study and revisioning of pedagogy and language from the four viewpoints of Sufism, phenomenology of the body, osteopathy, and evolutionary cosmology: Teachings of love and ecology
Davis, M. E.
Unpublished PhD thesis, 2015/01
1093

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01
1094

A single graduate medical education accreditation system: ensuring quality training for physicians and improved health care for the public
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/4
Free full text
1095

Intuition, analysis and reflection: An experimental study into the decision-making processes and thinking dispositions of osteopathy students
Spadaccini, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2014/12
1096

The accelerated physician assistant pathway: a three-year medical school curriculum for physician assistants to obtain DO degrees
Kauffman, M., Ferretti, S. M.
Academic Medicine, 2014/12
Free full text
1097

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text
1098

Experiential Learning: An Irreplaceable Tool in Osteopathic Student Education
Bikman, T. J., Ford, J., Schmidt, D., Ridpath, L.
The Journal of the American Osteopathic Association, 2014/12
1099

Model to Predict Student Performance on the Comprehensive Osteopathic Medical Licensing Examination-USA Level 1 Based on the Medical College Admission Test, Undergraduate Grade Point Average (GPA), and Osteopathic Medical School GPA
Jeffrey, L., McClain, E. K.
The Journal of the American Osteopathic Association, 2014/12
1100

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text
1101

Osteopathic emergency medicine programs infrequently publish in high-impact emergency medicine journals
Baskin, S. M., Lin, C., Carlson, J. N.
Western Journal of Emergency Medicine, 2014/11
Free full text
1102

Prozess der Wahrnehmung und Interpretation von Palpationsbefunden
(Process of perception and interpretation of palpation findings).
Liem, T.
Osteopathische Medizin, 2014/11
1103

Chiropraktik in Deutschland – die Zeit vor 1945
(Chiropractic in Germany - the time before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2014/11
1104

Professionalism score and academic performance in osteopathic medical students
Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text
1105

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with persistent non-specific low back pain after childbirth. A randomized controlled trial)
Belz, S.
Unpublished MSc thesis, 2014/10
Free full text
1106

A modified Delphi consensus study to identify UK osteopathic profession research priorities
Rushton, A. B., Fawkes, C. A., Carnes, D., Moore, A. P.
Manual Therapy, 2014/10
1107

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1108

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1109

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1110

Relationships between the Comprehensive Osteopathic Medical Achievement Test (COMAT) subject examinations and the COMLEX-USA Level 2-Cognitive Evaluation
Li, F., Kalinowski, K. E., Song, H., Bates, B. P.
The Journal of the American Osteopathic Association, 2014/09
Free full text
1111

Osteopaths' professional views, identities and conceptions – A qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/09
1112

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09
1113

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09
1114

Results, solutions, and learning: The continuing maturation of osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2014/09
1115

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text
1116

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text
1117

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text
1118

Osteopathie und Naturheilkunde in der Schweiz
(Osteopathy and naturopathy in Switzerland)
Vogel, C.
Osteopathische Medizin, 2014/09
1119

A degree of difference: the origins of osteopathy and the first use of the “DO“ designation
Stark, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
1120

Nonmedical Use of Stimulants Among Medical Students
Wasserman, J. A., Fitzgerald, J. E., Sunny, M. A., Cole, M., Suminski, R. R., Dougherty, J. J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
1121

Multitasking behaviors of osteopathic medical students
Shah, A. V., Mullens, D. J., Van Duyn, L. J., Januchowski, R. P.
The Journal of the American Osteopathic Association, 2014/08
Free full text
1122

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
1123

Burnout among osteopathic otolaryngology residents: identification during formative training years
Yost, M. G., Johnson, J. C., Johns, M. M., Burchett, K. D.
The Journal of the American Osteopathic Association, 2014/08
Free full text
1124

Im Gespräch mit … Gert Roncada
(In dialog with Gert Roncada)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1125

Association between cervical and thoracic somatic dysfunction among second-year osteopathic medical students
Brindise, J. P., Nelson, K. E., Kappler, R. E.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1126

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1127

Perception-based effects of clinical exposure to osteopathic manipulative treatment on first- and second-year osteopathic medical students
Vazzana, K. M., Yao, S. C., Jung, M. K., Terzella, M. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1128

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1129

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 2
Hendryx, J. T.
The AAO Journal, 2014/06
Free full text
1130

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06
1131

New gestational osteopathy unit at the University Hospital Quiron San Jose of Madrid
Guzman Mora, R.
Revista de Enfermeria, 2014/06
1132

Osteopathie in Kenia – humanitäre Hilfe und Engagement gegen die weibliche Genitalverstümmelung
(Osteopathy in Kenya - Humanitarian aid and commitment against female genital mutilation)
Gassmaier, H.
Osteopathische Medizin, 2014/06
1133

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06
1134

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1135

Predictive relationship of osteopathic manual medicine grades and COMLEX-USA Level 1 total scores and osteopathic principles and practice subscores
Lewis, D. D., Johnson, M. T., Finnerty, E. P.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1136

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1137

Attributions, influences and outcomes for underrepresented and disadvantaged participants of a medical sciences enrichment pipeline program
Pinckney, C.
Unpublished Dissertation, 2014/05
Free full text
1138

The Journal of the American Osteopathic Association: the next generation
Orenstein, R.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1139

Osteopathic graduate medical education: new research standards needed
Shulman, H. M., Cooper, K., Devine, W., Trzeciak, M., Burney, U., Chan, W. P., Gomez, A., Humpherys, J., Safavi, H., Yoshida, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1140

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1141

The DREEM, part 2: psychometric properties in an osteopathic student population
Vaughan, B., Mulcahy, J., McLaughlin, P.
BMC Medical Education, 2014/05
Free full text
1142

The DREEM, part 1: measurement of the educational environment in an osteopathy teaching program
Vaughan, B., Carter, A., Macfarlane, C., Morrison, T.
BMC Medical Education, 2014/05
Free full text
1143

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1144

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1145

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1146

Development of a data collection tool to profile osteopathic practice: use of a nominal group technique to enhance clinician involvement
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
1147

The use of technology and perceptions of its effectiveness in training physicians
Mason, P. B., Turgeon, B. M., Cossman, J. S., Lay, D. M.
Medical Teacher, 2014/04
1148

Reevaluating osteopathic medical education for the 21st century and beyond
Shannon, S. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1149

Honoring the Medicine: searching for the embodiment of spiritual commitment and philosophy for student physicians
Roseman, J. L.
Advances in Mind-Body Medicine, 2014/04
1150

Concurrent validity of the Osteopathic General Surgery In-Service Examination
Falcone, J. L., Rosen, M. E.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1151

Student- and faculty-reported importance of science prerequisites for osteopathic medical school: a survey-based study
Binstock, J., Junsanto-Bahri, T.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1152

Unified graduate medical education accreditation: a better plow
Bulger, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1153

Moving from EBM to EBOM: an osteopathic perspective on evidence-based medicine
Danto, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1154

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1155

Relationship between COMLEX-USA scores and performance on the American Osteopathic Board of Emergency Medicine Part I certifying examination
Li, F., Gimpel, J. R., Arenson, E., Song, H., Bates, B. P., Ludwin, F.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1156

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1157

A profile of osteopathic care in private practices in the United Kingdom: a national pilot using standardised data collection
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
1158

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1159

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 1
Hendryx, J. T.
The AAO Journal, 2014/03
Free full text
1160

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03
1161

Factors important to applicants to osteopathic versus allopathic emergency medicine residency programs
St Amour, B. A.
Western Journal of Emergency Medicine, 2014/03
Free full text
1162

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1163

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1164

Evidence of declining empathy in third year osteopathic medical students
Caruso, H. M., Bernstein, B.
International Journal of Osteopathic Medicine, 2014/03
1165

Clinical decision-making and therapeutic approaches in osteopathy - a qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
Manual Therapy, 2014/02
1166

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text
1167

Osteopathie als “eigenstandiger Heilberuf“. Sollen Bademeister auf eigene Faust Patienten behandeln?
(Osteopathy as an “independent healing profession“. Should balneology specialists treat patients independently? )
Ostendorf, G. M.
MMW - Fortschritte der Medizin, 2014/02
1168

Correlation of the emergency medicine resident in-service examination with the American Osteopathic Board of Emergency Medicine Part I
Levy, D., Dvorkin, R., Schwartz, A., Zimmerman, S., Li, F.
Western Journal of Emergency Medicine, 2014/02
Free full text
1169

Should osteopathic students applying to allopathic emergency medicine programs take the USMLE Exam?
Weizberg, M., Kass, D., Husain, A., Cohen, J., Hahn, B.
Western Journal of Emergency Medicine, 2014/02
Free full text
1170

Mini-medical school programs are an effective tool to introduce students to osteopathic medicine
Kaye, K. E., Berns, A. L., Cress, L. R., Nazar, A. M.
The Journal of the American Osteopathic Association, 2014/02
Free full text
1171

The integration of the “spirituality in medicine“ curriculum into the osteopathic communication curriculum at Kansas City University of Medicine and Biosciences
Talley, J. A., Magie, R.
Academic Medicine, 2014/01
Free full text
1172

No place like HOME
Pham, J. T.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1173

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1174

New frontiers in medical education: simulation technology at Campbell University School of Osteopathic Medicine
Maddox, R. W., Schmid, R. J.
North Carolina Medical Journal, 2014/01
1175

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1176

Componentes de formação no plano de estudos: a componente prática num curso profissional de osteopatia
(Training components in the syllabus: the practical component in a professional osteopathy course)
Barreto, N. M. S.
Unpublished MSc thesis, 2014/01
Free full text
1177

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1178

Connectedness, sense of community, and academic satisfaction in a novel community campus medical education model
Vora, R. S., Kinney, M. N.
Academic Medicine, 2014/01
Free full text
1179

Prevention curricula assessment of osteopathic medical schools in the United States
Dombrowski, H. T., Vincent, O. D., Wiley, C. L.
International Journal of Osteopathic Medicine, 2013/12
1180

Patient perception of osteopathic training in the UK and patient reported experience
Drysdale, I. P., Hinkley, H., Rolfe, K. J.
International Journal of Osteopathic Medicine, 2013/12
1181

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12
1182

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12
1183

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12
1184

Emotional processing and its relationship to chronic low back pain
Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12
1185

Investigation of standardized patient ratings of humanistic competence on a medical licensure examination using Many-Facet Rasch Measurement and generalizability theory
Zhang, X., Roberts, W. L.
Advances in Health Sciences Education : Theory and Practice, 2013/12
1186

On the oft-debated question of what it means to be an osteopathic physician
Benzoni, T.
The Journal of the American Osteopathic Association, 2013/12
Free full text
1187

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text
1188

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text
1189

Osteopathic graduate medical education: a way forward
Terry, R.
The Journal of the American Osteopathic Association, 2013/12
Free full text
1190

Assessing undergraduate osteopaths in the identification of patients' excess body weight
Bright, P., Wasik, C.
International Journal of Osteopathic Medicine, 2013/12
1191

Strukturierte curriculare Fortbildung Osteopathische Verfahren
(Structured curricular advanced training osteopathic methods)
v. Heymann, W., Buchmann, J.
Manuelle Medizin, 2013/12
1192

Zukunft und Qualität der Osteopathie in Deutschland
(Future and quality of osteopathy in Germany)
Osteopathische Medizin, 2013/11
1193

Evidenzbasierte Medizin – der Goldstandard auch in der Osteopathie?
(Evidence-based medicine - the golden standard also in osteopathy?)
Hartwig, B.
Osteopathische Medizin, 2013/11
1194

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text
1195

Tobacco dependence curricula in US osteopathic medical schools: a follow-up study
Griffith, B. N., Montalto, N. J., Ridpath, L., Sullivan, K.
The Journal of the American Osteopathic Association, 2013/11
Free full text
1196

Natural Bridge: Wo sich Osteopathie und Natur verbinden
(The Natural Bridge: Where osteopathy and nature combine)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1197

Osteopathic dermatology residency training through Nova Southeastern University College of Osteopathic Medicine at Largo Medical Center
Walls, B.
Cutis, 2013/10
Free full text
1198

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1199

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1200

Osteopathische Behandlung bei psychischen Traumafolgestörungen
(Osteopathic treatment in mental posttraumatic stress disorders)
Krebs, C.A., von Franque, M.
Osteopathische Medizin, 2013/09
1201

Osteopathie in Portugal staatlich reguliert
(Osteopathy in Portugal is regulated by the state)
Hartlep, M.
Osteopathische Medizin, 2013/09
1202

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text
1203

Frequency of counterstrain tender points in osteopathic medical students
Snider, K. T., Glover, J. C., Rennie, P. R., Ferrill, H. P., Morris, W. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text
1204

The importance of residency program size and location on American Osteopathic Board of Surgery In-Training Examination outcomes
Falcone, J. L., Rosen, M. E.
Journal of Surgical Research, 2013/09
1205

Osteopath is incorrect term for osteopathic physicians
Kaufman, B.
American Family Physician, 2013/08
Free full text
1206

One of ours
Burhop, J.
The Journal of the American Osteopathic Association, 2013/08
Free full text
1207

Relighting the fire in our bellies
Cain, R. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text
1208

Effects of Osteopathic Manipulative Treatment on Self-Perceived Stress in First-Year Osteopathic Medical Students
Bianchi, W., Cooper, M., Roberts, C., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08
1209

Portfolios in Osteopathic Medical Education: A Qualitative Pilot Study
Miner, A., Pierce, L. J., Sidhu, K., Menini, T.
The Journal of the American Osteopathic Association, 2013/08
1210

Reducing Medical Student Fatigue With Osteopathic Manipulative Treatment
Wiegand, S., Jordan, L., Van Tiem, M., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08
1211

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1212

Osteopathic Training for MDs
Fredericks, T. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1213

Fascia's function: classical osteopathic perspectives and current research compared
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2013/07
Free full text
1214

Item development for a questionnaire investigating patient self reported perception, satisfaction and outcomes of a single osteopathy in the cranial field (OCF) treatment
Mulcahy, J., Vaughan, B., Boadle, J., Klas, D., Rickson, C., Woodman, L.
International Journal of Osteopathic Medicine, 2013/06
1215

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text
1216

Osteopathic evaluation of somatic dysfunction and craniosacral strain pattern among preterm and term newborns
Pizzolorusso, G., Cerritelli, F., D', Orazio, M., Cozzolino, V., Turi, P., Renzetti, C., Barlafante, G., D', Incecco, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
1217

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
1218

Patients' expectations of private osteopathic care in the UK: a national survey of patients
Leach, C. M., Mandy, A., Hankins, M., Bottomley, L. M., Cross, V., Fawkes, C. A., Fiske, A., Moore, A. P.
BMC Complementary Medicine and Therapies, 2013/05
Free full text
1219

He walked with confidence into the wilderness of life: a tribute to Philip E. Greenman, DO (1928-2013)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
1220

An osteopathic approach to gastrointestinal disease: somatic clues for diagnosis and clinical challenges associated with Helicobacter pylori antibiotic resistance
Smilowicz, A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
1221

Response
Suminski, R. R., Wasserman, J. A., Guillory, V. J., Hendrix, D., May, L. E.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1222

Osteopathic postdoctoral training institutions and academic sponsorship
Biszewski, M.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1223

Osteopathic graduate medical education 2013
DeRosier, A., Lischka, T. A., Martinez, B.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1224

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1225

Bibliometric measures and National Institutes of Health funding at COMs, 2006-2010
Gugliucci, A.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1226

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text
1227

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1228

Impact indices shed false light
McDonald, R. G.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1229

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1230

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1231

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1232

Ohio osteopathic residency directors' self-reported administrative knowledge and skills before and after participation in an administrative training program
Sheehan, O. O., Brannan, G.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1233

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text
1234

Osteopathic principles in the modern world
Cotton, A.
International Journal of Osteopathic Medicine, 2013/03
1235

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03
1236

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03
1237

From distinct to indistinct, the life cycle of a medical heresy. Is osteopathic distinctiveness an anachronism?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2013/03
1238

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03
1239

An historical perspective on principles of osteopathy
Stark, J. E.
International Journal of Osteopathic Medicine, 2013/03
1240

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03
1241

Osteopathie im Kontext der italienischen Politik
(Osteopathy in the context of Italian politics)
Tozzi, P.
Osteopathische Medizin, 2013/03
1242

Special issue: Osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2013/03
1243

An Exploration of Emerging Professional Identity in Women Osteopathic Medical Students: Does Gender Matter?
Dunatov, L. J.
Unpublished Dissertation, 2013/03
1244

Somatic hygiene: osteopathic manipulative medicine as preventive treatment
Bowers, R. J.
The Journal of the American Osteopathic Association, 2013/03
Free full text
1245

How patients choose osteopaths: a mixed methods study
Bishop, F. L., Bradbury, K., Hj Jeludin, N. N., Massey, Y., Lewith, G. T.
Complementary Therapies in Medicine, 2013/02
1246

Predictors of scoring at least 600 on COMLEX-USA Level 1: successful preparation strategies
Vora, A., Maltezos, N., Alfonzo, L., Hernandez, N., Calix, E., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2013/02
Free full text
1247

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
1248

A new look for the Journal of the American Osteopathic Association
Berneath Lang, D., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1249

2012 student research abstracts and poster competitions
Neufeld, K. S.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1250

Biotensegrity: a unifying theory of biological architecture with applications to osteopathic practice, education, and research--a review and analysis
Swanson, R. L.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1251

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12
1252

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12
1253

Interview mit Theodor Dierk Petzold über Salutogenese und Osteopathie
(Interview with Theodor Dierk Petzold on salutogenesis and osteopathy)
Petzold, T. D.
Osteopathische Medizin, 2012/12
1254

Methods of assessment used by osteopathic educational institutions
Vaughan, B., Sullivan, V., Gosling, C., McLaughlin, P., Fryer, G., Wolff, M., Gabb, R.
International Journal of Osteopathic Medicine, 2012/12
1255

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1256

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1257

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1258

OCC: will it never end?
Sylvara, J. T.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1259

Touch - more than a basic science
Lalonde, F.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1260

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1261

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1262

Bibliometric measures and National Institutes of Health funding at colleges of osteopathic medicine, 2006-2010
Suminski, R. R., Hendrix, D., May, L. E., Wasserman, J. A., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1263

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1264

Osteopathic manipulative treatment: much more than simply a “hands-on“ phenomenon
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1265

Über die Ursprünge der Biodynamik in der Osteopathie. Sind Grundzüge des Biodynamischen Gedankengutes schon in den Aussagen von A. T. Still zu finden? Eine historische Literaturübersicht
(The origins of biodynamics in osteopathy. Can principles of biodynamic ideas already be detected in statements of A.T. Still? Basic Research)
Roth, R.
Unpublished D.O. thesis, 2012/10
1266

Geographic patterns in primary care visits provided by osteopathic physicians
Licciardone, J. C.
Family Medicine, 2012/10
1267

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text
1268

Combined manual therapy techniques for the treatment of women with infertility: a case series
Kramp, M. E.
The Journal of the American Osteopathic Association, 2012/10
Free full text
1269

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text
1270

Consent in osteopathy: A cross sectional survey of patients' information and process preferences
Daniels, G., Vogel, S.
International Journal of Osteopathic Medicine, 2012/09
1271

Osteopathic education: Editorial call for papers
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2012/09
1272

Using manual and conventional therapies to enhance musculoskeletal health: highlights of the Osteopathic Research Center's 10th Anniversary Conference
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/09
Free full text
1273

Metaphern für Gesundheit – Gesundheit als Metapher
(Metaphors for health - Health as metaphor)
Risch, A. J.
Osteopathische Medizin, 2012/09
1274

Interview mit Jane Stark über die biografischen Quellen der Osteopathie
(Interview with Jane Stark on the biographical sources of osteopathy)
Stark, J.
Osteopathische Medizin, 2012/09
1275

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text
1276

Advancing osteopathic medicine through research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2012/09
Free full text
1277

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the USMLE
Lenchus, J. D.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1278

Health-related Internet use among patients of osteopathic physicians
Cooley, D. L., Mancuso, A. M., Weiss, L. B., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1279

Touch: vital to patient-physician relationships
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1280

Frequency of specific osteopathic manipulative treatment modalities used by candidates while taking COMLEX-USA Level 2-PE
Langenau, E. E., Dowling, D. J., Dyer, C., Roberts, W. L.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1281

Communicating About Osteopathic Medicine: An Analysis of Osteopathic Residents’ Responses to the Question “What’s the Difference Between a DO and an MD?”
Hamstra, J.
The Journal of the American Osteopathic Association, 2012/08
1282

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1283

Assessing Palpation Thresholds Using Static Lumbar Spine Models
Snider, E. J., Pamperin, K. L., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2012/08
1284

Burnout Among Osteopathic Otolaryngology Residents: Identification, Prevention, and Treatment During Formative Training Years
Yost, M., Johnson, J. C., Burchett, K.
The Journal of the American Osteopathic Association, 2012/08
1285

Putting on White Coats: Professional Socialization of Medical Students Through Narrative Pedagogy in Standardized Patient Labs
Patterson, S. D.
Unpublished PhD thesis, 2012/08
Free full text
1286

We have met the enemy and he is us
Vanderburgh, A. J.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1287

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1288

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1289

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1290

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1291

Interview mit Jaap van der Wal über die Embryologie und ihre Bedeutung für die Osteopathie
(Interview with Jaap van der Wal on embryology and its significance for osteopathy)
van der Wal, J.
Osteopathische Medizin, 2012/06
1292

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text
1293

Rigor in medical writing: quoting accurately
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
1294

Empathy in osteopathic medical students: a cross-sectional analysis
Kimmelman, M., Giacobbe, J., Faden, J., Kumar, G., Pinckney, C. C., Steer, R.
The Journal of the American Osteopathic Association, 2012/06
Free full text
1295

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text
1296

Letter About “Thanks, but No Thanks: How Denial of Osteopathic Service in the World Wars Shaped the Profession–1”
Stiger, J.
The Journal of the American Osteopathic Association, 2012/05
Free full text
1297

Thanks but no thanks: how denial of osteopathic service in the world wars shaped the profession
Schriner, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text
1298

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1299

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1300

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1301

Prediction of Osteopathic Medical School Performance on the basis of MCAT score, GPA, sex, undergraduate major, and undergraduate institution
Dixon, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1302

Redirect terminology debate toward improved definition of osteopathic medicine
Ching, L. M.
The Journal of the American Osteopathic Association, 2012/03
Free full text
1303

Interview mit Prof. Matthias Beck, AVT-College, Nagold
(Interview with Prof. Matthias Beck, AVT-College, Nagold)
Beck, M.
Osteopathische Medizin, 2012/03
Free full text
1304

Interview mit Marina Fuhrmann, Hochschule Fresenius, Idstein
(Interview with Marina Fuhrmann, Hochschule Fresenius, Idstein)
Fuhrmann, M.
Osteopathische Medizin, 2012/03
Free full text
1305

Interview mit Dr. med. Bernhard Hartwig, IKT, München
(Interview with Dr. med. Bernhard Hartwig, IKT, Munich)
Hartwig, B.
Osteopathische Medizin, 2012/03
Free full text
1306

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03
1307

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the United States Medical Licensing Examination
Hasty, R. T., Snyder, S., Suciu, G. P., Moskow, J. M.
The Journal of the American Osteopathic Association, 2012/02
Free full text
1308

„Was Sie machen, ist doch keine Osteopathie!“ – Ansätze zu einem konsensfähigen Selbstverständnis
(“What you are doing is not osteopathy after all!“ - Approaches to a consensual self-image)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1309

Wie viel Differenzialdiagnostik braucht die Osteopathie?
(How much differential diagnostics does osteopathy need?)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1310

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text
1311

Oral health awareness for osteopathic medical students--a medical and dental collaborative effort
Rosenheck, A. H., Scott, G. J., Dombrowski, H. T., Cohen, H. V., York, J. A., Kleiman, A., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/02
Free full text
1312

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text
1313

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12
1314

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
1315

Background and methodology of the Osteopathic Survey of Health Care in America 2010 (OSTEOSURV 2010)
Licciardone, J. C., Kearns, C. M., Ruggiere, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
1316

Interview mit Jean-Pierre Barral: „Nur das Gewebe weiß Bescheid“
(Interview with Jean-Pierre Barral: “only the tissue knows“)
Barral, J.P.
Osteopathische Medizin, 2011/12
1317

Osteopathischer Herbstgenuss in Potsdam
(Autumn osteopathic enjoyment in Potsdam)
Prediger, G.
Osteopathische Medizin, 2011/12
1318

Perspectives on quality assurance methods – A comparison of osteopathic programmes in two countries: A pilot study
Michelson, H. C.
Unpublished MSc thesis, 2011/12
Free full text
1319

Osteopathie in Österreich
(Osteopathy in Austria)
Schulmeyer, A.
Osteopathische Medizin, 2011/12
1320

Time to direct COM candidates away from the MCAT?
Kauffman, M.
The Journal of the American Osteopathic Association, 2011/11
Free full text
1321

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text
1322

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text
1323

Promoting safe and efficacious vaccines for adults
Grogg, S. E.
The Journal of the American Osteopathic Association, 2011/10
Free full text
1324

Support for women in osteopathic medicine who breastfeed: a call for action
Pieh-Holder, K. L.
The Journal of the American Osteopathic Association, 2011/10
Free full text
1325

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text
1326

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09
1327

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text
1328

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text
1329

Neubewertung der klassischen osteopathischen Feldtheorie am Beispiel von Perzeption und Wahrnehmung
(Reevaluation of the classic osteopathic field theory using perception and cognition as example)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/09
1330

Situation der Osteopathie in Frankreich
(Situation of osteopathy in France)
Steringot, P.
Osteopathische Medizin, 2011/09
1331

Interview mit Jim Jealous über Mentoren in der Osteopathie
(Interview with Jim Jealous on mentors in osteopathy)
Jealous, J. S.
Osteopathische Medizin, 2011/09
1332

Call for papers: An invitation to contribute to a special issue on osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2011/09
1333

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Melnick, A.
The Journal of the American Osteopathic Association, 2011/09
Free full text
1334

Sprache und Kommunikation in der Osteopathie: Glossare im Internet
(Language and communication in osteopathy: glossaries on the Internet)
Risch, A. J.
Osteopathische Medizin, 2011/09
1335

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Perrotta, A. L.
The Journal of the American Osteopathic Association, 2011/09
Free full text
1336

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?
Shaw, H. H.
The Journal of the American Osteopathic Association, 2011/08
Free full text
1337

What Drew You to Osteopathic Medicine? A Survey of Osteopathic Medical Students From 10 Schools
Draper, B. B., Johnson, J. C., Chamberlain, N.
The Journal of the American Osteopathic Association, 2011/08
1338

Osteopathic Medical Students' Attitude Toward Complementary and Alternative Medicine
Shubrook, J. H., Kanadiya, M. K.
The Journal of the American Osteopathic Association, 2011/08
1339

Improving Resident Research Projects by Providing a Focused Research Infrastructure and Training on Evidence-Based Practice
Weiss, L. B., Filipetto, F. A., Zipp, C. P., Gupta, A. K., Switala, C. A.
The Journal of the American Osteopathic Association, 2011/08
1340

Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes
Langenau, E. E., Sandella, J. M.
The Journal of the American Osteopathic Association, 2011/07
Free full text
1341

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text
1342

Re: Is a postural-structural-biomechanical model, within manual therapy, viable? A JBMT debate
Franke, H.
Journal of Bodywork and Movement Therapies, 2011/07
1343

An investigation into the transition from student to practising osteopath
Davidson, Y. M.
Unpublished MSc thesis, 2011/07
Free full text
1344

Opinions on research and evidence based medicine within the UK osteopathic profession: A thematic analysis of public documents 2003–2009
Humpage, C.
International Journal of Osteopathic Medicine, 2011/06
1345

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06
1346

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06
1347

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text
1348

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text
1349

Diagnostic Palpation in Osteopathic Medicine: A Putative Neurocognitive Model of Expertise
Esteves, J. E. d. J.
Unpublished PhD thesis, 2011/06
Free full text
1350

Klassische Osteopathie: eine Feldtheorie als Vorbild und Grundlage
(Classic osteopathy: A field theory as a model and basis)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/06
1351

Flawed science is not evidence-based osteopathic medicine
Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text
1352

Die Folgen der Armut lindern - osteopathische Behandlung in Kenia
(Alleviating the effects of poverty - osteopathic treatment in Kenya)
Abb, B.
Osteopathische Medizin, 2011/06
1353

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1354

DOs should endorse an evidence-based national healthcare policy
Graham, J. D.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1355

The Impact of an Osteopathic Medical Program on Information Technology Skills of Physicians Entering the Workforce
Bronsburg, S. E.
Unpublished PhD thesis, 2011/05
1356

Are clinical protocols for osteopathic manipulative procedures truly “osteopathic“?
Kirsch, J. R.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1357

One osteopathic physician's path through an ACGME-Accredited Residency
Patchett, D. C.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1358

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1359

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1360

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1361

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1362

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1363

Interprofessional education: cooperation among osteopathic medicine, pharmacy, and physician assistant students to recognize medical errors
Meszaros, K., Lopes, I. C., Goldsmith, P. C., Knapp, K. K.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1364

Osteopathic Issues Raised by the September 2010 JAOA
Patriquin, D. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1365

Understanding osteopathic medical school applicants and the class of 2014
Ramos, R. L., Zhou, C., Hasan, M., Herrera, S. J., Bono, N. A., Hallas, B. H.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1366

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1367

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1368

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1369

Evaluation of colleges of osteopathic medicine: training for the evaluators
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1370

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04
1371

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03
1372

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
1373

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
1374

Osteopathic manipulative treatment in developing countries: a call for education and research
Szkwarko, D.
The Journal of the American Osteopathic Association, 2011/03
Free full text
1375

Somatische Dysfunktion
(Somatic dysfunction)
Adler-Michaelson, P.
Osteopathische Medizin, 2011/03
1376

Muscle energy technique: An evidence-informed approach
Fryer, G.
International Journal of Osteopathic Medicine, 2011/03
1377

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text
1378

Internationales Symposium: Osteopathie bei Neugeborenen & Kleinkindern vom 19.-21.11.2010
(International Symposium: Osteopathy for newborns & infants from 19-21.11.2010)
Nagel, M.
Osteopathische Medizin, 2011/03
1379

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03
1380

Internationaler Konsens zur Osteopathie - die Benchmarks der WHO
(International consensus regarding osteopathy - WHO's benchmarks)
Dräger, K.
Osteopathische Medizin, 2011/03
1381

New COMLEX-USA-to-USMLE conversion formula needed
Burmeister, J. D.
The Journal of the American Osteopathic Association, 2011/02
Free full text
1382

Communication by degrees
Melnick, A.
The Journal of the American Osteopathic Association, 2011/02
Free full text
1383

Student abstracts and poster competitions: encouraging research
Prinsen, J. K.
The Journal of the American Osteopathic Association, 2011/01
Free full text
1384

Relationship between encounter time and candidate performance on COMLEX-USA Level 2-PE
Sandella, J. M., Roberts, W. L., Langenau, E. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text
1385

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text
1386

HR Influence in a For-Profit Osteopathic Medical School: Staffing, Polices and Procedures
Pelletier, C.
Unpublished MSc thesis, 2011/01
1387

Desarrollo de un sistema multimedia como herramienta educativa para osteopatía estructural de la articulación sacroiliaca
(Development of a multimedia system as an educational tool for structural osteopathy of the sacroiliac joint)
Mahecha Orjuela, D. M.
Unpublished MSc thesis, 2011/01
Free full text
1388

EROP-Richtlinien: Kernkompetenzen und Praxisstandards in der osteopathischen Medizin
(EROP guidelines: Core competencies and practice standards in osteopathic medicine)
Mayer, J.
Osteopathische Medizin, 2010/12
1389

Interview mit Dr. med. Johannes Mayer zum Thema EROP-Richtlinien: Kernkompetenzen und Praxisstandards
(Interview with Dr. Johannes Mayer, M.D. on the topic EROP guidelines: Core competencies and practice standards)
Schmidt, S.
Osteopathische Medizin, 2010/12
1390

`Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 2010/12
Free full text
1391

Osteopathic Medicine's Holistic Approach Is More Important Than Ever
Goldberg, P. M.
The Journal of the American Osteopathic Association, 2010/12
Free full text
1392

Progression through osteopathic training in Australia: The student experience
Hartup, J. K., Murphy, R. A., Plowman, L. M., Myers, R.
International Journal of Osteopathic Medicine, 2010/12
1393

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 2: Treatment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
1394

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 1: Assessment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
1395

It Means Just What I Choose It to Mean--Neither More nor Less
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/12
Free full text
1396

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text
1397

Die Bekanntheit und Akzeptanz der Osteopathie bei niedergelassenen Ärzten im ländlichen und kleinstädtischen Bereich am Beispiel Wald und Weinviertel
The level of knowledge about osteopathy among medical doctors in private practice in the rural and small-town Weinviertel region
Wotruba, S.
Unpublished MSc thesis, 2010/12
Free full text
1398

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text
1399

Comments on “Commentary on the globalization of osteopathic medicine”
Findlay, T.
Osteopathic Family Physician, 2010/11
1400

Medical business education in colleges of osteopathic medicine
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2010/11
Free full text
1401

How the AOA established the first national guidelines for OMT
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2010/11
Free full text
1402

Reliability of bony anatomic landmark asymmetry assessment in the lumbopelvic region: application to osteopathic medical education
Stovall, B. A., Kumar, S.
The Journal of the American Osteopathic Association, 2010/11
Free full text
1403

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11
1404

Response to “Relationship between COMLEX and USMLE scores among osteopathic medical students who take both examinations“
Gimpel, J. R.
Teaching and Learning in Medicine, 2010/10
1405

Osteopathisches Patientenprofil in Bezug auf das Gesundheitssystem in Deutschland. Umfrage 2009
(Potential existing profile of typical osteopathy users at the German Health System. A survey 2009)
Tüffers, C.
Unpublished D.O. thesis, 2010/10
1406

Systematische Übersichtsarbeit über Definition, Nomenklatur und Klassifikation der Säuglingsasymmetrie bzw. Schiefhals bei Säuglingen.
(A Systematic Review on the Definition, Nomenclature and Classification on Infantile Asymmetry, respectively, Torticolllis in Infants)
Wagner, C.
Unpublished D.O. thesis, 2010/10
1407

Realigning the JAOA to sharpen our focus
Capobianco, P. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text
1408

Development, implementation, and outcomes of an initiative to integrate evidence-based medicine into an osteopathic curriculum
Laird, S., George, J., Sanford, S. M., Coon, S.
The Journal of the American Osteopathic Association, 2010/10
Free full text
1409

Soul sickness: a frequently missed diagnosis
Tobe, E. H.
The Journal of the American Osteopathic Association, 2010/10
Free full text
1410

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text
1411

8th International conference on advances in osteopathic research – ICAOR 2010
International Journal of Osteopathic Medicine, 2010/09
1412

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text
1413

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text
1414

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07
1415

Physiotherapie et osteopathie: une prise en charge reellement holistique des sportifs.
(Physiotherapy and osteopathy: a real holistic supervision of athletes)
Larequi, Y.
Revue Medicale Suisse, 2010/08
1416

COMLEX Level 2-PE Performance Differences between Left-handed and Right-handed Candidates
Langenau, E. E., Dyer, C.
The Journal of the American Osteopathic Association, 2010/08
1417

Standardized Patients and Osteopathic Manipulative Treatment During COMLEX-USA Level 2-PE
Sandella, J. M., Pugliano, G.
The Journal of the American Osteopathic Association, 2010/08
1418

Research and osteopathy: an interview with Dr Gary Fryer by Helge Franke
Franke, H.
Journal of Bodywork and Movement Therapies, 2010/07
Free full text
1419

Defining osteopathic medicine: can you put your finger on it?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2010/07
Free full text
1420

International medical graduates can be the answer to osteopathic graduate medical education vacancies and international recognition of osteopathic medicine
DeLengocky, T.
Osteopathic Family Physician, 2010/05
1421

Commentary on the globalization of osteopathic medicine
Qureshi, Y., Kusienski, A. M.
Osteopathic Family Physician, 2010/05
1422

Changes in US healthcare: our time is now, but for what?
Cain, R. A.
The Journal of the American Osteopathic Association, 2010/05
Free full text
1423

El desarrollo científico de la osteopatía en el ámbito internacional
(Scientific development of osteopathy at international level)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/05
1424

The anachronistic fight for osteopathic distinctiveness
Shore, E. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text
1425

Adding MI principles to your communication skills: an interview with Susan Butterworth, PhD
Butterworth, S.
The Journal of the American Osteopathic Association, 2010/04
Free full text
1426

Call to action: aggressively managing lipid levels
Carr, L. L.
The Journal of the American Osteopathic Association, 2010/04
Free full text
1427

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text
1428

An introduction to clinical research in osteopathic medicine
Earley, B. E., Luce, H.
Primary Care: Clinics in Office Practice, 2010/03
Free full text
1429

Kommentar der Deutsch-Amerikanischen Akademie für Osteopathie e.V. (DAAO)
(Comment of the German-American Academy of Osteopathy (DAAO))
Adler-Michaelson, P.
Osteopathische Medizin, 2010/03
1430

Forum zum Artikel: “Wissenschaftliche Bewertung osteopathischer Verfahren”
(Forum on the article: “Scientific assessment of osteopathic procedures“. Comment of the German Society of Chiropractic and Osteopathy (DGCO))
Daichendt, D.
Osteopathische Medizin, 2010/03
1431

Kommentar des Verbands der Osteopathen Deutschland e.V. (VOD)
(Comment of the German Osteopathic Association (VOD))
Fuhrmann, M.
Osteopathische Medizin, 2010/03
1432

Kommentar des Deutschen Registers Osteopathische Medizin (DROM)
(Comment of the German Register of Osteopathic Medicine (DROM))
Hartwig, B.
Osteopathische Medizin, 2010/03
1433

Kommentar der Deutschen Gesellschaft für Osteopathische Medizin e.V. (DGOM)
(Comment of the German Society of Osteopathic Medicine (DGOM))
Hogrefe, C.
Osteopathische Medizin, 2010/03
1434

Kommentar des Verbands Osteopathie Schule Deutschland (VOSD)
(Comment of the Association of the Osteopathic School in Germany (VOSD))
Nagel, M.
Osteopathische Medizin, 2010/03
1435

Kommentar des Register der Traditionellen Osteopathen in Deutschland GmbH (ROD)
(Comment of the Registry of Traditional Osteopathy in Germany (ROD))
Prediger, G.
Osteopathische Medizin, 2010/03
1436

Kommentar der Akademie für Osteopathie AFO
(Comment of the Academy of Osteopathy (AFO))
Schwerla-Goeggel, B. S.
Osteopathische Medizin, 2010/03
1437

Wissenschaftliche Bewertung osteopathischer Verfahren: Der Vorstand der Bundesärztekammer hat in seiner Sitzung vom 28. August 2009 folgende Ausarbeitung des Wissenschaftlichen Beirats zustimmend zur Kenntnis genommen
(Scientific assessment of osteopathic procedures)
Osteopathische Medizin, 2010/03
1438

Osteopathy 2.0: Osteopathy and the new web
Lucas, N. P.
International Journal of Osteopathic Medicine, 2010/03
1439

AOA should support IOM report on resident work hours
Conklin, J. H.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1440

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1441

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1442

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1443

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1444

Uniform instruction using web-based, asynchronous technology in a geographically distributed clinical clerkship: analysis of osteopathic medical student participation and satisfaction
Peska, D. N., Lewis, K. O.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1445

Osteopathic medical education in 2010: another decade of growth
Shannon, S. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1446

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1447

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text
1448

Osteopathie: Die Sicht der Bundesärztekammer
(Osteopathy: The view of the German Medical Association)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1449

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01
1450

Osteopathic Medicine and Primary Care: one journal, two audiences
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2010/01
Free full text
1451

The Efficacy of OMT by Osteopathic Medical Students on Musculoskeletal Pain and Somatic Findings
Hallas, S. J., Seffinger, M., Hurwitz, E.
The Journal of the American Osteopathic Association, 2010/01
1452

Anterior Cruciate Ligament Function in Osteopathic Medical Education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2010/01
1453

A Study to Investigate the Efficacy of a Novel Interactive Web-Based Virtual Clinical Scenario System (Virtual People Factory) in Medical Education
Surkunalingam, N., Walker, J., McCaskill, S., Taranto, C., Blanchard, C., Lind, D. S., Rossen, B., Lok, B.
The Journal of the American Osteopathic Association, 2010/01
1454

Perception of osteopathic medicine among allopathic physicians in the deep central southern United States
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text
1455

Keeping the osteopathic medical profession parallel and distinctive
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/12
Free full text
1456

Reject influence of pharmaceutical industry
McPartland, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text
1457

Profile of members of the Australian Osteopathic Association: Part 2 - The patients
Orrock, P.
International Journal of Osteopathic Medicine, 2009/12
1458

Billing and coding for OMT
Doss, Y. L., Snider, K. T.
The Journal of the American Osteopathic Association, 2009/11
Free full text
1459

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text
1460

Maintaining distinctiveness and affordability of osteopathic medical education
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/10
Free full text
1461

Personality types and performance: COMLEX-USA Level 2-CE
Getz, R., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2009/10
Free full text
1462

Curricular analysis of competency-based osteopathic medical education: application of a matrix for quality enhancement to a standardized patient encounter example
Lockwood, M. D., Tucker-Potter, S., Sargentini, N. J.
The Journal of the American Osteopathic Association, 2009/09
Free full text
1463

Interest in rural medicine among osteopathic residents and medical students
Colegrove, D. J., Whitacre, B. E.
Rural and Remote Health, 2009/09
1464

Swedenborg's influence on Sutherland's ‘Primary Respiratory Mechanism’ model in cranial osteopathy
Jordan, T.
International Journal of Osteopathic Medicine, 2009/09
1465

Prevention in Osteopathic Undergraduate Medical Education: A Survey of the Core Competencies in Disease Prevention and Health Promotion
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2009/08
1466

Teaching Psychiatry in Osteopathic Medical Schools: A Survey of Current Curriculum and a Suggested Primary Care Approach
Lowe, M., Murphy, M.
The Journal of the American Osteopathic Association, 2009/08
1467

Spiritual and Religious Characteristics of Osteopathic Medical Students
Workman, G. M., Lee, M. M., Nichols, K. J., Workman, D. E., Christian, V. L., Orlinsky, D. E.
The Journal of the American Osteopathic Association, 2009/08
1468

The DO difference: an analysis of causal relationships affecting the degree-change debate
Bates, B. R., Mazer, J. P., Ledbetter, A. M., Norander, S.
The Journal of the American Osteopathic Association, 2009/07
Free full text
1469

Stop smoking, save money, get free OMM
Byrnes Jr., T. R.
The Journal of the American Osteopathic Association, 2009/07
Free full text
1470

Exploring European osteopathic identity: An analysis of professional websites of European osteopathic organizations
Wagner, C.
Unpublished MSc thesis, 2009/07
Free full text
1471

The appropriate amount of force used must always be individualized for each patient during each treatment session
Abu-Sbaih, R.
The Journal of the American Osteopathic Association, 2009/07
Free full text
1472

Intent to “teach“ and pay to play in osteopathic medical education
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/06
Free full text
1473

Measuring awareness, interest, and involvement in the osteopathic community through board certification: a survey of DO residents in ACGME-accredited training programs
Scott, S. C., O'Connor, E. M., Marlow, R. A.
The Journal of the American Osteopathic Association, 2009/06
Free full text
1474

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text
1475

Monitoring self-reported adverse events: A prospective, pilot study in a UK osteopathic teaching clinic
Rajendran, D., Mullinger, B., Fossum, C., Collins, P., Froud, R.
International Journal of Osteopathic Medicine, 2009/06
1476

AM Last Page: Osteopathic medicine in the U.S.A
Cummings, M., Rohrer, J.
Academic Medicine, 2009/06
Free full text
1477

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text
1478

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
1479

The Changing Face of Medical Education: The Role of Religion, Integrative Medicine and Osteopathy
Grossoehme, D. H., Ragsdale, J., Dixon, C., Berz, K., Zimmer, M.
The Open Medical Education Journal, 2009/05
Free full text
1480

Intent to “teach“ and pay to play in osteopathic medical education
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/04
Free full text
1481

Etudiant osteopathe en geriatrie
(Osteopathy student in geriatrics. Interview by Agnes Maillard)
Forget, S.
Soins. Gerontologie, 2009/03-04
1482

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text
1483

Prevention, diagnosis, and management of osteoporosis-related fracture
Fakih, M.
The Journal of the American Osteopathic Association, 2009/03
Free full text
1484

Don't neglect the “art“ of medicine
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/03
Free full text
1485

Dual and parallel postdoctoral training programs: implications for the osteopathic medical profession
Burkhart, D. N., Lischka, T. A.
The Journal of the American Osteopathic Association, 2009/03
Free full text
1486

Osteopathic medical education in 2009: sails set for improved healthcare?
Shannon, S. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text
1487

Evolution of colleges of osteopathic medicine: a discussion of the COCA's “substantive change“ policies
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text
1488

Profile of members of the Australian Osteopathic Association: Part 1 - The practitioners
Orrock, P.
International Journal of Osteopathic Medicine, 2009/03
1489

New horizons for research and education in osteopathic manipulative medicine
Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2009/02
Free full text
1490

Osteopathie und (Hatha-)Yoga
(Osteopathy and (Hatha) yoga)
Liem, T.
Osteopathische Medizin, 2009/02
1491

Collaboration and excellence in osteopathic medical research
Manion, K. M.
The Journal of the American Osteopathic Association, 2009/01
Free full text
1492

An Analysis of the Use of Web-Based Materials by Medical Students and its Relationship to Learning Style
Halbert, C., Fresa-Dillon, K., Kriebel, R., Coughlin, P., Cuzzolino, R.
The Journal of the American Osteopathic Association, 2009/01
1493

A for-profit medical school
Mychaskiw, G., 2nd, Wiltshire
Academic Medicine, 2009/01
Free full text
1494

Performing Preclerkship Pelvic Examinations Improves Student Perceptions of Clerkship Preparedness
Lievens, A. M., May, L. E.
The Journal of the American Osteopathic Association, 2009/01
1495

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12
1496

Research underpins the evidence base for osteopathic medicine
Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12
Free full text
1497

Three pathways to a physician career: applicants to U.S. MD and DO schools and U.S. Citizen applicants to international medical schools
Jolly, P., Garrison, G., Boulet, J. R., Levitan, T., Cooper, R. A.
Academic Medicine, 2008/12
1498

Response: Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Fitzgerald, M.
The Journal of the American Osteopathic Association, 2008/12
Free full text
1499

Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Lanier, W. L.
The Journal of the American Osteopathic Association, 2008/12
Free full text
1500

COMLEX-USA and in-service examination scores: tools for evaluating medical knowledge among residents
Sevensma, S. C., Navarre, G., Richards, R. K.
The Journal of the American Osteopathic Association, 2008/12
Free full text
1501

The introduction of a novel approach to the teaching and assessment of osteopathic manipulative medicine assessment skills
Fossum, C., Snider, E., Fryer, G., Gillette, N., Degenhardt, B.
International Journal of Osteopathic Medicine, 2008/12
1502

Modern Reception of A.T.Still´s TRIUNE MAN in Germany
Kaiser, F.
Unpublished MSc thesis, 2008/11
Free full text
1503

The living matrix: a model for the primary respiratory mechanism
Lee, R. P.
Explore (NY), 2008/11
1504

Patients' perceptions and satisfaction with treatment in a UK osteopathic training clinic
Strutt, R., Shaw, Q., Leach, J.
Manual Therapy, 2008/10
1505

Supporting and promoting osteopathic medicine through community-based family practice preceptorships: a survey-based study
Aguwa, M. I., Monson, C. L., Liechty, D. K., Fowler, L. V., Kost, M. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
1506

Prevention, diagnosis, and management of osteoporosis-related fracture: a multifactoral osteopathic approach
Gronholz, M. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text
1507

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text
1508

The Meaning of Tensegrity Principles in Osteopathic Medicine
Pflüger, C.
Unpublished MSc thesis, 2008/09
Free full text
1509

Back to basic science: time for another Flexner report
Weissmann, G.
FASEB Journal, 2008/09
1510

Will the ‘real’ osteopathy please speak up?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/09
Free full text
1511

Commentary on ‘Is there a place for science in the definition of osteopathy’?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09
1512

Osteopathic certification evolving into a continuous certification model
Moskowitz, J. S.
The Journal of the American Osteopathic Association, 2008/09
Free full text
1513

One hundred thousand cases of influenza with a death rate of one-fortieth of that officially reported under conventional medical treatment
Dery, M.
The Journal of the American Osteopathic Association, 2008/09
Free full text
1514

Assessing Educational Impact of Osteopathic Pre-doctoral Teaching Fellows
Cross, B. M., Villanueva, R., Glover, J. C., Hiserote, R. M., Davis, G.
The Journal of the American Osteopathic Association, 2008/08
1515

Use of Ultrasonography in the Preclinical Education of Osteopathic Medical Students: A Pilot Study
Syperda, V. A., Trivedi, P. N., Melo, L. C., Freeman, M. L., Ledermann, E. J., Smith, T. M., Alben, J. O.
The Journal of the American Osteopathic Association, 2008/08
1516

Osteopathic medicine and community health fairs: increasing public awareness while improving public health
Stamat, H. M., Injety, K. R., Liechty, D. K., Pohlod, C. A., Aguwa, M. I.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1517

Evidence-based publications: balancing research mission and our community's needs
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1518

Keeping the flames of OMM burning
Hogarty, D. C.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1519

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1520

Eliminating bad, bad medicine: problems with P4P initiatives
McDonald, R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1521

Dangers of for-profit education: more than just words
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1522

Election year's first shot over the bow: reforms needed
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1523

Increase efforts to promote primary care
Rapp, R. W.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1524

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1525

AOA is strong advocate for debt relief and primary care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2008/07
Free full text
1526

Living in fast forward
Harper, D. L.
The Journal of the American Osteopathic Association, 2008/07
Free full text
1527

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text
1528

The osteopathic research center will remain key to osteopathic medical profession
Licciardone, J. C., King, H. H., Kearns, C. M.
The Journal of the American Osteopathic Association, 2008/07
Free full text
1529

Culture drives research funding
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2008/07
Free full text
1530

DOs need to define value of osteopathic medicine
Snow, R. J., Seffinger, M. A., McGill, S. L., Vincent, R. A.
The Journal of the American Osteopathic Association, 2008/07
Free full text
1531

Role of exercise therapy in osteopathic education, treatment and management
Zamani, J. M.
Unpublished PhD thesis, 2008/07
Free full text
1532

Teaching critical thinking in osteopathy – Integrating craft knowledge and evidence-informed approaches
Fryer, G.
International Journal of Osteopathic Medicine, 2008/06/01/
1533

Criticality, research, scholarship and teaching: Osteopaths as educators – what makes a good teacher?
Wallace, S. S.
International Journal of Osteopathic Medicine, 2008/06
1534

Consistency of standing and seated posture of asymptomatic male adults over a one-week interval: A digital camera analysis of multiple landmarks
Pownall, P. J., Moran, R. W., Stewart, A. M.
International Journal of Osteopathic Medicine, 2008/06
1535

Educating osteopaths to be researchers - what role should research methods and statistics have in an undergraduate curriculum?
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2008/06
Free full text
1536

Place de l’ostéopathie dans la correction des déformations crâniennes du nouveau-né et du jeune enfant
(Cranial osteopathy as a complementary treatment of postural plagiocephaly)
Amiel-Tison, C., Soyez-Papiernik, E.
Archives de Pédiatrie, 2008/06
1537

Saying what you mean and meaning what you say
Rogers, F. J.
The Journal of the American Osteopathic Association, 2008/06
Free full text
1538

AAO Convocation in Dallas, Texas
Beck, M.
Osteopathische Medizin, 2008/05
1539

Constraints to caring: service to medically indigent patients by allopathic and osteopathic physicians
Chirayath, H. T., Wentworth, A. L.
Journal of Health Care for the Poor and Underserved, 2008/05
1540

Excessive tuition does not equal excellent education
Andrews, C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text
1541

Award-winning debt-management education
Goeppinger, K. H.
The Journal of the American Osteopathic Association, 2008/05
Free full text
1542

Mortgaging our future, foreclosing our profession
Kraus II., C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text
1543

Working to ease debt burdens
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/05
Free full text
1544

The virtual haptic back: a simulation for training in palpatory diagnosis
Howell, J. N., Conatser, R. R., Williams II., R. L., Burns, J. M., Eland, D. C.
BMC Medical Education, 2008/04
1545

Expression of the endocannabinoid system in fibroblasts and myofascial tissues
McPartland, J. M.
Journal of Bodywork and Movement Therapies, 2008/04
1546

A randomized controlled trial of the effectiveness of osteopathy-based manual physical therapy in treating pediatric dysfunctional voiding
Nemett, D. R., Fivush, B. A., Mathews, R., Camirand, N., Eldridge, M. A., Finney, K., Gerson, A. C.
Journal of Pediatric Urology, 2008/04
Free full text
1547

Spirituality and medicine: prevalence of spirituality-in-medicine instruction at osteopathic medical schools
McClain, E. K., McClain, R. L., Desai, G. J., Pyle, S. A.
The Journal of the American Osteopathic Association, 2008/04
Free full text
1548

Embrace evidence...with both eyes open
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/04
Free full text
1549

OSTEOPAThic Health outcomes in chronic low back pain: The OSTEOPATHIC Trial
Licciardone, J. C., King, H. H., Hensel, K. L., Williams, D. G.
Osteopathic Medicine and Primary Care, 2008/04
1550

Towards an osteopathic understanding of evidence
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/03
Free full text
1551

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text
1552

Pushing bodies through COMs
Lisowsky, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text
1553

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03
1554

Osteopathic medical education in 2008: course corrections and new horizons
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/03
Free full text
1555

Medical education summits: building a solid foundation for the future of the osteopathic medical profession
Watson, D. K., Nichols, K. J.
The Journal of the American Osteopathic Association, 2008/03
Free full text
1556

OMM education vs “real world“ medicine
Davidson, S. M.
The Journal of the American Osteopathic Association, 2008/02
Free full text
1557

Ignorance in high places
Ha, L.
The Journal of the American Osteopathic Association, 2008/02
Free full text
1558

Colleges of osteopathic McMedicine?
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2008/02
Free full text
1559

Debt control for young DOs
Wagner, E.
The Journal of the American Osteopathic Association, 2008/02
Free full text
1560

Female osteopathic medical students: When the minority become the majority
Johnson, K. D.
Unpublished PhD thesis, 2008/01
1561

Palpatory diagnosis training on the virtual haptic back: performance improvement and user evaluations
Howell, J. N., Conatser, R. R., Williams, R. L., Burns, J. M., Eland, D. C.
The Journal of the American Osteopathic Association, 2008/01
Free full text
1562

Attitudes toward pay-for-performance initiatives among primary care osteopathic physicians in small group practices
Locke, R. G., Srinivasan, M.
The Journal of the American Osteopathic Association, 2008/01
Free full text
1563

„Attentionality”: Osteosophische Basisschritte zur sensorischen Körper-Spiritualität in der osteopathischen Medizin
('Attentionality': Basic osteosophic steps towards a sensory spirituality of the body in osteopathic medicine)
Beuckels, J. M.
Osteopathische Medizin, 2008/01
1564

Quantifying Structural Changes with the Application of Osteopathic Manual Medicine (OMM) in Tegucigalpa, Honduras
Hardee, A. B.
Unpublished PhD thesis, 2008/01
Free full text
1565

Self-reported health behaviors of osteopathic physicians
McNerney, J. P., Andes, S., Blackwell, D. L.
The Journal of the American Osteopathic Association, 2007/12
Free full text
1566

How and in what context do osteopathic medical students learn about interprofessional practice
Head French, J.
Unpublished Dissertation, 2007/12
Free full text
1567

Relationships between clinical rotation subscores, COMLEX-USA examination results, and school-based performance measures
Cope, M. K., Baker, H. H., Foster, R. W., Boisvert, C. S.
The Journal of the American Osteopathic Association, 2007/11
Free full text
1568

Evolution of osteopathic graduate medical education: integration of osteopathic principles and practice in postdoctoral training
Lemley, W. W., Steele, K. M., Shires, W. E., McMahan, R. M.
The Journal of the American Osteopathic Association, 2007/11
Free full text
1569

Andrew Taylor Still (1828-1917): founder of osteopathic medicine
Tan, S. Y., Zia, J. K.
Singapore Medical Journal, 2007/11
1570

Nonprofit and for-profit COMs: investing in the future of osteopathic medicine
Ajluni, P. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text
1571

Lake Erie College of Osteopathic Medicine's preclinical problem-based learning pathway program: an alternative medical school curriculum design
Ferretti, S. M., Krueger, W. A., Gabel, L. L., Curry, J. J.
The Journal of the American Osteopathic Association, 2007/10
Free full text
1572

Systematische Analyse der anatomischen Verbindungen der cranialen Gefäßabgänge des Aortenbogens mit Strukturen der oberen Thorax-apertur sowie der experimentellen Überprüfung ihrer mechanischen Abhängigkeit
(Systematically research of the anatomic links of the supraaortic arteries with thoracic outlet structures and an experimental testing of their mechanical dependence)
Vogt, R.
Unpublished D.O. thesis, 2007/10
1573

RVUCOM: striving to meet the needs of the osteopathic medical profession
Martin, R. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text
1574

Surgical workforce since the 1975 study of surgical services in the United States: an update
Sheldon, G. F.
Annals of Surgery, 2007/10
1575

A three-year accelerated medical school curriculum designed to encourage and facilitate primary care careers
Bell, H. S., Ferretti, S. M., Ortoski, R. A.
Academic Medicine, 2007/09
1576

Treatment of irritable bowel syndrome with osteopathy: results of a randomized controlled pilot study
Hundscheid, H. W., Pepels, M. J., Engels, L. G., Loffeld, R. J.
Journal of Gastroenterology and Hepatology, 2007/09
Free full text
1577

Three Shortcomings of Current Osteopathic Medical Education Curricula, a Student Perspective
Alvarez, R. A., Feitell, S., Jones, A. C., Landry, B. W., Mapley, A. C., Mason, C. R., Sarmiento, P. A., Schrick-Senasac, S. L.
Journal of Osteopathic Medicine, 2007/08
1578

Applicant Selection Criteria for Osteopathic Residency Programs
Ballam, G. O., Guillory, V. J.
Journal of Osteopathic Medicine, 2007/08
1579

Awareness of Health Disparities in Organ Donation among Osteopathic Medical Students
Burch, D. M., Gordon, A. R., Burnett, P. A.
The Journal of the American Osteopathic Association, 2007/08
1580

Attitudes towards Osteopathic Manipulation in Career Choices (ATOMICC)
Dunbar, B. D., Desai, G. J.
The Journal of the American Osteopathic Association, 2007/08
1581

Measuring pressures used by physicians and students for cervical diagnosis of segmental somatic dysfunction using the Iso-TOUCH® Palpation Monitor System
Jean, N. T., Kuchera, M. L., Schoenfeldt, B., Dombrowski, R. T., Vardy, T., Williams, L.
The Journal of the American Osteopathic Association, 2007/08
1582

Teaching Palpatory Force to Osteopathic Medical Students
Marchioni, R. M., Badoolah, A. H., Caban-Martinez, A., Patterson, M. M.
The Journal of the American Osteopathic Association, 2007/08
1583

Factors Contributing to Osteopathic Manipulation Usage at Army Family Medicine Residency Programs
Platz, K. E., Asplund, C. A.
The Journal of the American Osteopathic Association, 2007/08
1584

Treating the cause
Stimson, N.
British Dental Journal, 2007/08
1585

Getting “beyond the barriers“ in reforming osteopathic medical education
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
1586

Emphasizing research in osteopathic medical education
Martin, K. D.
The Journal of the American Osteopathic Association, 2007/07
Free full text
1587

COM Accreditation: the Flexner Report revisited
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2007/07
Free full text
1588

Getting back to the country
Ortolon, K.
Texas Medicine, 2007/07
1589

Trichotillomania: a rare but serious disorder
Rodos, J. J.
The Journal of the American Osteopathic Association, 2007/07
Free full text
1590

Is estimating USMLE performance useful?
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2007/06
Free full text
1591

Should your GP be an osteopath? Patients' views of an osteopathy clinic based in primary care
Westmoreland, J. L., Williams, N. H., Wilkinson, C., Wood, F., Westmoreland, A.
Complementary Therapies in Medicine, 2007/06
Free full text
1592

Repatriating DOs with MD-affiliated residencies
Forte, T. E.
The Journal of the American Osteopathic Association, 2007/05
Free full text
1593

Promoting an osteopathic medical research culture
Lee, R. P.
The Journal of the American Osteopathic Association, 2007/05
Free full text
1594

Competence levels in musculoskeletal medicine: a call to action
Ruane, J. J.
The Journal of the American Osteopathic Association, 2007/05
Free full text
1595

Irresistible indexes for somatic dysfunction
Sucher, B. M.
The Journal of the American Osteopathic Association, 2007/05
Free full text
1596

Osteopathic focus in the biomedical sciences: A survey of biomedical science faculty at osteopathic medical schools in the United States
Ebert, D. E.
Unpublished MSc thesis, 2007/05
1597

Integration of osteopathic manipulative medicine into differential diagnosis training: A study evaluating teaching strategies and their influence on student learning
Irvine-Moore, L. R.
Unpublished MSc thesis, 2007/05
1598

Latino success stories in higher education: A qualitative study of recent graduates from a health science center
Colley, K. L.
Unpublished PhD thesis, 2007/05
Free full text
1599

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text
1600

Osteopathic medical education in 2007: plumbing the depths with the questions we ask
Shannon, S. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text
1601

Practice patterns among osteopathic dermatologists in the United States
Yoo, J. Y., Lee, H., Kimball, A. B.
Journal of the American Academy of Dermatology, 2007/03
1602

Knowing the body and embodying knowledge: an ethnography of student practitioner experiences in osteopathy and homeopathy
Gale, N. K.
Unpublished PhD thesis, 2007/03
Free full text
1603

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2007/02
Free full text
1604

Osteopathy. Sensing and Philosophy
Weber, K.H.
Unpublished MSc thesis, 2007/01
Free full text
1605

Osteopathic degrees overseas
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2007/01
Free full text
1606

Teaching “doctoring“: a model curriculum for family medicine
Wilson, M. A., Blondefield, P. J.
The Journal of the American Osteopathic Association, 2007/01
Free full text
1607

Approval of ACGME Training as an AOA-approved internship: history and review of current data
Bulger, J. B.
The Journal of the American Osteopathic Association, 2006/12
Free full text
1608

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text
1609

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11
1610

Interests in research electives among osteopathic medical students
Pheley, A. M., Lois, H., Strobl, J.
The Journal of the American Osteopathic Association, 2006/11
Free full text
1611

Teaching critical appraisal: a pilot randomized controlled outcomes trial in undergraduate osteopathic medical education
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/11
Free full text
1612

A problem-based learning pathway for medical students: Improving the process through action research
Chegwidden, W. R.
Annals of the Academy of Medicine Singapore, 2006/09
Free full text
1613

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text
1614

Computer-assisted instruction: a survey on the attitudes of osteopathic medical students
Forman, L. J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text
1615

Teaching Osteopathic Manipulative Treatment to Allopathic Family Medicine Residents: The Role of the Community Preceptor
Jorgensen, S., Quinlan, J., Soldo, T.
The Journal of the American Osteopathic Association, 2006/08
1616

Assessing the Effectiveness of OMT Provided by Undergraduate Teaching Fellows as Measured by a Visual Analog Pain Scale
Lerma, C. M., Render, R. M., Sarkaria, J. A., Homertgen, K. D., Hruby, R. J.
The Journal of the American Osteopathic Association, 2006/08
1617

AOA certifying boards are credible and capable
Reeves, R. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text
1618

Worlds of Western medicine and Chinese medicine learning from each other
Wu, E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
1619

Proof-of-concept learning: acrylic templates as empiric evidence
White, J. E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
1620

Future of osteopathic medicine depends on investing in graduate medical education
Tosca, M.
The Journal of the American Osteopathic Association, 2006/07
Free full text
1621

Addressing substance abuse in medical school curricula
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2006/07
Free full text
1622

Suggestions and questions for osteopathic medical education
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2006/06
Free full text
1623

Competence levels in musculoskeletal medicine: comparison of osteopathic and allopathic medical graduates
Stockard, A. R., Allen, T. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text
1624

Progressive idea for osteopathic medical education
Belsky, D. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text
1625

Relationships between scores on the COMLEX-USA Level 2-Performance Evaluation and selected school-based performance measures
Baker, H. H., Cope, M. K., Adelman, M. D., Schuler, S., Foster, R. W., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2006/05
Free full text
1626

Will the last DO turn off the lights?
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2006/05
Free full text
1627

Survey on the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, J. R., Weidner, A. C.
The Journal of the American Osteopathic Association, 2006/05
Free full text
1628

Let the beauty of the marketplace benefit healthcare
Bliss, G.
The Journal of the American Osteopathic Association, 2006/04
Free full text
1629

Whole person medicine: a definition articulated osteopathically
Rosen, M. E.
The Journal of the American Osteopathic Association, 2006/04
Free full text
1630

Credit where credit's due: forebears of the Osteopathic Research Center
Goldsmith, D. M.
The Journal of the American Osteopathic Association, 2006/04
1631

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text
1632

Center or periphery? The future of osteopathic principles and practices
Gevitz, N.
The Journal of the American Osteopathic Association, 2006/03
Free full text
1633

What If? Thomas L. Northup Lecture, 2005
Dowling, D. J.
The AAO Journal, 2006/03
Free full text
1634

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text
1635

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1636

Osteopathic medical education in 2006: charting a course for the future
Shannon, S. C.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1637

Ein Interview mit Jane Carreiro, D.O.; Osteopathisch-Richtlinien für die WHO
(An interview with Jane Carreiro, D.O.; Osteopathic guidelines for the WHO)
Schmidt, S.
Osteopathische Medizin, 2006/02
1638

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1639

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1640

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1641

Computer animation and improved student comprehension of basic science concepts
Thatcher, J. D.
The Journal of the American Osteopathic Association, 2006/01
Free full text
1642

Plans for new conjoint certificate of added qualifications in hospice and palliative medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2006/01
1643

A phenomenological single case study of African American medical students in a predominantly White college of osteopathic medicine
Brown, T. A. Sr.
Unpublished PhD thesis, 2006/01
1644

Navigation in neurologic localization: web site launch
Hoegerl, C.
The Journal of the American Osteopathic Association, 2006/01
Free full text
1645

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12
1646

Osteopathie gestern und morgen - Medizin des 21. Jahrhunderts
(Osteopathy of the past and the present - medicine in the 21st century)
Gritsch, J.
Unpublished MSc thesis, 2005/12
1647

Dynamic duo: Maine-Dartmouth Family Practice Residency program and University of New England College of Osteopathic Medicine
Perakis, C.
The Journal of the American Osteopathic Association, 2005/11
Free full text
1648

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text
1649

Surprised by surgery statistics
Kattner, K. A.
The Journal of the American Osteopathic Association, 2005/10
Free full text
1650

Das Menschenbild von A. T. Still:: „MAN IS TRIUNE“. Eine Untersuchung des Ursprungs von „MAN IS TRIUNE“
(A. T. Still´s Idea of Man: „MAN IS TRIUNE“. A Research of the Origin of „MAN IS TRIUNE“)
Dippon, M.
Unpublished D.O. thesis, 2005/10
1651

Missed opportunity for osteopathic medical education
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
1652

The “Big DO“
Werrell, B. H.
The Journal of the American Osteopathic Association, 2005/10
Free full text
1653

Jumping through hoops for osteopathic internships
Snyder, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
1654

Graduate medical education: accuracy of AOA's annual data-reporting mechanisms questioned
Cummings, M.
The Journal of the American Osteopathic Association, 2005/10
Free full text
1655

Die osteopathische Medizin im Dilemma zwischen Tradition und Moderne
(Osteopathic medicine in the dilemma between tradition and modern approach)
Beck, M., Unverricht, R.
Osteopathische Medizin, 2005/10
1656

Teacher, heal thyself
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/09
1657

Evidence base presented--and expanding--for investment in tobacco dependence curricula for osteopathic medical education
Montalto, N. J., Priester, T. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1658

Loyalty to the profession, not the AOA: evidence base necessary for member support of association policies
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1659

Attention applicants: please submit emotional intelligence scores
Sefcik, D. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1660

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1661

Biologische Basis des osteopathischen Konzeptes
(Biological basis of osteopathic concepts)
Korr, I. M.
Osteopathische Medizin, 2005/09
1662

The short term effect of atlanto-axial high velocity low amplitude manipulation with cavitation on Edge Light Pupil Cycle Time
Gosling, C. M. R., Kinross, T., Gibbons, P., Holmes, M.
International Journal of Osteopathic Medicine, 2005/09
1663

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text
1664

Medical students' perceptions of medical education research and their roles as participants
Forester, J. P., McWhorter, D. L.
Academic Medicine, 2005/08
Free full text
1665

CV4 technique as a tool to decrease psychological stress in osteopathic medical students
Shah, A., Donaldson, N., Campomanes, C., Barragan, H., Menini, T., Binkerd, J.
The Journal of the American Osteopathic Association, 2005/07
1666

Dreigliedrige Osteopathie
(Triune osteopathy)
Pöttner, M., Hartmann, C.
Osteopathische Medizin, 2005/07
1667

The Impact of Osteopathic Manipulative Treatment on Future Osteopathic Physicians
Williams, J., Howell, J. P.
The Journal of the American Osteopathic Association, 2005/07
1668

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text
1669

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text
1670

Psychosocial factors in osteopathic practice: To what extent should they be assessed?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/06
1671

Promoting active engagement with osteopathic principles and practice in interns and residents
Cain, R. A.
The Journal of the American Osteopathic Association, 2005/05
Free full text
1672

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text
1673

Kudos on electronic-only COMLEX-USA
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1674

Same as it ever was
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1675

“Hardship exception“ is necessary
Zawadzki, E.
The Journal of the American Osteopathic Association, 2005/03
1676

Osteopathic medical training revisited: developing tomorrow's physicians
Innes, K.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1677

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03
1678

Chairman of COPT concludes debate on “hardship exception“
Opipari, M. I.
The Journal of the American Osteopathic Association, 2005/02
Free full text
1679

The biodynamic model of osteopathy in the cranial field
McPartland, J. M., Skinner, E.
Explore (NY), 2005/01
1680

Rebuttal regarding the “hardship exception“
Steier, K. J.
The Journal of the American Osteopathic Association, 2005/01
1681

A pilot study investigating professional standardisation and harmonisation in osteopathic institutions within Europe and Australia
Hristov, A.
Unpublished MSc thesis, 2005/01
Free full text
1682

An observational study of student osteopaths' measurement of arterial blood pressure by sphygmomanometry and auscultation
Tye-Smith, A.
Unpublished MSc thesis, 2005/01
Free full text
1683

Osteopathie und Chiropraktik
(Osteopathy and chiropractic)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1684

Relationship of Medical Students' Pre-Matriculate Clinical Experience to Step I Medical Board Examination Scores
Laster, B. B.
Unpublished MSc thesis, 2004/12
Free full text
1685

Osteopathic medical training: developing the seasoned osteopathic physician
Clark, R. C.
The Journal of the American Osteopathic Association, 2004/11
1686

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text
1687

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text
1688

DO outlines steps to malpractice reform
Michaud, R. G.
The Journal of the American Osteopathic Association, 2004/10
Free full text
1689

Am I a carer and do I care? An exploration of the concept of care as applied to osteopathic practice
Barnes, A.
Medicine, Health Care and Philosophy, 2004/09
1690

DO notes difference between residency programs
Hornbeck, K. L.
The Journal of the American Osteopathic Association, 2004/09
Free full text
1691

Ganz ganzheitlich als osteopathisch tätiger Physiotherapeut
(Completely comprehensive as osteopathic physiotherapist)
Meert, G. F.
Osteopathische Medizin, 2004/08
1692

Interview: Jane Stark
(An interview with Jane Stark)
Stark, J.
Osteopathische Medizin, 2004/08
1693

Ganz ganzheitlich: Ganzheitlichkeit der Osteopathie?
(Completely comprehensive: Comprehensiveness of osteopathy?)
Wührl, P.
Osteopathische Medizin, 2004/08
1694

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text
1695

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text
1696

Tobacco dependence curricula in undergraduate osteopathic medical education
Montalto, N. J., Ferry, L. H., Stanhiser, T.
The Journal of the American Osteopathic Association, 2004/08
Free full text
1697

In opposition to Resolution 42
Steier, K. J.
The Journal of the American Osteopathic Association, 2004/08
Free full text
1698

Yes, Dr Still, an MD won the 2004 Northup Writing Award!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/07
Free full text
1699

Performance on the American Osteopathic Board of Internal Medicine certifying examination 1986-2002 of various demographic groups and the impact of AOA reentry resolutions on allopathic-trained candidates taking the examination
Slick, G. L.
The Journal of the American Osteopathic Association, 2004/07
Free full text
1700

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text
1701

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text
1702

Evaluating the rationale of the osteopathic internship
Smith, A. B.
The Journal of the American Osteopathic Association, 2004/06
Free full text
1703

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text
1704

Preliminary trial of a survey instrument to detect outcomes of curriculum reform in osteopathic manipulative medicine
von Lindeman, A.
Unpublished MSc thesis, 2004/05
1705

A divisional approach to enhancing research among osteopathic family practice residents
Smith-Barbaro, P., Fulda, K. G., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2004/04
Free full text
1706

Osteopathic emergency medicine
Anderson, G. V.
Annals of Emergency Medicine, 2004/03
Free full text
1707

Energy medicine: an osteopath's personal view
Handoll, N.
The Journal of Alternative and Complementary Medicine, 2004/03
1708

Status of complementary and alternative medicine in the osteopathic medical school curriculum
Saxon, D. W., Tunnicliff, G., Brokaw, J. J., Raess, B. U.
The Journal of the American Osteopathic Association, 2004/03
Free full text
1709

Interdisciplinary approach to teaching medication adherence to pharmacy and osteopathic medical students
Singla, D. L., MacKinnon, G. E., 3rd, MacKinnon, K. J., Younis, W., Field
The Journal of the American Osteopathic Association, 2004/03
Free full text
1710

AOA membership and board certification of residency graduates: comparison of three programs accepting osteopathic physicians--implications for graduate medical education
Hayes, O. W.
The Journal of the American Osteopathic Association, 2004/02
Free full text
1711

Strength in collaboration
Quinn, A.
The Journal of the American Osteopathic Association, 2004/02
Free full text
1712

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text
1713

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text
1714

Analysis of co-pathologies in 1000 patients attending an osteopathic teaching clinic
Blajer, J.
Unpublished MSc thesis, 2004/01
Free full text
1715

An investigation of the factors underlying the choice of treatment modalities used by students in the Victoria University Osteopathic clinic and practicing osteopaths
Kennedy, L.
Unpublished MSc thesis, 2004/01
Free full text
1716

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain
Lamaro, J.
Unpublished MSc thesis, 2004/01
Free full text
1717

The effect of training on the inter-examiner and intra-examiner reliability of static palpation for assessing pelvic landmarks
McPherson, H. C.
Unpublished MSc thesis, 2004/01
Free full text
1718

The perceived effect that part-time work has on undergraduate and postgraduate osteopathic students
Nolle, C.
Unpublished MSc thesis, 2004/01
Free full text
1719

Inter-examiner and intra-examiner reliability of the seated flexion test
O'Keefe, P.
Unpublished MSc thesis, 2004/01
Free full text
1720

The efficacy of the osteopathic manipulative medicine pre-doctoral fellowship program at the Texas College of Osteopathic Medicine at the University of North Texas Health Science Center
McCurdy, E. N.
Unpublished MSc thesis, 2004/01
1721

Bedside cardiology skills training for the osteopathic internist using simulation technology
Issenberg, S. B., Gordon, M. S., Greber, A. A.
The Journal of the American Osteopathic Association, 2003/12
Free full text
1722

Support needed for clinical faculty in osteopathic emergency medicine residencies
Minor, S. K., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2003/12
Free full text
1723

Inclusion of evidence-based medicine in colleges of osteopathic medicine and suggestions for implementing evidence-based medicine into osteopathic medical school curricula
Cundari, A. D., Ker, N.
The Journal of the American Osteopathic Association, 2003/11
Free full text
1724

Relations between academic performance by medical students and COMLEX-USA Level 2: a multisite analysis
Evans, P., Goodson, L. B., Schoffman, S. I., Baker, H. H.
The Journal of the American Osteopathic Association, 2003/11
Free full text
1725

Correlation between prior exercise and present health and fitness status of entering medical students
Peterson, D. F., Degenhardt, B. F., Smith, C. M.
The Journal of the American Osteopathic Association, 2003/11
Free full text
1726

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text
1727

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text
1728

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10
1729

A prospective study of osteopathic medical students' attitudes toward use of osteopathic manipulative treatment in caring for patients
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2003/10
Free full text
1730

Characteristics of the courses that best predict COMLEX-USA level 1 performance
Sefcik, D. J., Prozialeck, W. C., O'Hare, T. H.
The Journal of the American Osteopathic Association, 2003/10
Free full text
1731

Productivity outcomes for recent grants and fellowships awarded by the American Osteopathic Association Bureau of Research
Rose, R. C., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2003/09
Free full text
1732

Development of the Attitudes Toward Osteopathic Principles and Practice Scale (ATOPPS): preliminary results
Russo, D. P., Stoll, S. T., Shores, J. H.
The Journal of the American Osteopathic Association, 2003/09
Free full text
1733

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text
1734

Osteopathic and Allopathic Family Practice Residents' Attitudes Toward OMT/OPP
Allee, B. A., Pollak, M. H., Malnar, K. F., Elfrink, L. D., Mulkey, L. E.
Journal of Osteopathic Medicine, 2003/08
1735

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text
1736

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text
1737

Predictive validity of osteopathic medical licensing examinations for osteopathic medical knowledge measured by graduate written examinations
Cavalieri, T. A., Shen, L., Slick, G. L.
The Journal of the American Osteopathic Association, 2003/07
Free full text
1738

Osteopathic graduate medical education opportunities abound in south Florida
Pinto, M. G.
The Journal of the American Osteopathic Association, 2003/07
Free full text
1739

Emergency medicine resident work productivity and procedural accomplishment
Deveau, J. P., Lorenz, J. E., Hughes, M. J.
The Journal of the American Osteopathic Association, 2003/06
Free full text
1740

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
1741

Awareness and use of osteopathic physicians in the United States: results of the Second Osteopathic Survey of Health Care in America (OSTEOSURV-II)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/06
Free full text
1742

Regarding the editorial on tobaccoism
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/04
1743

Thanks for professional support
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2003/04
1744

Time to forge affiliations between osteopathic medical schools and hospitals
Belsky, D. H.
The Journal of the American Osteopathic Association, 2003/03
Free full text
1745

Tobaccoism revisited
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/03
Free full text
1746

Failure to convince osteopathic medical students of OMT's worth increases risk of subspecialization
Corbett, R. M.
The Journal of the American Osteopathic Association, 2003/02
Free full text
1747

Benefits of osteopathic schools
Blackstone, E. A.
Health Affairs, 2003/01
1748

Results of a survey of inaugural class graduates of a college of osteopathic medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2003/01
Free full text
1749

A pilot study of the fundamental elements of osteopathic diagnosis as currently taught in the osteopathy course at Victoria University
Chisari, M.
Unpublished MSc thesis, 2003/01
Free full text
1750

Osteopathic treatments and the techniques used in the treatment of acute mechanical low back pain
Daskalou, D.
Unpublished MSc thesis, 2003/01
Free full text
1751

What is the relationship between indicators of stress and academic performance in third year university students: a follow up study
Flint, D.
Unpublished MSc thesis, 2003/01
Free full text
1752

Clinical thinking: does your choice of university make a difference?
Harris, M.
Unpublished MSc thesis, 2003/01
Free full text
1753

The impact of curricular reform on student opinions of their osteopathic manipulative medicine education
Niedzwecki, C. M.
Unpublished MSc thesis, 2003/01
1754

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text
1755

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01
1756

Reasons for student debt during medical education: a Michigan study
Zonia, S. C., Stommel, M., Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 2002/12
Free full text
1757

Improving the oral health knowledge of osteopathic medical students
Skelton, J., Smith, T. A., Betz, W. T., Heaton, L. J., Lillich, T. T.
Journal of Dental Education, 2002/11
1758

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
1759

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
1760

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11
1761

Selection criteria for applicants in primary care osteopathic graduate medical education
Bates, B. P.
The Journal of the American Osteopathic Association, 2002/11
Free full text
1762

State of the art in standardized patient programs: a survey of osteopathic medical schools
Errichetti, A. M., Gimpel, J. R., Boulet, J. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text
1763

Relationship of osteopathic medical licensure examinations with undergraduate admission measures and predictive value of identifying future performance in osteopathic principles and practice/osteopathic manipulative medicine courses and rotations
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2002/11
Free full text
1764

Institutional impact of a part-time faculty development fellowship program for osteopathic community-based physicians
Pinheiro, S. O., Liechty, D. K., Busch, K. V., Johnson, E. S., Dora, D. L., Butler, R. M.
The Journal of the American Osteopathic Association, 2002/11
Free full text
1765

Training family medicine residents for assessment and advocacy of older adults
Robbins, M. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text
1766

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text
1767

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text
1768

Working less, training harder
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2002/10
Free full text
1769

Research Interests and Motivations Among Osteopathic Medical Students: Results of a Pre-Clinical Student Survey
Licciardone, J. C., Fulda, K., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/09
1770

Re: Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
McGovern, J. J., McGovern, R. J., Lemley, W. W.
The AAO Journal, 2002/09
Free full text
1771

Students', Interns' and Residents' Comfort and Confidence With Their OMT Skills
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2002/09
1772

Student performance on the Comprehensive Osteopathic Medical Licensing Examination-USA level 2 following a clinical evaluation, feedback, and intervention program
Agostini, D. E., Stano, A. S., Parente, D. H.
The Journal of the American Osteopathic Association, 2002/09
Free full text
1773

The anatomy professor that ate New York: some dinosaurs are teachers, and some teach about dinosaurs
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2002/08
Free full text
1774

Rating interest in clinical research among osteopathic medical students
Licciardone, J. C., Fulda, K. G., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/08
Free full text
1775

A Discussion of Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
Lemley, W. W.
The AAO Journal, 2002/06
Free full text
1776

Resources in bioethics at osteopathic medical schools
Peppin, J., Leeper, K., Garloff, D.
Academic Medicine, 2002/05
Free full text
1777

Can we afford to lose another osteopathic teaching facility?
Dickason, R. H.
The Journal of the American Osteopathic Association, 2002/05
Free full text
1778

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text
1779

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text
1780

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04
1781

Student and patient perspectives on the interaction between supervisors, students and patients during the clinical teaching experience at a university out-patient clinic: a descriptive pilot study
Robertson, A., Gibbons, P., Carter, A.
Journal of Osteopathic Medicine, 2002/04
1782

Editorial
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2002/04
1783

Osteopathy: A Noun Not Just An Adjective
Habenicht, A. L.
The AAO Journal, 2002/03
Free full text
1784

Osteopathic philosophy must be the foundation of osteopathic medical education
Beals-Becker, L.
The Journal of the American Osteopathic Association, 2002/03
Free full text
1785

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text
1786

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02
1787

Proposed tenets of osteopathic medicine and principles for patient care
Rogers, F. J., D'Alonzo, G. E., Jr., Glover, J. C., Korr, I. M., Osborn, G. G., Patterson, M. M., Seffinger, M. A., Taylor, T. E., Willard
The Journal of the American Osteopathic Association, 2002/02
Free full text
1788

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text
1789

An alert regarding Canada's financial aid for an osteopathic medical education
Campbell, A.
The Journal of the American Osteopathic Association, 2002/01
Free full text
1790

End-of-life care focus critical to a complete medical education
Gaber, R.
The Journal of the American Osteopathic Association, 2002/01
Free full text
1791

Identifying competencies for effective osteopathic physicians in the 21st century
Walrod, S.
Unpublished PhD thesis, 2002/01
Free full text
1792

Osteopathic approach may be helpful in war on terrorism
Rogers, F. J.
The Journal of the American Osteopathic Association, 2002/01
Free full text
1793

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text
1794

Introduction to the Texas College of Osteopathic Medicine at the University of North Texas Health Science Center at Fort Worth
Aylett, K., Squires, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
1795

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
1796

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text
1797

Is there any osteopathy in the specialty training of osteopathic residents?
Glover, J. C.
The AAO Journal, 2001/12
Free full text
1798

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
1799

Pre-Doctoral Fellowship Program in the Osteopathic Manipulative Medicine Program at the Texas College of Osteopathic Medicine
Slicho, T., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
1800

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
1801

Research Accomplishments of the Department of Osteopathic Manipulative Medicine of the Texas College of Osteopathic Medicine
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
1802

Neuromusculoskeletal Medicine and Osteopathic Manipulative Treatment Residency Programs at the Osteopathic Medical Center of Texas
Stoll, S. T., Carnes, M., Brooks, L.
The AAO Journal, 2001/12
Free full text
1803

Guide OPTI development beyond organizational differences
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text
1804

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
1805

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
1806

A Fact: The Medical Industry Doesn't Support Hands-On CME!
Noone, S. J.
The AAO Journal, 2001/12
Free full text
1807

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text
1808

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text
1809

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text
1810

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text
1811

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09
1812

Marketing lessons and retaining the traditional osteopathic internship
Broder, D. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text
1813

Development of the Attitudes Toward Osteopathic Principles and Practices Scale (ATOPPS): Preliminary Results of a Pilot Project
Russo, D. P., Stoll, S. T., Shores, J.
The Journal of the American Osteopathic Association, 2001/09
1814

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
1815

Osteopathic medical schools should foster sense of identity
Fogel, R. M.
The Journal of the American Osteopathic Association, 2001/06
Free full text
1816

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
1817

President Bush's 2002 budget proposal would hamper geriatric education
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text
1818

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text
1819

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
1820

The Interdisciplinary Generalist Curriculum Project at Nova Southeastern University College of Osteopathic Medicine
Blavo, C., Steinkohl, D. C.
Academic Medicine, 2001/04
Free full text
1821

Researched and demonstrated: inquiry and infrastructure at osteopathic institutions
Gevitz, N.
The Journal of the American Osteopathic Association, 2001/03
Free full text
1822

Going global with osteopathic medicine
Smith, D. A.
The Journal of the American Osteopathic Association, 2001/03
Free full text
1823

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text
1824

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text
1825

Testing osteopathic medical school graduates for licensure: is COMLEX-USA the most appropriate examination?
Graneto, J.
The Journal of the American Osteopathic Association, 2001/01
Free full text
1826

Collaboration between pharmacy and osteopathic medicine to teach via the Internet
Sweeney, M. A., Schuster, M. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text
1827

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text
1828

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
1829

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
1830

A fresh look at osteopathic medical education in 2000
Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2000/11
1831

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
1832

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
1833

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text
1834

Enrollment management strategies and practices at colleges of osteopathic medicine
Guidry, B. S.
Unpublished Dissertation, 2000/11
1835

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
1836

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
1837

An examination of the status of osteopathic medicine from 1960 to 2000
Steinberg, S. H.
Unpublished PhD thesis, 2000/10
1838

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
1839

Use of a computer-assisted clinical case (CACC) SOAP note exercise to assess students' application of osteopathic principles and practice
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2000/07
Free full text
1840

Survey of medical ethics in US medical schools: a descriptive study
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2000/06
Free full text
1841

Osteopathic success in the treatment of influenza and pneumonia. 1919
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/05
Free full text
1842

Relationship between academic achievement and COMLEX-USA Level 1 performance: a multisite study
Baker, H. H., Foster, R. W., Bates, B. P., Cope, M. K., McWilliams, T. E., Musser, A., Yens, D.
The Journal of the American Osteopathic Association, 2000/04
Free full text
1843

Unity may preserve osteopathic ideals
Adair, A. D.
The Journal of the American Osteopathic Association, 2000/03
Free full text
1844

Relationship of preadmission variables and first- and second-year course performance to performance on the National Board of Osteopathic Medical Examiners' COMLEX-USA Level 1 examination
Baker, H. H., Cope, M. K., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2000/03
Free full text
1845

Inter-examiner and intra-examiner agreement for assessing sacroiliac anatomical landmarks using palpation and observation: pilot study
O'Haire, C., Gibbons, P.
Manual Therapy, 2000/02
1846

Take the time to teach to ensure the legacy and future of our profession
Steier, K. J.
Journal of Osteopathic Medicine, 1999/12
Free full text
1847

Comparison of osteopathic and allopathic medical schools' support for primary care
Peters, A. S., Clark-Chiarelli, N., Block, S. D.
Journal of General Internal Medicine, 1999/12
1848

Importance of OMT cannot be overemphasized
Abend, D. S.
Journal of Osteopathic Medicine, 1999/12
Free full text
1849

Evaluierung und kritische Bewertung von in der europaischen Literatur veroffentlichten, osteopathischen Studien im klinischen Bereich und im Bereich der Grundlagenforschung.
(Evaluation and critical review published in the European literature on osteopathic studies in the clinical field and in the area of fundamental research)
Schwerla, F., Hass-Degg, K., Schwerla, B.
Forschende Komplementärmedizin, 1999/12
1850

Osteopathic unity must continue
Ross, K. E.
Journal of Osteopathic Medicine, 1999/10
Free full text
1851

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text
1852

Osteopathic medical education in the 21st century--translating educational challenges into professional opportunities
Kasovac, M.
Journal of Osteopathic Medicine, 1999/08
Free full text
1853

Professional identification and affiliation of the 1992 graduate class of the colleges of osteopathic medicine
Aguwa, M. I., Liechty, D. K.
Journal of Osteopathic Medicine, 1999/08
Free full text
1854

Training osteopathic geriatric academicians: impact of a model geriatric residency program
Cavalieri, T. A., Basehore, P., Perweiler, E., Chopra, A.
Journal of Osteopathic Medicine, 1999/07
Free full text
1855

OMM beyond the classroom – The Future is now
Veneziano, M.
The AAO Journal, 1999/06
Free full text
1856

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text
1857

Support programs for minority students at Ohio University College of Osteopathic Medicine
Thompson, H. C., Weiser, M. A.
Academic Medicine, 1999/04
1858

Visualization technology in medical education
Gorbis, S., Hallgren, R. C.
Journal of Osteopathic Medicine, 1999/04
Free full text
1859

Call to develop and implement dually approved residency programs
Daftarian, H.
Journal of Osteopathic Medicine, 1999/04
Free full text
1860

1998 Louisa Burns Memorial Lecture: can teaching and research coexist?
Yorio, T.
Journal of Osteopathic Medicine, 1999/03
Free full text
1861

Chiropractic and osteopathic education at Royal Melbourne Institute of Technology. A student perspective
French, S. D., Marshall, S. J., Webb, M., Tucker, C.
Australasian Chiropractic & Osteopathy, 1999/03
Free full text
1862

Making a difference: the osteopathic approach lecture series
Danto, J. B., Kavieff, T. R.
Journal of Osteopathic Medicine, 1999/03
Free full text
1863

Seize opportunity to foster osteopathic pride
Bahrami, P.
Journal of Osteopathic Medicine, 1999/03
Free full text
1864

A model for teaching and assessing high velocity low amplitude thrust techniques
Wells, K.
The AAO Journal, 1999/03
Free full text
1865

Time to tell the world about osteopathic medicine
Oliveri, E. A., Osborn, G. C.
Journal of Osteopathic Medicine, 1999/02
Free full text
1866

An international study of osteopathic practice
Cameron, M.
Unpublished MSc thesis, 1999/01
Free full text
1867

Comparison of the scope of allopathic and osteopathic medical school health promotion programs for students
Hooper, J., Cox, C. C., Cambre, K., Wilburn, D., Webster, M., Wolf, T.
American Journal of Health Promotion, 1999/01
1868

Student Movement of the Medicine/Public Health Initiative promotes nationwide preventive healthcare approach
Cardarelli, R., Pierce, T.
Journal of Osteopathic Medicine, 1998/12
Free full text
1869

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text
1870

Osteopathic medical education in 1998 prepares for the future
Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text
1871

Dual approval of a residency program: ten years' experience and implications for postdoctoral training
Hayes, O. W.
Journal of Osteopathic Medicine, 1998/11
Free full text
1872

Comparison of personality styles between students enrolled in osteopathic medical, pharmacy, physical therapy, physician assistant, and occupational therapy programs
Hardigan, P. C., Cohen, S. R.
Journal of Osteopathic Medicine, 1998/11
Free full text
1873

Evaluierung und kritische Bewertung von Studien der Osteopathie im klinischen Bereich und im Bereich der Grundlagenforschung in der europäischen Literatur
(Evaluation and Critical Review of Clinical and Fundamental Research Studies on Osteopathy Published in the European Literature)
Schwerla, B., Hass-Degg, F., Schwerla, F.
Unpublished D.O. thesis, 1998/10
1874

Osteopathic medical school applicants not allopathic medical school 'rejects'
Kasovac, M.
Journal of Osteopathic Medicine, 1998/10
Free full text
1875

Correction to 'professional identity' article
Tettambel, M. A.
Journal of Osteopathic Medicine, 1998/09
Free full text
1876

Key to our survival lies in honesty
Olson, C. D.
Journal of Osteopathic Medicine, 1998/09
Free full text
1877

L'ostéopathie et la chiropraxie.
(Osteopathy and chiropractic)
Klein, P.
Revue médicale de Bruxelles, 1998/09
1878

An 'apples-to-apples' comparison of training hours for DOs, PAs, NPs
Truthan, C. E.
Journal of Osteopathic Medicine, 1998/08
Free full text
1879

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text
1880

Study of attitudes and beliefs about obesity on second and third year osteopathic medical students
Bradley, C. A.
Unpublished MSc thesis, 1998/08
Free full text
1881

Environmental factors promoting the effective use of a computer-assisted clinical case for second-year osteopathic medical students
Baer, R. W., Chamberlain, N. R.
Journal of Osteopathic Medicine, 1998/07
Free full text
1882

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05
1883

Partners for two decades: AOA and the National High Blood Pressure Education Program
Nickey, W. A., Lenfant, C.
Journal of Osteopathic Medicine, 1998/03
1884

Communication for osteopathic manipulative treatment (OMT): the language of lived experience in OMT pedagogy
Gaines, E., Chila, A. G.
Journal of Osteopathic Medicine, 1998/03
1885

The medical school curriculum for the 21st century
Wood, D. L., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/02
1886

Re-examining the number of osteopathic residency programs
Baker, H. H.
Journal of Osteopathic Medicine, 1998/02
1887

Osteopathic versus allopathic care
Wakham, M.
Hospital Practice, 1998/01
1888

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01
1889

Leading the pace of change: crisis or opportunity?
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/12
Free full text
1890

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text
1891

Anatomy of an OPTI dissected: structure, function, and the impact of budget reconciliation legislation
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/11
Free full text
1892

A snapshot of osteopathic medical education in 1997
Retz, K. C.
Journal of Osteopathic Medicine, 1997/11
Free full text
1893

Forecast for osteopathic medical education programs in the for-profit hospital environs
Spink, G. C.
Journal of Osteopathic Medicine, 1997/11
Free full text
1894

Anatomy of an OPTI: Part I. Form, function, and relationships
Meyer, C. T., Mann, M. P., Riley, C., Portanova, R.
Journal of Osteopathic Medicine, 1997/10
Free full text
1895

Osteopathic manipulative treatment: Practice use and and opinions of the Texas College of Osteopathic Medicine alumni
Gamber, R. G., Kennedy, D. A., Erickson, R. C., Moss, J. A., McKay Hart, C., Zengerle, C., Stone, R. C., Gish, E. E.
The AAO Journal, 1997/09
Free full text
1896

Pondering the effects of the Reconciliation Budget law on osteopathic medical education
Wood, D. L.
Journal of Osteopathic Medicine, 1997/09
Free full text
1897

An osteopathic prescription for medical education reform: Part 2. Specialty mix and community integration
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/08
Free full text
1898

An osteopathic prescription for medical education reform: Part 1. Curriculum and infrastructure
Ross-Lee, B., Wood, D. L., Mann, D. D., Portanova, R. P., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/07
Free full text
1899

Comparison of performance on the American Osteopathic Board of Internal Medicine certifying examination 1986 to 1996 by type of residency
Slick, G. L.
Journal of Osteopathic Medicine, 1997/07
Free full text
1900

Osteopathic manifesto. VI. The light of the profession. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/06
Free full text
1901

Comparing medical knowledge of osteopathic medical trainees in DO and MD programs: a random effect meta-analysis
Shen, L., Cavalieri, T., Clearfield, M., Smoley, J.
Journal of Osteopathic Medicine, 1997/06
Free full text
1902

Osteopathic Medical Profession: Who are we & Where are we going? A student perspective
Nemon, B. M.
The AAO Journal, 1997/03
Free full text
1903

Comparison of entrance requirements for health care professions
Doxey, T. T., Phillips, R. B.
Journal of Manipulative and Physiological Therapeutics, 1997/02
1904

Osteopathic manipulative treatment: student attitudes before and after intensive clinical exposure
Magnus, W. W., Gamber, R. G.
Journal of Osteopathic Medicine, 1997/02
Free full text
1905

AOA continuing medical education
MacPherson, S. B., Rodgers, D. J.
The Journal of the American Osteopathic Association, 1996/11
Free full text
1906

Osteopathic graduate medical education
Bronersky, V. M., Falbo, P. W.
The Journal of the American Osteopathic Association, 1996/11
Free full text
1907

Geriatric education in osteopathic medical schools
Carlsen, W., Pfeiffer, B., Marx, T., Bonyo, B.
The Journal of the American Osteopathic Association, 1996/11
Free full text
1908

Osteopathic medical education at the bridge to the 21st century
Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
1909

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
1910

In pursuit of generalism: basic factors influencing the specialty decisions of osteopathic medical school seniors in 1995
Singer, A. M.
The Journal of the American Osteopathic Association, 1996/11
Free full text
1911

Research programs of the AOA and their role in osteopathic medical education
Retz, K. C., McGill, S. L.
The Journal of the American Osteopathic Association, 1996/11
Free full text
1912

Income and expenditures of osteopathic medical colleges
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
1913

Undergraduate osteopathic medical education
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
1914

Osteopathic medical education: the introduction of managed care principles into our undergraduate curriculum
Musser, A. E., Vinn, N.
The Journal of the American Osteopathic Association, 1996/10
Free full text
1915

Standardization of the hospital record for osteopathic structural examination: Part 2. Effects of an educational intervention on documentation of palpatory and structural findings and diagnosis
Friedman, H. D., Johnston, W. L., Kelso, A. F., Schwartz, F. N., Beal, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 1996/09
Free full text
1916

Results of the 1996 National Resident Matching Program: family practice
Kahn, N. B., Jr., Garner, J. G., Schmittling, G. T., Ostergaard, D. J., Graham
Family Medicine, 1996/09
1917

Transforming osteopathic medical education
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/08
Free full text
1918

Ambulatory care training standards for continuity of care in osteopathic family medicine
Winters, F. D., Zonia, S., Cook, J. N., Dora, D. L., Meyer, C. T.
The Journal of the American Osteopathic Association, 1996/04
Free full text
1919

Curriculum goals for the training of osteopathic family practice residents for the year 2000
Dickerman, J., Rich, P.
The Journal of the American Osteopathic Association, 1996/03
Free full text
1920

Marketing key to increased women applicants to COMs
Payson, S. M.
The Journal of the American Osteopathic Association, 1996/01
Free full text
1921

Osteopathic GME consortia
Meyer, C. T., Mann, M. P.
Academic Medicine, 1995/11
1922

Osteopathic postdoctoral training institution: the osteopathic 'road map' to graduate medical education viability
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/11
Free full text
1923

Synergism strengthens osteopathic medical education programs
Allen, T. W.
Journal of Osteopathic Medicine, 1995/10
Free full text
1924

Female enrollment in colleges of osteopathic medicine: five years and five percentage points behind
Baker, H. H.
The Journal of the American Osteopathic Association, 1995/10
Free full text
1925

OMM Residency Training and Certification
Ettlinger, H., Pelkey, Z.
The AAO Journal, 1995/09
Free full text
1926

Osteopathic graduate medical education programs must be maintained
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/09
Free full text
1927

10,000 apply to osteopathic schools
Japsen, B.
Modern Healthcare, 1995/06
1928

Osteopathic graduate medical education: don't give up the ship--yet!
Meyer, C. T.
Journal of Osteopathic Medicine, 1995/06
Free full text
1929

A standardized form for DSM-IV review of symptoms and mental status examination for students and residents
Reeves, R. R., Bullen, J. A.
The Journal of the American Osteopathic Association, 1995/06
Free full text
1930

Performance of osteopathic medical school graduates on the American Osteopathic Board of Internal Medicine certifying examinations 1985 to 1994
Slick, G. L., Dolan, S., Draba, R. E.
The Journal of the American Osteopathic Association, 1995/06
Free full text
1931

The Experimental Method of Learning
Young, M. D.
The AAO Journal, 1995/06
1932

Making sense of federal GME reforms: the need for secondary reforms
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/05
Free full text
1933

Making sense of federal GME reforms: the impact on osteopathic medicine
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/04
Free full text
1934

Time to abolish most osteopathic graduate medical education programs
Kienitz, R.
The Journal of the American Osteopathic Association, 1995/03
Free full text
1935

A model for improving generalist physician output: the osteopathic experience
Cummings, M., Ennis, M.
Academic Medicine, 1995/01
Free full text
1936

Performances of candidates with osteopathic compared with allopathic subspecialty training on the American Osteopathic Board of Internal Medicine subspecialty certifying examinations 1984 to 1992
Slick, G. L., Dolan, S.
The Journal of the American Osteopathic Association, 1994/12
Free full text
1937

DOs who train in allopathic residency programs not 'disloyal'
Wogec, J.
The Journal of the American Osteopathic Association, 1994/12
Free full text
1938

A perspective from osteopathic medical schools
Arnstein, S. R., Haspel, L. U.
The Milbank Quarterly, 1994/12
Free full text
1939

Healthcare reform and practice choices: a survey of osteopathic medical students
Shubrook, J. H., Jr., Solomon, J. A., Ross-Lee
The Journal of the American Osteopathic Association, 1994/11
Free full text
1940

Osteopathic medical education adapts to a changing environment
Ward, W. D.
The Journal of the American Osteopathic Association, 1994/11
Free full text
1941

The danger of complacency
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/11
Free full text
1942

Colleges of Osteopathic Medicine
The Journal of the American Osteopathic Association, 1994/11
Free full text
1943

Membership of AOA Committees on Osteopathic Medical Education 1994-1995
The Journal of the American Osteopathic Association, 1994/11
Free full text
1944

Overview of financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1994/11
Free full text
1945

Gender effects on student performances on the NBOME Part I, Part II, and Part III
Shen, L.
Academic Medicine, 1994/10
Free full text
1946

Entry of US medical school graduates into family practice residences: 1993-1994 and 3-year summary
Kahn, N. B., Jr., Schmittling, G., Graham
Family Medicine, 1994/09
1947

Results of the 1994 National Resident Matching Program: family practice
Kahn, N. B., Jr., Schmittling, G., Ostergaard, D. J., Graham
Family Medicine, 1994/09
1948

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text
1949

Effect of clerkship training at rural sites on students' clinical skills
Brandau, D., Heun, L.
Academic Medicine, 1994/08
Free full text
1950

The in-training examination in internal medicine
Garibaldi, R. A., Trontell, M. C., Waxman, H., Holbrook, J. H., Kanya, D. T., Khoshbin, S., Thompson, J., Casey, M., Subhiyah, R. G., Davidoff, F.
Annals of Internal Medicine, 1994/07
1951

Managed care and graduate medical education: mutual objectives, barriers, and prospects
Natkow, N., Fry, L. J.
The Journal of the American Osteopathic Association, 1994/07
Free full text
1952

Specialty-oriented internships
Opipari, M. I.
The Journal of the American Osteopathic Association, 1994/06
Free full text
1953

Performance-based assessment of moral reasoning and ethical judgment among medical students
Smith, S. R., Balint, J. A., Krause, K. C., Moore-West, M., Viles, P. H.
Academic Medicine, 1994/05
Free full text
1954

More suggested changes to osteopathic medical curriculum
Clark, R. C.
The Journal of the American Osteopathic Association, 1994/05
Free full text
1955

'Parallel and distinctive': the philosophic pathway for reform in osteopathic medical education
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/04
Free full text
1956

Dark period in history of osteopathic medicine revisited
Frymann, V. M.
The Journal of the American Osteopathic Association, 1994/04
Free full text
1957

Preparing the osteopathic academic health centers for healthcare reform
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/04
Free full text
1958

Performance of candidates on the American Osteopathic Board of Internal Medicine subspecialty certifying examinations 1984-1992
Slick, G. L.
The Journal of the American Osteopathic Association, 1994/03
Free full text
1959

Revamp primary care programs to include psychiatry training
Magen, J. G.
The Journal of the American Osteopathic Association, 1994/03
Free full text
1960

Clarifying number of DOs in allopathic residency programs
Sprafka, S.
The Journal of the American Osteopathic Association, 1994/01
Free full text
1961

A strategy for the future success of osteopathic medicine
Wax, C. M.
The Journal of the American Osteopathic Association, 1994/01
Free full text
1962

The primary medicine initiative--continuity in medical education
Wood, D. L.
The Journal of the American Osteopathic Association, 1994/01
Free full text
1963

Debate continues on the call to reform the profession
Terry, R. R., Comeaux, Z., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text
1964

Crafting effective internal memos
Baker, H. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text
1965

Response: Debate continues on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/12
Free full text
1966

Focused goals of osteopathic medical education achieve results
Ward, W. D.
The Journal of the American Osteopathic Association, 1993/11
Free full text
1967

No 'paradigm shift' needed at COMs
Richwine, W. B., Papa, F. J.
The Journal of the American Osteopathic Association, 1993/11
Free full text
1968

Important characteristics of a director of medical education
Powell, V. D., Jr., George
The Journal of the American Osteopathic Association, 1993/11
Free full text
1969

Financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1993/11
Free full text
1970

An MD's note to his osteopathic medical students
Friedlander, E. R.
The Journal of the American Osteopathic Association, 1993/10
Free full text
1971

Do medical students' knowledge and attitudes about health and exercise affect their physical fitness?
Liang, M. T., Dombrowski, H. T., Allen, T. W., Chang, C. O., Andriulli, J., Bastianelli, M., Davina, E., Norris, S. D.
The Journal of the American Osteopathic Association, 1993/10
Free full text
1972

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text
1973

Lifestyle changes associated with osteopathic medical education
Crapse, F. J., Jr., Hudgins, P. M., Baker
The Journal of the American Osteopathic Association, 1993/10
Free full text
1974

Promoting the health and fitness of osteopathic medical students
Licciardone, J. C.
The Journal of the American Osteopathic Association, 1993/10
Free full text
1975

More comments on the call to reform the profession
McPartland, J. M., Pulsipher, D. W., Cope, M. K., Wagenknecht, D. A.
The Journal of the American Osteopathic Association, 1993/10
Free full text
1976

Response: More comments on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/10
Free full text
1977

Primary care DOs, specialists--and OMM--important to profession
Wax, C. M.
The Journal of the American Osteopathic Association, 1993/09
Free full text
1978

Entry of US medical school graduates into family practice residencies: 1992-1993 and three-year summary
Kahn, N. B., Jr., Graham, R., Schmittling
Family Medicine, 1993/09
1979

Teaching residents to write a research paper
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1993/09
Free full text
1980

The HIV-infected house officer: residency training issues
Fernandez, E. S., Troutman, H. T., Herbert, B., Condoluci, D. V.
The Journal of the American Osteopathic Association, 1993/08
Free full text
1981

Readers offer suggestions for reforms in osteopathic medicine
Rosenblum, J.
The Journal of the American Osteopathic Association, 1993/08
Free full text
1982

Predictors of Academic Difficulties of Osteopathic Medical Students in the Preclinical Curriculum
Cigelman, M. S.
Unpublished Dissertation, 1993/08
Free full text
1983

Another view of the “crisis“ in osteopathic medicine
Baker, H. H.
Academic Medicine, 1993/07
Free full text
1984

Helping-not hurting--residents with substance use disorders
Sells, K. W., Gorby, W. G.
The Journal of the American Osteopathic Association, 1993/06
Free full text
1985

'Blueprint' for creating classroom facilities in teaching hospitals
Hayes, O. W.
The Journal of the American Osteopathic Association, 1993/06
Free full text
1986

Research secures the future of osteopathic medicine: Part 2: Readdressing the function and structure of colleges of osteopathic medicine
Papa, F. J.
The Journal of the American Osteopathic Association, 1993/06
Free full text
1987

Research secures the future of osteopathic medicine: Part 1. Research--foundation for faculty development, institutional recognition
Papa, F. J.
The Journal of the American Osteopathic Association, 1993/05
Free full text
1988

Research important to education--and society
Retz, K. C.
The Journal of the American Osteopathic Association, 1993/05
Free full text
1989

Arranging affiliation agreements and outside rotations
Willard, R. L.
The Journal of the American Osteopathic Association, 1993/04
Free full text
1990

Osteopathic medicine: a call for reform
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/04
Free full text
1991

A growth industry. Graduate programs in health care are expanding rapidly
U.S. News & World Report, 1993/03
1992

Outcomes assessment: 'buzz words' in medical education whose time has come
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/03
Free full text
1993

Assessing outcomes of the educational program of the West Virginia School of Osteopathic Medicine
Cope, M. K., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text
1994

Procedures to follow when dismissing an intern or resident
Opipari, M., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text
1995

An approach to training and retaining primary care physicians in rural Appalachia
Roberts, A., Foster, R., Dennis, M., Davis, L., Wells, J., Bodemuller, M. F., Bailey, C. A.
Academic Medicine, 1993/02
Free full text
1996

Managing substance use disorders in resident physicians
Benzer, D. G.
The Journal of the American Osteopathic Association, 1993/02
Free full text
1997

Clinical teaching in the ambulatory care setting: how to capture the teachable moment
Bowling, J. R.
The Journal of the American Osteopathic Association, 1993/02
Free full text
1998

Integrate osteopathic principles and practices in postgraduate medical education--now
Kasovac, M., Jones, J. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text
1999

With a look at the past, osteopathic medical education heads into its second century
Ward, D.
The Journal of the American Osteopathic Association, 1992/11
Free full text
2000

Four approaches to using patients to teach and evaluate clinical skills of residents, interns, and students
Medio, F. J., Morewitz, S. J.
The Journal of the American Osteopathic Association, 1992/11
Free full text
2001

Voices From the Future: what students, interns, and residents want from osteopathic graduate medical training
Kushner, D., Cooney, J.
The Journal of the American Osteopathic Association, 1992/10
Free full text
2002

Heed 'Voices From the Future' and reform GME training
Meyer, C. T.
The Journal of the American Osteopathic Association, 1992/10
Free full text
2003

Teaching the process of obtaining informed consent to medical students
Johnson, S. M., Kurtz, M. E., Tomlinson, T., Fleck, L.
Academic Medicine, 1992/09
2004

Challenge to osteopathic education. Returning to its primary care roots
Cummings, M.
JAMA: The Journal of the American Medical Association, 1992/09
2005

Graduate medical education
JAMA: The Journal of the American Medical Association, 1992/09
2006

Reorganizing 'traditional' case presentation enhances learning, clinical experience
Russell, B., Penney, C. W.
The Journal of the American Osteopathic Association, 1992/08
Free full text
2007

Suggestions for clinicians providing--and residents seeking--feedback
Sprafka, S.
The Journal of the American Osteopathic Association, 1992/08
Free full text
2008

Is Osteopathic Education Ready For Its Next Century?
Corbett, S. R.
The AAO Journal, 1992/06
Free full text
2009

College of Podiatric Medicine and Surgery in Des Moines
Tomczak, R. L.
Journal of the American Podiatric Medical Association, 1992/06
Free full text
2010

Guidelines for designing resident rating forms
Gugelchuk, G. M., Daum, S. G.
The Journal of the American Osteopathic Association, 1992/06
Free full text
2011

Recruiting interns and residents to an osteopathic medical training program
Slick, G. L.
The Journal of the American Osteopathic Association, 1992/05
Free full text
2012

Training osteopathic medical students in behavioral medicine and psychiatry
Magen, J.
The Journal of the American Osteopathic Association, 1992/05
Free full text
2013

The medical education system in Oklahoma
Lapolla, M., Duffy, D., Lewis, C. S.
The Journal of the Oklahoma State Medical Association, 1992/03
2014

Case presentation as a teaching tool: making a good thing better
Brose, J. A.
The Journal of the American Osteopathic Association, 1992/03
Free full text
2015

The physical fitness of first-year osteopathic medical students
Licciardone, J. C., Hagan, R. D.
The Journal of the American Osteopathic Association, 1992/03
Free full text
2016

'Blueprint' for designing a curriculum for intern and residency programs
Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 1992/02
Free full text
2017

A curriculum database with boolean natural-language searching in HyperCard
Mann, D., Goodrum, K., DeWine, J. M., McVicker, J.
Proceedings Annual Symposium on Computer Application in Medical Care, 1992/01
Free full text
2018

Superlatives and concerns in osteopathic medical education
Baker, H. H.
The Journal of the American Osteopathic Association, 1991/11
Free full text
2019

Incorporating OMT in hospital training
Cooper, G. J.
The Journal of the American Osteopathic Association, 1991/11
Free full text
2020

The Effects of Problem-based Learning on National Board Scores, Clinical Evaluations and Residency Selection of Medical Students
Tomczak, R. L.
Unpublished Dissertation, 1991/11
Free full text
2021

US osteopathic medical school finances
Reich, M. M.
The Journal of the American Osteopathic Association, 1991/11
Free full text
2022

Who Will Hatch Our Students?
Morey, L.
The AAO Journal, 1991/09
Free full text
2023

Osteopathic vs. chiropractic education: a student perspective
McNamee, K. P., Magarian, K., Phillips, R. B., Greenman, P. E.
Journal of Manipulative and Physiological Therapeutics, 1991/09
2024

A proposal to modify research and scholarly activities during osteopathic residency training
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1991/09
Free full text
2025

Osteopathic interns' attitudes toward their education and training
Shlapentokh, V., O'Donnell, N., Grey, M. B.
The Journal of the American Osteopathic Association, 1991/08
Free full text
2026

Bias in medical education? Take my word for it!
Schulte, J.
Medical Economics, 1991/08
2027

Selected characteristics of graduate medical education in the United States
Rowley, B. D., Baldwin, D. C., Jr., McGuire
JAMA: The Journal of the American Medical Association, 1991/08
2028

Osteopathic medical educators should heed lesson from interns
Johnston, W. L.
The Journal of the American Osteopathic Association, 1991/08
Free full text
2029

Osteopathic principles and practices: maintaining a vital link in osteopathic education
Kappler, R. E.
The Journal of the American Osteopathic Association, 1991/07
Free full text
2030

Who should teach osteopathic manipulative medicine?
Lo, K. S.
The Journal of the American Osteopathic Association, 1991/03
Free full text
2031

Evaluation of videodisc modules: a mixed method approach
Parkhurst, P. E., Lovell, K. L., Sprafka, S. A., Hodgins, M.
Proceedings Annual Symposium on Computer Application in Medical Care, 1991/02
Free full text
2032

The theory of reasoned action as applied to the intention to enroll in an osteopathic medical school
Burnett, P. A.
Unpublished PhD thesis, 1991/01
2033

Too little and too late for GME programs
AOHA Today, 1990/12
2034

The Historical Development of the Texas College of Osteopathic Medicine as a State Medical School, 1960-1975
Rafes, R. S.
Unpublished PhD thesis, 1990/12
Free full text
2035

Osteopathic postdoctoral education
Baker, H. H., Wachtler, J.
The Journal of the American Osteopathic Association, 1990/11
Free full text
2036

Research programs of the AOA and their role in osteopathic education
Retz, K. C.
The Journal of the American Osteopathic Association, 1990/11
Free full text
2037

Practicing what we teach: integrating osteopathic principles into practice
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/10
Free full text
2038

Politics cloud state of osteopathic medical residency programs
Donovan, P. J.
The Journal of the American Osteopathic Association, 1990/10
Free full text
2039

Allopathic residencies: current and former residents' viewpoints
Baron, M., Karp, S. J., Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/09
Free full text
2040

Commenting on L-tryptophan and osteopathic physicians in allopathic residencies
Davis, F. E.
The Journal of the American Osteopathic Association, 1990/09
Free full text
2041

Performances of U.S. osteopathic and Canadian medical school graduates on the American Board of Internal Medicine Certifying Examinations, 1984-1988
Shea, J. A., Norcini, J. J., Benson, J. A.
Academic Medicine, 1990/08
2042

Development of an Expert System to Teach Diagnostic Skills
Elieson, S. W.
Unpublished PhD thesis, 1990/08
Free full text
2043

Louisa Burns memorial lecture: research in residencies
Belsky, D. H.
The Journal of the American Osteopathic Association, 1990/07
Free full text
2044

How effectively are osteopathic medical students coping with a stressful life-style?
Kurtz, M. E., Paulsen, R. D., Ferguson, D.
The Journal of the American Osteopathic Association, 1990/07
Free full text
2045

Factors influencing osteopathic physicians' decisions to enroll in allopathic residency programs
Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/06
2046

Breastfeeding Opinions of Medical Students at the Oklahoma State University College of Osteopathic Medicine
Hoskins, J. A.
Unpublished MSc thesis, 1990/05
Free full text
2047

The Century Club: a model for staff-supported medical education
Meyer, C. T.
The Journal of the American Osteopathic Association, 1990/05
Free full text
2048

The pull toward the vacuum: osteopathic medical education in the 1980s
Cummings, M.
The Journal of the American Osteopathic Association, 1990/04
Free full text
2049

A second opinion on geriatric training programs
Toffol, G. J., Schultz, D. R., Root, K. E., Weintraub, J. R.
The Journal of the American Osteopathic Association, 1990/03
Free full text
2050

General practice residency training and the osteopathic profession: trends and issues for the 1990s
Aquilina, A. D.
The Journal of the American Osteopathic Association, 1990/02
Free full text
2051

Faculty Perception of Institutional Needs and Goals in an Osteopathic Medical Education Program
Fazio, L. S.
Unpublished PhD thesis, 1984/05
2052

Faculty Perceptions of Institutional Needs and Goals in an Osteopathic Medical Education Program
Fazio, L. S.
Unpublished PhD thesis, 1984/05
Free full text
2053

Towards a conceptual framework for the continuum of clinical competence development in an undergraduate osteopathic medical education program: An exploratory study
Weaver, S. A.
Unpublished PhD thesis, 1984/01
2054

The orientations of medical students to osteopathic medicine
Aho, W. R.
Unpublished PhD thesis, 1970/01
 
 
 






  • Impressum • Legal notice • Datenschutz •


ostlib.de/advanced



Supported by

OSTLIB recommends