Advanced search



 
 79.9% of the records
 
 20.1 % of the records
 
 57.8 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial swellingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxishair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodialysishemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrialstriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

2297 results (please see below)  Sort:    
1

Interexaminer reliability studies: spanning a gap in medical research--Louisa Burns Memorial Lecture
Johnston, W. L.
The Journal of the American Osteopathic Association, Aug




5

Editorial
Editorial
Newiger, C.
Osteopathische Medizin, 2026/03


7

Incorporation of virtual reality into medical physiology
Benmerzouga, I., Oviawe, E.
Advances in Physiology Education, 2026/03
Free full text

8

Different letters, same results: a comparison of milestones among US allopathic and osteopathic residents
Langhan, M. L., Ngo, T. L., Yamazaki, K., Nesiama, J.A. O., Pence, L., Hogan, S. O.
Journal of Osteopathic Medicine, 2026/02
Free full text

9

Evaluating Laparoscopic Simulation Training for Preclinical Osteopathic Medical Students
Muchard, R. D., Jacobsen, N. D., Sypula, T., Longley, S., Hurrinus, N., Barefield, N. S., Patel, P. G.
Cureus, 2026/02
Free full text

10

Impact of the Council of State Neurosurgical Societies (CSNS) Fellowship on the Development of Neurosurgical Careers: A Retrospective Study
Rawson, C., Tenhoeve, S., Oladipo, O., Carter, A., Bauer, S., Lucke-Wold, B., Benzil, D., Adogwa, O., Sharma, A., Karsy, M.
Cureus, 2026/02
Free full text

11

Challenging hierarchies and fostering collaboration: a critical discourse analysis of interprofessional education in healthcare training
Zorda, E. M., Sargent, M. A., Gose, C. E., Becker, M. T., Garber, S. S., DePrimo, A., Batteson, T.
Journal of Osteopathic Medicine, 2026/02
Free full text

12

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2026/01

13

Effects of the allopathic and osteopathic graduate medical education merger on U.S. specialty training: a review
Ibrahim, S., Abdelhady, M., Venckus, J., North, C., Bohler, F.
Medical Education Online, 2026/01
Free full text

14

Race, ethnicity, and gender discrepancies between allopathic and osteopathic otolaryngology trainees from 2015 to 2023
Minutello, K. M., Nicks, S. L., Gillette, B. T., Hasan, S., Shermetaro, C. B.
Journal of Osteopathic Medicine, 2026/01
Free full text

15

Osteopathic manipulative medicine among injured emergency department patients: a nationwide study
Harris, H., DiStefano, A., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2026/01
Free full text

16

Effect of COMLEX-USA Level 1 pass/fail score reporting on student stress, test preparation, and performance
Jin, R., Sandella, J. M., Gross, G. A., Dawley, M., Boulet, J., Mao, X., Wang, Y.
Journal of Osteopathic Medicine, 2026/01
Free full text

17

Allopathic resident prevalence in orthopedic residency programs formerly accredited by the American Osteopathic Association during single accreditation
Murray, J. B., Balazs, G. C., Speicher, M. R., Olsen, A. A.
Journal of Osteopathic Medicine, 2026/01
Free full text

18

Development, implementation, and evaluation of interprofessional events on climate change in health professions curricula
Ly, K., Cariddi, A., Cote, M., Hall, K.
Frontiers in Medicine, 2026/01
Free full text

19

Graduate Degree Holders in the U.S. Residency Match: Trends and Outcomes (2016-2024)
Barron, D. W., Yu, H., Pendse, R. S., Barzee, B. M., Rappaport, D. E.
Journal of Medical Education and Curricular Development, 2026/01
Free full text

20

Im Gespräch mit … Christian Schwartzkopf
(In dialog with Christian Schwartzkopf)
Mihajlovic, Z., Schwartzkopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01

21

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/12
Free full text

22

Palpation and its learning: A professionalization approach to acquiring a complex skill
Rosenzweig, F., Feruglio, R., Marin, T.
International Journal of Osteopathic Medicine, 2025/12

23

Analysis of hepatitis B immunity in vaccinated medical students
Gentile, N., Aghera, C., Smith, H., Mazzoleni, S., Redden, D., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2025/12
Free full text

24

Is Research Fun? A Survey of Osteopathic Medical Students
Amendolara, A., Homan, M., Thorpe, L., Payne, A., Stacey, S. K., Small, C.
Journal of Osteopathic Medicine, 2025/12


26

Analyzing Medical Student Knowledge Regarding Nutrition
Barros, M., Weir, S.B., Bennett, A.
Journal of Osteopathic Medicine, 2025/12

27


28

Physician and Resident Physician knowledge of childhood obesity management guidelines
Chaar, S., Chaaban, A., Bitar, R., Hill Guseman, E.
Journal of Osteopathic Medicine, 2025/12





33

Enhancing Transitional Support for First-Year Medical Students: An Osteopathic, Student-Centered Perspective
Hartman, T., Pookkattu, M., Dearden, S., Venkataraman, V.
Journal of Osteopathic Medicine, 2025/12


35

Bridging Communication Gaps: Exploring Medical Students’ Understanding and Experiences in Caring for Patients with Hearing Impairments and Language Barriers
Kim, A., Nolin, J. R., Bracy, H., Berko, H., Mazzorana, A., Leiber, K., Hernandez, E.
Journal of Osteopathic Medicine, 2025/12

36


37

Evaluating Student Mental Health Resource Utilization and Self-Perceived Mental Health
Muppala, M. S., Sanapala, C., Shields, E., Kemp, E., Goldsteen, R., Tano, S., Grewal, P.
Journal of Osteopathic Medicine, 2025/12

38

Bridging the Gap: A Tri-campus Survey on Student Confidence in Applying OMT in Neurological Conditions
Nallanukala, G. S., Noto-Bell, L., Nallanukala, V.
Journal of Osteopathic Medicine, 2025/12

39

Pushing into the Barrier: Investigating the Use of OMM Among 3rd and 4th Year Medical Students
Pirzadeh, N., Dona, C. G., Valencia, R., Anche, G., Liang, W. M., Chen, D., Para, R., Volokitin, M.
Journal of Osteopathic Medicine, 2025/12


41

Zink’s Fascial Patterns Among First- and Second-Year Medical Students
Rutt, G., Graham, M., Boesler, D.
Journal of Osteopathic Medicine, 2025/12

42

D.O. Podcast Increases Pre-Medical Student Knowledge and Attitudes Toward Osteopathic Medicine
Sullivan, V. E., D'Amelio, M. P., Storch, I. M., van Rooyen, D. R., Storch, N. C., Callaway, C. A., Pierce-Talsma, S. L., Hauler, J. J.
Journal of Osteopathic Medicine, 2025/12

43

Osteopathic Medical Education and Treatment: Changes in Perspective Through the Lens of Standardized Patients
Thompson, T. R., Craun, W. D., Strickland Creech, T., Parks, J. M., Nolin, J. R.
Journal of Osteopathic Medicine, 2025/12


45

Perceptions of Campus Climate and Inclusivity Among LGBTQIA+ Osteopathic Medical Students: A Cross-Sectional Study
Varin, P., Temucin, S., Reese, A., Florescu, N., Grace, C., Bettiker, R., Sonneville, K., Fiscus, V., Tanaka, L.A.
Journal of Osteopathic Medicine, 2025/12

46

Factors Affecting Medical Student Participation in Student Evaluations of Teaching: A Retrospective Study
Walker, R., Tucker, S., Smith, M. L.
Journal of Osteopathic Medicine, 2025/12

47

Geographical distribution and match trends of osteopathic residents in otolaryngology residency programs: a cross-sectional analysis
Reardon, L., Stucki, B., Akella, D., Carr, M. M.
Journal of Osteopathic Medicine, 2025/12
Free full text


49

NextGenDO: A Pre-medical Outreach Program to Promote Early Exposure to Osteopathic Medicine
Quezada, K. A., Gjunkshi, L., Persaud, N. A., Hasty, R.
Cureus, 2025/12
Free full text


51

Effect of positional asymmetry palpatory models on improvement and retention of accuracy during pelvic asymmetry assessments
Hajicek, J. M., Huhn, M. B., Thurgood, A., Isemann, E. N., Barnwell, C. B., Starks, Z., Ying-Fang Wang, M., Degenhardt, B. F.
Journal of Osteopathic Medicine, 2025/12
Free full text

52

Associations of comorbidities, opioid use, and intimate partner violence, with urinary tract infections in pregnancy: implications for prevention and screening
Donatucci, K., Pathak, S., McPherson, K., Price, J., Hartwell, M.
Journal of Osteopathic Medicine, 2025/12
Free full text

53

A Retrospective Comparative Analysis of MD and DO Applicants' Acceptance to Plastic Surgery Residency
Yacoub, S. G., Guyler, M., Zak, A., Marlar, R., Obeid, R., Leavitt, W. III., Bernard, S., Isakov, R., Rampazzo, A., Gharb, B. B.
Annals of Plastic Surgery, 2025/12

54

Prolotherapy in the Academy: A Mixed Methods Survey Study
Dubey, J., Jones, N. R., Evered, J. A., Grob, R., Andrie, J., Rabago, D.
Journal of Integrative and Complementary Medicine, 2025/12
Free full text


56

Complementary health approach engagement of people with migraines in a nationally representative sample
Bond, A. D., Agostini, K., Motyka, T. M., Cappola, J. D., DiCristo, J. D., Heims, A. D.
Postgraduate Medicine, 2025/12

57

De-stress pain management: Assessing pain management care amongst primary care providers
Browder, B. H., Reynolds, C., Agnello, R.
Postgraduate Medicine, 2025/12

58

Osteopathic Acceptance in General Surgery Residency: A Five-Year Review of Resident Outcomes
Baule, S. M., Nguyen, J., Mehdiyar, D., Panlilio, M. A., Flume, H., Hanna, A., Cordero, A., Shepherd, J., Johnson, R., Sees, J. P.
Cureus, 2025/12
Free full text

59

Evaluating Research Preparedness and Skill Gaps Among Osteopathic Medical Students Pursuing Surgical Specialties
Beerman, S. A., Stucki, B., Wong, R., Alexander, V. S., Vogel, A., Heard, M. A., Wallen, T. J.
Cureus, 2025/12
Free full text

60

Enhancing the Awareness of Osteopathic Learning Opportunities Through a Newsletter
Eilerman, A., Benton, A., Shneker, N., Abdo, M., Mar, D., Faherty, M., Reynolds, R.
The AAO Journal, 2025/12

61

The State of Osteopathic Physicians in Orthopaedic Training and Academic Practice
Cohn, R. M., Bitterman, A. D.
Journal of the American Academy of Orthopaedic Surgeons, 2025/12


63

Medical Student Perspectives on Abortion Education in US Osteopathic Medical School Curricula
Steffes, R., Thakur, P., Cox, S., Adams, C., Creamer, B. A., Dennis, J. F.
Perspectives on Sex and Reproductive Health, 2025/12


65

Geographical distribution of osteopathic urology residents and match trends in the United States
Wong, R., Eke, B., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/11
Free full text

66

Clerkship Rotations Are a Key Driver of Family Medicine Choice: Insights from the 2024 National Resident Survey
Barr, W., Peterson, L. E., Fleischer, S., Bazemore, A.
Journal of the American Board of Family Medicine, 2025/11
Free full text



69

A quantitative analysis comparing pre-clinical volunteering hours with third-year medical students' preceptor evaluations
Ranta, E. K., Ranta, J. C., Redden, D., Stoner, A. M.
Journal of Osteopathic Medicine, 2025/11
Free full text

70

Scholar 12 longitudinal outcomes: osteopathic research development application to facilitate scholarly activity during the pandemic and beyond
Rowane, M. J., Thomas, K. A., Smith, T. M., Terrel, M. A., Rowane, M. P., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2025/11
Free full text

71

Osteopathic Medicine Applicants in Urology: Evolving Pathways and Persistent Gaps After the Merger
Toumazos, K., Svendsen, C., Spencer, K. A., Cranford, W., McLouth, C., Buchanan, A. F.
Urology Practice, 2025/11



74

Assessing eating disorder education in U.S. medical schools: a qualitative content analysis of lecture slides
Laboe, A. A., Pictor, L. E., Gavuji, M., Temucin, S., Kreynin, A., Sheil, E., Jourdan, B., Schaumberg, K., Davis, H., Harrop, E. N.
Eating and Weight Disorders, 2025/11
Free full text

75

Assessing fundamental clinical skills of osteopathic medical students
Boulet, J. R., Sandella, J. M., Gimpel, J., LaBaere, R.
Journal of Osteopathic Medicine, 2025/10
Free full text

76

Affirmative Action Repeal and Racial and Ethnic Diversity in US Medical School Admissions
Florescu, N., Lin, A., Temucin, S., Rae, L.
JAMA Network Open, 2025/10
Free full text


78

From Simulation to Surgery: Gauging Surgical Interest in Osteopathic Medical Students Through Cadaveric Simulation: A Pilot Study
Paladichuk, S., Chase, T., Downs, A., Heck, C., Cortner, M., Cornwell, H., Shang, T., Brennan, Z., Walser, R. F., Kerber, K., Wallen, T.
Journal of Medical Education and Curricular Development, 2025/10
Free full text

79

European research Priorities for Osteopathic Care (PROCare): a sequential exploratory investigation and survey
Vaucher, P., Carnes, D., Hohenschurz-Schmidt, D., Thomson, O., Vogel, S., Arienti, C., Bright, P., Alvarez Bustins, G., Esteves, J., Koch Esteves, N., Fawkes, C., Rinne, S., Roura, S., Treffel, L., Wagner, A., Draper-Rodi, J.
BMJ Open, 2025/10
Free full text

80

Enhancing Embryology Education Through Virtual Reality: A Pilot Study
Quiñones-Rodríguez, J., Rice, R., Mayer, W., Marchelli, G., Bouchoukian, M., Davis, P.
Anatomical Record, 2025/10

81

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10

82

Incorporating the Certified Professional in Patient Safety credential into undergraduate medical curriculum: assessment and lessons learned
Gelinas, L., Hassan, A. K., Lieto, J., Yurvati, A. H.
Journal of Osteopathic Medicine, 2025/10
Free full text

83

Predicting COMLEX-USA Level 2-CE using medical school performance and use for student advising
Wang, S., Basehore, P.
Journal of Osteopathic Medicine, 2025/10
Free full text

84

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/10
Free full text


86

Preceptor-Ranked Competencies in Osteopathic Medical Students: A Comparison of General Surgery and Surgical Subspecialties
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Garg, R., Thacker, R. R., Roach, S. L.
Cureus, 2025/10
Free full text


88

Top 100 cited articles in osteopathic medical education: A bibliometric analysis
Bright, H. S. IV., Robinson, K., Fitterling, L., Kelley, S., Wang, M. Y.F., Lipke, L.
Medical Reference Services Quarterly, 2025/10

89

Virtual Escape Rooms in Anatomy Education: Case Studies from Two Institutions
Beger, A. W., Hannan, S., Patel, R., Sweeney, E. M.
Advances in Physiology Education, 2025/09
Free full text

90

Corrigendum to: The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T.H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/09
Free full text

91

A proven template for providing streamlined, scalable, cost-effective clinical research opportunities in osteopathic medical schools
Greek, J. N., Greek, A. P., Hopper, M., Arnce, R.
Journal of Osteopathic Medicine, 2025/09
Free full text

92

Technology use and satisfaction among colleges/schools of osteopathic medical education
Linsenmeyer, M., Ridpath, L.
Journal of Osteopathic Medicine, 2025/09
Free full text

93

Medical student perceptions of psychiatric conditions and the impact of stigmatizing language
Monahan, Z., Stevens, V., Hartwell, M., Ford, A. I.
Journal of Osteopathic Medicine, 2025/09
Free full text

94

Why is identification with osteopathy decreasing in medical students?
Kauffman, Z. S., Harper, T., Augustyniak, R. A., Ruff, C.
Journal of Osteopathic Medicine, 2025/09
Free full text

95

The epidemiology of osteopathic diagnoses and treatments in United States emergency departments from 2018 to 2021
Distefano, A., Harris, H., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2025/09
Free full text

96

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/09

97

Abstracts From the Third Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 13, 2025
Akenami, F. O., Ismail, R., Obando Solano, C. P., Amalfitano, A.
Spartan Medical Research Journal, 2025/09
Free full text



100

Dermatology match disparities: analyzing osteopathic vs. allopathic student outcomes post-ACGME/AOA single accreditation system (2020-2024)
Wan, L., Bawa, K., Park, A., Kadri, H., Cusick, A., Trotter, S. C.
Journal of Osteopathic Medicine, 2025/09

101

Osteopaths' attitudes, skills and use of evidence-based practice in Portugal
Nunes, A., Santo, J. E., Moita, J.
International Journal of Osteopathic Medicine, 2025/09

102

Osteopathy Educators’ and Researchers’ Perspectives on Artificial Intelligence in Academia: A Cross-Sectional Study
Mhadhbi, H., Draper-Rodi, J., Consorti, G., Antunes Ferreira, A. P., Horta, L. M., Rinne, S., Vaucher, P., Ménard, M.
International Journal of Osteopathic Medicine, 2025/09

103

Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/09

104

Understanding the Ranking and Matching Behaviors During the 2023 and 2024 General Surgery Match Cycles: A Program Signaling Approach
Pakdaman, S., LaFemina, J., Byrd, K. S., Dunleavy, D. M., Balestrieri, S. G., Jurich, D. P., Dowden, A. J., Lamb, D. L.
Journal of Surgical Education, 2025/09

105

A novel simulation enhanced education for osteopathic manipulation of hospitalized patients
Eilerman, A. P., Libonate, G., Pothen, S., Rudie, M., Zardoost, S., Donaldson, B., Gable, B.
Journal of Osteopathic Medicine, 2025/09
Free full text

106

Osteopathic Manipulative Treatment (OMT) Protocol on Sleep Quality in Medical Students as Measured by the Fitbit Smart Watch: A Pilot Study
Radigan, R., Finkelstein, A., Lee, B., George, E., Bhushan, P., Sousa, A., Yao, S. C.
The AAO Journal, 2025/09



109

The Need for Telehealth Education in the Medical School Curriculum
Carney, M., Thornton, M. E., Avancha, K., Nolin, J. R., Alexander, J.
Cureus, 2025/08
Free full text

110

Clinical Reasoning and Practices in the Osteopathic Management of Visceral Disorders: A Grounded Theory Study in the Italian Context
Camonico, T., Lippi, F., Rizzo, N., Barusso, A., Rossettini, G., Villafañe, J. H., Cerritelli, F., Papa, L., Esteves, J. E.
Healthcare, 2025/08
Free full text



113

Understanding COMLEX-USA Level-1 as a Pass/Fail examination: impact and opportunities
Gerhardson, A., Efurd, M., Sexton, P., Sefcik, D.
Journal of Osteopathic Medicine, 2025/08
Free full text

114

Effectiveness of Different Teaching Modalities in Human Gross Anatomy Education
Mooney, A., Thompson, N. E., Hoffmann, S.
Clinical Anatomy, 2025/07

115

Investigating the trustworthiness of randomized controlled trials in osteopathic research: a systematic review with meta-analysis
Sénéquier, A., Draper-Rodi, J., Alvarez Bustins, G., Braithwaite, F. A., Brown, J., Corcoran, D., Forrest, L., Godsi, E., MacMillan, A., Menard, M., Roura Carvajal, S., Scocca, C., Treffel, L., Vaucher, P., Wagner, A., Soliman, N., Abbey, H., Hohenschurz-Schmidt, D.
Journal of Clinical Epidemiology, 2025/07
Free full text

116

The impact of a summer research internship program on research engagement of osteopathic medical students
Bishayee, A., Wallace, M. A., Bobak, A. K., Sasher, T. L., Alvarez, L. A., Flink, T. S.
Journal of Osteopathic Medicine, 2025/07
Free full text

117

Exploring the Characteristics and Competencies of Successful Osteopathic Medical Students on General Surgery Clerkship
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Thacker, R. R., Roach, S. L.
Cureus, 2025/07
Free full text

118

A Pilot Study of Orthopedic Applicants Regarding Sub-internship Number, Cost, and Preferences
Schultz, M. J., Riebesell, S., Lutz, R. W., McCahon, J., Suarez, J. D., Purtill, J., Daniel, J.
Cureus, 2025/07
Free full text

119

Predicting First-Semester Performance of First-Year Medical Students in a Changing Landscape
Walker, M., George, A., Mohsin, S., Nichani, R., Garg, R., Chosie, K., Kennedy, C.
Cureus, 2025/07

120

Enabling Exploration: Examining the Availability and Adequacy of Conference Funding for Medical Students
Allison, S. G., Soltani, H., Chwa, E. S., Shuaibi, D. W., Allison, K. R., Gosain, A. K.
Plastic and Reconstructive Surgery-Global Open, 2025/07
Free full text

121

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text

122

The effectiveness of training student physicians in culturally sensitive patient care using an interprofessional culturally competent curriculum
Aminpour, A., Gelvin, M., Smurzynski, A., Gardner, F., Gardere, J.
Journal of Osteopathic Medicine, 2025/07
Free full text

123

Building Community With Community: Collaborative Reflections on the Rural and Urban Community Orienting Experience (RUCOE)
Casapulla, S., Kropf, K., Kalout, S., Lingerak, S.
Teaching and Learning in Medicine, 2025/07

124

A survey of sexual harassment and assault in osteopathic medical schools
Chiriboga, K., Zeller, M., LaPlante, M., Prasad, C.
BMC Medical Education, 2025/07
Free full text

125

Development of a national osteopathic Practice-Based Research Network (PBRN): the NCOR Research Network
Draper-Rodi, J., Fawkes, C., Bailey, D.
Scientific Reports, 2025/07
Free full text

126

A cross-sectional analysis of pathology exposure across COCA-accredited osteopathic medical schools: Gaps and opportunities in pathology undergraduate medical education
Preston, P., Herman, M., Berry, A., Robinson, M., Schukow, C. P., Kowalski, P.
Academic Pathology, 2025/07
Free full text

127

Pioneering the future: incorporating lifestyle medicine tools in osteopathic medical education
Bansal, S., Shubrook, J. H.
Journal of Osteopathic Medicine, 2025/07
Free full text

128

Development of Standardized Osteopathic Manipulative Treatment Tracking Forms Recording Pain and Functional Outcomes to Facilitate Osteopathic Research
Joseph, C., Mintle, L. S., Hoegerl, C., Asher, D., Adams, K., Fugler, P., McKinney, J.
International Journal of Osteopathic Medicine, 2025/06


130

A Novel Calibration Methodology for Osteopathic Manipulative Medicine Research: Improving Study Validity by Standardizing Intra-researcher Techniques
Hahn, D., Krakowski, M., Kadriovski, S., Pierides, M., Velasquez, L., Volokitin, M.
The AAO Journal, 2025/06

131

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06



134

Gender Sensitivity in Osteopathy: The Challenge of Diagnosing Pubic Symphysis Somatic Dysfunctions
Velasquez, L., Walker-Elders, A., Feygin, H., Hahn, D., Lee, D., Volokitin, M.
The AAO Journal, 2025/06




138

Integrative medicine
(Интегративная медицина)
Shabrov, A. V., Mokhov, D. E., Tregubova, E. S., Korotkov, K. G., Moiseev, V. I., Partsernyak, S. A.
Russian Osteopathic Journal, 2025/06

139

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/06

140

Trends in osteopathic medical education: a scoping review
Hoskins, K., Montgomery, M., Griffith, A., Pollard, H., Orr-Roderick, D., Schmick, D., Strausman, J., Wade, S., Robertson, M., DeArmond, M.
Journal of Osteopathic Medicine, 2025/06
Free full text




144

Recent and future trends in osteopathic orthopedic surgery residency match rates following the transition to a single accreditation system
Turnow, M., Nemani, M. G., Gupta, N., Hartman, H., Manes, T., Williamson, T., Gianakos, A.
Journal of Osteopathic Medicine, 2025/05
Free full text

145

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2025/05
Free full text

146

International medical graduate orthopaedic residents show higher research productivity than United States graduate peers before and during residency
MacLeod, J. S., Jacome, F., Mansour, H., Lee, M. S., Akwuole, F., Cho, S., Lee, J., Lema, O., Chopra, A., Bakaes, Y., Painter, S., Baker, H., Mejia, A.
International Orthopaedics, 2025/05

147

Efforts in Undergraduate Medical Education to Improve Socioeconomic Status Diversity
Velasquez, D. E., Shrestha, A., Matias, W. R.
Academic Medicine, 2025/05
Free full text

148

Residency Program Characteristics Associated With Osteopathic Resident Representation
Nikolla, D. A., Sachdeva, V., Distefano, A., Bryan, A., Mudrakola, V., Milliron, M. L., Bowers, K. M.
Cureus, 2025/04
Free full text

149

“Transition to Clinical Years“ Podcast Series: A Pilot Project to Support Rising Third-Year Students
Price, K. W., Bhagtani, H., Abraham-Hardee, S., Yeager, D., Anandakrishnan, R.
Cureus, 2025/04
Free full text

150

Does Malpractice Risk Deter Medical Students From Pursuing Obstetrics and Gynecology?
Thai, A., Huynh, K., Pickering, T., Maron, A., Wang, L., Stohl, H.
Cureus, 2025/04
Free full text

151

An Expert Consensus of Acceptable Scholarly Activities in Emergency Medicine Residency Training Programs
Garg, N., Totten, V. Y., Greenberg, M. R., Wilkerson, G., Finnell, J. T., Lau, W. B., Miner, J. R., d'Etienne, J. P., Brenner, J. D., Kumar, P., Camargo, C. A.
The Journal of Emergency Medicine, 2025/04

152

A cross-sectional study of newly established medical schools in the United States: student body diversity remains an unmet challenge
Oyoun Alsoud, L., West, K., Sorrell, S., Andolsek, K. M., Al Hageh, C., Ibrahim, H.
Medical Education Online, 2025/04
Free full text

153

Modeling the importance of physician training in practice location for Ohio otolaryngologists
Borgemenke, S., Newsom, D., Scheatzle, P., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/04
Free full text

154

Effectiveness of a program director for osteopathic medical education to support osteopathic recognition at a training site with multiple programs
Eilerman, A., Porter, C., Faherty, M., Zmuda, E.
Journal of Osteopathic Medicine, 2025/04
Free full text

155

An Investigation of Second-Year Medical Students' Use of Outside Resources at Two Institutions
Berry, A., Campbell, A., Li, D., Bay, C., Ikonne, U.
Medical Science Educator, 2025/04
Free full text

156

Lecture Capture, Transcripts, and Captioning in US Colleges of Osteopathic Medicine: Descriptive Cross-Sectional Survey
Khong, P., Holmes, D., Masoudian, B., Lund, G. C., Garwood, S.
Medical Science Educator, 2025/04
Free full text

157

A comprehensive review of clinical experiences and extracurricular activities for US premedical students applying to osteopathic medical schools
Kadavakollu, S., Dang, T., Bains, J., Ham-Ying, J., Boyanovsky, B., Qureshi, M., Graneto, J., Richards, S.
Journal of Osteopathic Medicine, 2025/04
Free full text


159

The assessment of point-of-care ultrasound (POCUS) in residency: the benefits of a four-year longitudinally integrated curriculum
Le, D. Q., Scarpulla, M., Lam, H., Kern, J., Vroegop, S., Yaeger, J., Finch, C., Martini, W., Bolch, C. A., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2025/03
Free full text

160

Prevalence of pelvic examinations on anesthetized patients without informed consent
Cutting, R., Reddy, V., Polam, S., Neiman, N., Manna, D.
Journal of Osteopathic Medicine, 2025/03
Free full text

161

Indigenous Epistemological Frameworks and Evidence-Informed Approaches to Consciousness and Body Representations in Osteopathic Care: A Call for Academic Engagement
Zegarra-Parodi, R., Loum, T., D&rsquo, Alessandro, G., Baroni, F., Zweedijk, R., Schillinger, S., Conte, J., Mehl-Madrona, L., Lunghi, C.
Healthcare, 2025/03

162

Impact of osteopathic manipulative medicine training during graduate medical education and its integration into clinical practice
Kramer, J. L., Trombetti, K., De Asis, K., Mai, V., Swing, E.
Journal of Osteopathic Medicine, 2025/03
Free full text

163

The Seven Drivers of Change in Osteopathic Education
Engel, R.
International Journal of Osteopathic Medicine, 2025/03

164

Changes in Matches into Surgical Residencies and Fellowships Following the ACGME Merger
Soliman, S. S., Andrews, G., Emara, S., Watkins-Granville, N., Podwójniak, A., Hasan, I., Stuti, J., Brotman, A.
Journal of Surgical Education, 2025/03
Free full text



167

Increase in the Number of Medical Schools in the United States and Its Potential Adverse Ramifications for Urology Residency Applicants
Donato, U. M., Ebedes, D. M., Nelwan, D., Imam, A., Patel, T.
Cureus, 2025/03
Free full text



170

Addressing confounding factors in the match disparities between DO and MD seniors
Bohler, F.
Journal of Osteopathic Medicine, 2025/03
Free full text


172

Assigning Commercial Off-The-Shelf (COTS)-Based Board-Style Pharmacology Practice Questions to Medical Students
Ghayur, M. N., Ghayur, A.
The Journal of Pharmacology and Experimental Therapeutics, 2025/03

173

503 A Closer Look at Pathology Education in Osteopathic Medical Schools: Data from 2021 to 2024
Preston, P., Herman, M., Berry, A., Robinson, M., Kowalski, P.
Laboratory Investigation, 2025/03

174



176

Determining the effects of social media engagement on surgery residents within the American College of Osteopathic Surgeons
Alexander, V. S., Eke, B., Xu, A., Wong, R., Greek, A., Ernst, M., Roberts, H., Ariwodo, O., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/02
Free full text

177

“The Dark Side of Musculoskeletal Care”: Why Do Ineffective Techniques Seem to Work? A Comprehensive Review of Complementary and Alternative Therapies
Mamud-Meroni, L., Tarcaya, G. E., Carrasco-Uribarren, A., Rossettini, G., Flores-Cortes, M., Ceballos-Laita, L.
Biomedicines, 2025/02
Free full text


179

“There is a way to work together“: A qualitative study on complementary medicine therapists' perceptions of their role in the Swiss healthcare system
Dubois, J., Rodondi, P.Y., Akre, C.
Complementary Therapies in Clinical Practice, 2025/02
Free full text

180

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text

181

Generative Artificial Intelligence in Medical Education—Policies and Training at US Osteopathic Medical Schools: Descriptive Cross-Sectional Survey
Ichikawa, T., Olsen, E., Vinod, A., Glenn, N., Hanna, K., Lund, G. C., Pierce-Talsma, S.
JMIR Medical Education, 2025/02
Free full text

182

Pursuing Osteopathic Recognition: A National Survey on US Program Director Perspectives
Dong, T., Shapiro, M., Soh, M., Merkebu, J., Cervero, R., McClain, R., Durning, S. J.
Journal of Graduate Medical Education, 2025/02
Free full text

183

Development and Implementation of the “Exercise is Medicine“ Elective at an Osteopathic Medical School
Mitchell, C., DeMartino, S., Ivers, L., Brown, A., Maccabee, E., Griffith, B., Pankey, C. L.
Medical Science Educator, 2025/02
Free full text

184

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text

185

Foot and ankle fellowship-trained osteopathic orthopaedic surgeons: a review, analysis, and understanding of current trends
Henry, J. P., Partan, M. J., Chen, K. M., Cohn, R. M., Bitterman, A. D.
Journal of Osteopathic Medicine, 2025/01
Free full text

186

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text


188

Efficacy of an Abdominal Surgery Simulator in Didactic Medical Training: A Randomized Controlled Trial
Fincher, S. E., Koniuk, V. M., Benavidez, M. S., Benefield, M. C., Drew, D. L., Hasan, D. M., Minner, N., Prakash, T. C., Parks, M. J., Lindsey, T.
Cureus, 2025/01
Free full text


190

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01


192

Resident Perceptions of Migraine Management and Interventions to Improve Care
Malone, L. I., Kelley, K.
American Journal of Health-System Pharmacy, 2025/01

193

The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T. H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/01
Free full text

194

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text


196

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text

197

A call to include intersectionality on board examinations
Dozier, D. R., Rodríguez, J. E.
Journal of Osteopathic Medicine, 2024/12
Free full text

198

Methodological limitations of the sternal brace test study
Nikolla, D. A., Raich, C., Erickson, T. E.
Journal of Osteopathic Medicine, 2024/12
Free full text

199

Assessing osteoporosis screening compliance in total joint surgery: a retrospective chart review
Shepard, S., Bartholomew, A., Houserman, D., Bamberger, H. B., Manocchio, A. G.
Journal of Osteopathic Medicine, 2024/12
Free full text

200

Evidence-informed approach of sighs in the scope of osteopathic practice
Vicart, A., Wagner, A.
International Journal of Osteopathic Medicine, 2024/12

201

Making the Cut: A Six-Year “Bone-afide“ Membership Trend From Student to Surgeon
Nemani, M. G., Barham, E., Sees, J. P.
Cureus, 2024/12
Free full text

202

Evaluating perspectives, knowledge and behaviors of osteopathic medicine in a United States osteopathic medical school: A study in employee education and changes in understanding
Glaser, K., Roberts, J., Coleman, M. K., Payton, M., Wilke, S., Linton, M., Waller, J.
International Journal of Osteopathic Medicine, 2024/12

203

Evaluating the Information Quality of YouTube Videos on Manual Medicine/Therapy
Is, E. E., Tarihci Cakmak, E., Damla Korkmaz, M.
International Journal of Osteopathic Medicine, 2024/12

204

Student perception of Case Based Learning at a medical school in New York before and during the COVID-19 pandemic
Bhurtyal, K. K., Kung-Lau, S., Pino, M. A.
Journal of Osteopathic Medicine, 2024/12

205

Institutional Funding of Medical Students for Research Conferences: Is There a Benefit for the NRMP?
Dennis, J. F., Khan, H., Papatheofanis, C., Agollari, K., Marino, R., Schumann, T., Woolhiser, E.
Journal of Osteopathic Medicine, 2024/12

206

Effectiveness of Prematriculation Programs for Student Success in Medical School
Frontz, A., Sheridan, L., Davidson, K., Gundler, C.
Journal of Osteopathic Medicine, 2024/12

207

Outreach Education led by Osteopathic Medical Students on Substance Use Prevention for Sustainable Health Literacy in Underserved Youth Communities
Garg, E., Gogineni, K., Mahimkar, S., Jambunathan, V., Jamal, L., Nazaroff, C., Restini, C.
Journal of Osteopathic Medicine, 2024/12


209

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12


211

Building Disability Competency in Osteopathic Medical Students in Rural Ohio Pilot Study
Hughes, A., Barrett, J., Dillman, O.
Journal of Osteopathic Medicine, 2024/12


213

Trends and Outcomes in Residency Matches: Assessing the Post-Merger Landscape for DO and MD Graduates
Jerman, H., Yebernetsky, K. E., Wilson, S.M. T., Rosmarin, S., Divito, C. B.
Journal of Osteopathic Medicine, 2024/12



216


217

Osteopathic Medical Student Experiences with Assessing Red-Reflex in Different Skin Tones
Shah, P., Curran, S.
Journal of Osteopathic Medicine, 2024/12

218

Evaluation of the Use of 3D Printed Spinal Models to Educate and Assess Osteopathic Medical Students
Valdés, D., Zarandy, J., Sherrington, M., Cohen, M., Matechak, J.
Journal of Osteopathic Medicine, 2024/12


220

Third-year medical students' perceptions of confidence and readiness to perform EFAST after training
Rocic, P., Garrison, R., Stitle, K., Reynolds, A., Andrews-Dickert, R.
BMC Medical Education, 2024/12
Free full text



223

Concerns of osteopathic medical students during the COVID-19 pandemic
Hanna, O., Vinyard, C. J., Casapulla, S.
Journal of Osteopathic Medicine, 2024/11
Free full text

224

Unpacking ABSITE Performance: Evaluating International vs Domestic Medical Graduates and DO vs MD Trainees in a Joint Residency Program
Rahimpour, A., Baxter, J. D., Fox, D. W. N., Morrison, M., Denning, D. A., Ray, P. D., Barry, R.
Journal of the American College of Surgeons, 2024/11

225

Feasibility of a cinematic-virtual reality training program about opioid use disorder for osteopathic medical students: a single-arm pre–post study
Rehl, D., Mangapora, M., Love, M., Love, C., Shaw, K., McCarthy, J., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/11
Free full text


227

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text

228

Building an evidence base for osteopathy: Trials and tensions. A qualitative study of the experience of clinicians engaging in research
Grace, S., Engel, R., Vogel, S., Ahrens, G., Barclay, K., Guy, C., Lowe, C., McCormack, T., Paranthoiene, J., Carnes, D.
Complementary Therapies in Clinical Practice, 2024/11
Free full text

229

Students with prior anatomy experience start out stronger in medical school gross anatomy
Louro, M. D., Meegan, G., Rudin, L. R., Granatosky, M. C., Thompson, N. E.
Anatomical Sciences Education, 2024/10

230

Associations of clinical personnel characteristics and telemedicine practices
Phillips, G., Millhollon, R., Elenwo, C., Ford, A. I., Bray, N., Hartwell, M.
Journal of Osteopathic Medicine, 2024/10
Free full text

231

Response to “Fostering a research culture in osteopathic medical education”
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2024/10
Free full text

232

Fostering a research culture in osteopathic medical education
Kadavakollu, S., Dang, T., Richards, S.
Journal of Osteopathic Medicine, 2024/10
Free full text

233

Assessing nutrition literacy and nutrition counseling proficiency following an interdisciplinary culinary medicine elective
Kirby, A. N., DeBellis, J., Wolter, K., Mount, G., Wang, C.H., Bishop, J., Barkhouse, J., Wirth, K., Nguyen, N., Cacciatore, C., Kraus, K.
Journal of Osteopathic Medicine, 2024/10
Free full text

234

Improving learning experience through implementing standardized team-based learning process in undergraduate medical education
Andrews-Dickert, R., Nagaraj, R., Zhan, L., Knittig, L., Zhao, Y.
BMC Medical Education, 2024/10
Free full text


236

The Transformative Care Continuum: implementing an accelerated pathway that addresses the new roles of the family medicine physician
Chrisman-Khawam, L., Snyder, S., Tyler, C., Harley, D., Davidson, E., Anthes, L., Casapulla, S.
Medical Education Online, 2024/10
Free full text

237

Geographical Distribution and Trends Analysis of Osteopathic General Surgery Residents
Ernst, M. D., Alexander, V. S., Wong, R., Berg, N., Roberts, H., Vogel, A. D., Burns, J. B., Conrad-Schnetz, K.
Cureus, 2024/10
Free full text

238

The Effect of an Anatomy Prep Course on OMS-1 Student's Performance During the Fall Semester
Prasad, D. M., Inman, A. M., Blanc, P. K., Gaunt, J. A., Guzik, H. M., Peterson, J. L.
Clinical Anatomy, 2024/10


240

Evaluating the Impact of Direct, Direct Video, and Indirect Video Laryngoscopy Training on the Proficiency of Medical Students in Performing Direct Laryngoscopy: A High-Fidelity Manikin-Based Assessment
Moriarty, S. E., Perera, I. R., Sabbagh, M., Yeckley, M., Carpio, P., Hoodfar, A., LePera, A., Anandakrishnan, R., Daniels, T., Martin, R., Looney, J., Gittings, K., Edwards, W., Rawlins, F.
Cureus, 2024/10
Free full text

241

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10

242

Primary and secondary prevention of musculoskeletal pain and disability in chiropractic, osteopathy, and physiotherapy: A scoping review
Draper-Rodi, J., Delion, T., MacMillan, A., Storey, A. I., Spadaccini, J., Jebi, W., Thomson, O. P., Hohenschurz-Schmidt, D.
International Journal of Osteopathic Medicine, 2024/09
Free full text

243

Limb spasticity and telemedicine consultation for reconstructive surgery: patient perspectives of surgical assessment
Bardwell, A., Crowe, C. S., Rhee, P. C.
Journal of Osteopathic Medicine, 2024/09
Free full text

244

Prognosen für die Zukunft wagen
(Daring to predict the future)
Franke, H., Liem, T., Mayer, J., Wikus, P., Newiger, C.
Osteopathische Medizin, 2024/09

245

Perceived benefits and limitations of game-based simulation education by osteopathy students in early clinical training: A preliminary mixed methods study
Mhadhbi, H., Horta, L. M., Ims, J., Draper-Rodi, J., Mansfield, H., Shaw, R., Rinne, S., Cleland Silva, T., Metsälä, E., Ménard, M.
International Journal of Osteopathic Medicine, 2024/09


247

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text

248

Integrating nutrition and culinary medicine into preclinical medical training
Johnston, E. A., Torres, M., Goldgraben, S., Burns, C. M.
BMC Medical Education, 2024/09
Free full text





253

Geographical Distribution of Osteopathic Neurosurgery Residents
Ariwodo, O., Greek, A., Wong, R., Alexander, V. S., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Cureus, 2024/09
Free full text

254

Response to “Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection“
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2024/09
Free full text

255

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text

256

An osteopathic orientation to interprofessional education
Martinez, E. S., Redding, D.
Journal of Osteopathic Medicine, 2024/09
Free full text

257

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2024/09
Free full text

258

Professional skill priorities: Comparison views of osteopathy industry professionals and osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2024/09
Free full text

259

Changes in the Affective Empathy of Osteopathic Students: a Longitudinal Study
Newton, B. W., Vaskalis, Z. T.
Medical Science Educator, 2024/08

260

The WELLMESS Project (Move Well, Eat Well, Sleep Well, Stress Well)
Machireddy, D. R., Reid, C. G., Hollingsworth, J. C., Redden, D.
Cureus, 2024/08
Free full text

261

On-site peer mentorship’s effect on personal and professional development, stress reduction, and ease of transition into the medical education system
Whitfield, S., Hazard, C., Haynes, B., Coffey, T., Lynch, L., Davis, S.
Journal of Osteopathic Medicine, 2024/08


263

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text

264

Students Matriculating into Integrated Plastic Surgery: Are all Medical Schools Equal?
Yau, A., Lentskevich, M. A., Reddy, N. K., Gutowski, K. S., Yau, I., Gosain, A. K.
The Journal of Craniofacial Surgery, 2024/08


266

The hindrance of matching into neurosurgery from doctors of osteopathic-medicine perspective
Kashif, M., Muthana, A., Al-Qudah, A. M., Hoz, S. S.
Surgical Neurology International, 2024/07
Free full text

267

Use of person-centered language in obesity-related publications across sports medicine journals: a systematic review of adherence to person-centered language guidelines in sports medicine
Webb, J., Mach, K., Gooch, T., Reddy, A., Anderson, M., Scott, J., Checketts, J. X., Walker, L., Hartwell, M.
Journal of Osteopathic Medicine, 2024/07
Free full text

268

Interest in Cardiothoracic Surgery Among the American College of Osteopathic Surgeons’ Medical Students
Vogel, A. D., Wynn, A. B., Richards, M. C., Sindoni, M., Brennan, Z., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2024/07

269

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text

270

Leitlinien in der Osteopathie: Pro und Kontra
(Guidelines in osteopathy: Pros and cons)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07



273

A survey of current specialty palliative care education in the United States
Dahlin, C., Wright, P. M.
Annals of Palliative Medicine, 2024/07
Free full text

274

Leitlinien in der Osteopathie: Pro und Kontra
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07

275

A validity study of COMLEX-USA Level 3 with the new test design
Mao, X., Boulet, J. R., Sandella, J. M., Oliverio, M. F., Smith, L.
Journal of Osteopathic Medicine, 2024/06
Free full text

276

Evidence of anchoring bias in novice (first year) osteopathic French students in the context of the primary respiratory mechanism: A randomized-experimental study
Driaï-Allègre, C., Coste, F., Olmière, C., Grinand, M., Le Nohaïc, A., Romanet, F., Gourjon, G.
International Journal of Osteopathic Medicine, 2024/06

277

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Canadian osteopaths
Pelletier, R., Morin, C., Noy, M., Thomson, O. P., Sundberg, T., Leach, M. J.
International Journal of Osteopathic Medicine, 2024/06

278

Comorbidities associated with symptoms of subjective cognitive decline in individuals aged 45–64
Monahan, Z., Heath, J., Santos, A. D., Ford, A., Hartwell, M.
Journal of Osteopathic Medicine, 2024/06
Free full text

279

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/06

280

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/06


282

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06

283

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/06
Free full text

284

Somatic Dysfunction and Behavior Correlates in Medical Students
LaFontano, C. M., Huzij, T., Garlock, M., Speth, M., Ko, K., Crouch, N., McDaniel, R., McEchron, M.
The AAO Journal, 2024/06


286

Counterstrain Point Frequency and Treatment in Osteopathic Medical Students
Arnold, C., Quackenbush, D., Fahim, A., Quackenbush, G., Navarro, A., Edwards, C.
The AAO Journal, 2024/06


288

Exploring the Evolution of the Mind-Body Connection as First-Year Osteopathic Medical Students Learn about Common Osteopathic Dysfunctions
Krauss, A., Normil, N., Mosley, B., George, S., Volokitin, M., Milani, S., Henshaw, M.
The AAO Journal, 2024/06


290

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06

291

OMT in the 21st century: current use of technologies in manual therapy education and opportunities for innovation
Pietrantoni, D., Krzykwa, E., Broussard, D., Fredrickson, T., Waters, H., Mehra, R.
The AAO Journal, 2024/06

292

Learning Mindsets and Well-Being and Ill-Being Among Osteopathic Medical Students
Tibbetts, Y., Himmelberger, Z. M., Barron, K. E., Speicher, M. R., Hulleman, C. S.
JAMA Network Open, 2024/06
Free full text

293

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06


295

Research integrity and academic medicine: the pressure to publish and research misconduct
Kearney, M., Downing, M., Gignac, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text



298

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text

299

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text

300

Interventions to promote medical student well-being: an overview of systematic reviews
Bennett-Weston, A., Keshtkar, L., Jones, M., Sanders, C., Lewis, C., Nockels, K., Solomon, J., Howick, J.
BMJ Open, 2024/05
Free full text

301

The Tensegrity Curriculum: A Comprehensive Curricular Structure Supporting Cultural Humility in Undergraduate Medical Education
Jones, A. C., Bertsch, K. N., Williams, D., Channell, M. K.
Advances in Medical Education and Practice, 2024/05
Free full text

302

Immediate Effects of Integrative Health and Medicine Modalities Among Outpatients With Moderate-To-Severe Symptoms
Rodgers-Melnick, S. N., Srinivasan, R., Rivard, R. L., Adan, F., Dusek, J. A.
Global Advances in Integrative Medicine and Health, 2024/05
Free full text


304

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05

305

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text


307

Doctors of Osteopathic Medicine as Plastic Surgery Residents: Demographics, Credentials, and Pathways to Residency
Raborn, L. N., Elmorsi, R., Smith, B. T., Asaad, M., Kelley, R., Egro, F. M.
Journal of Surgical Education, 2024/04

308

The impact of emergency medicine residents on clinical productivity
Pallaci, M., Jouriles, N., dos Santos, A., Miller, J., Gothard, M. D., Seaberg, D. C.
Journal of Osteopathic Medicine, 2024/04
Free full text

309

Overcoming barriers to equality, diversity, inclusivity, and sense of belonging in healthcare education: the Underrepresented Groups' Experiences in Osteopathic Training (UrGEnT) mixed methods study
Draper-Rodi, J., Abbey, H., Hammond, J., Thomson, O. T., Brownhill, K., MacMillan, A., Fabusuyi, Y., Vogel, S.
BMC Medical Education, 2024/04
Free full text

310

The Academic Medicine and Leadership Track for Medical Students
Glaser, K., McEchron, M., Jensen, C., Park, D.
Medical Science Educator, 2024/04
Free full text

311

The Impact of Financial Education on Stress Among Orthopaedic Surgeons
Higginbotham, D. O., Nham, F. H., Cavazos, D. R., Chen, C., Stoker, S. K.
Cureus, 2024/04
Free full text

312

Effect of COVID-19 Curriculum Changes on Medical Student Exam Performance: A Case Series
Ho, J., Levy, J., Afshari, N., Patel, D., Andersen, S., Simanton, E., Linton, M.
Cureus, 2024/04
Free full text

313

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text

314

The 7 Elements Communication Rating Form for Teaching and Assessing Medical Communication Competency
Wise, C. M., Lovett, G. D., Swarm, G. M., Nazar, A.
Cureus, 2024/04
Free full text

315

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text

316

What is wrong with osteopathy? A response to Thomson and MacMillan
Nicholls, D. A.
International Journal of Osteopathic Medicine, 2024/03

317

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03

318

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03

319

The role of aspirin, statins, colchicine, and IL-1 inhibitors in prevention of cardiovascular events: a systematic integrative review
Arboleda, V., Hackworth, A., Bonnice, S., Gonzalez, V., Cabrera, D., Colletti, C., Baxter, C., Aleman Oliva, C., Kabir, S., Huang, J., Khan, A., Filoramo, S., Ecoff, S., Demory Beckler, M., Kesselman, M. M.
Journal of Osteopathic Medicine, 2024/03
Free full text


321

The impact of osteopathic recognition on multiple medical specialty residencies in a university-based setting
Nohomovich, B., Tito, E., Baker, J., Gomes, T.
Journal of Osteopathic Medicine, 2024/03
Free full text

322

Teaching ultrasound in osteopathic medical schools
Slyvka, Y., Gwilym, J. L.
Journal of Osteopathic Medicine, 2024/03
Free full text

323

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03

324

A tailored training based on students’ and teachers’ needs to improve palpation skills: A quantitative part of a mixed-method study
Lavazza, C., Zangoni, G., Sozzi, F., Abenavoli, A., Barenghi, M.
International Journal of Osteopathic Medicine, 2024/03

325

Expansion of osteopathic medicine practitioner education on substance use disorders
Petrides, J., Jha, S., Kowalski, A., Hosein, S., Collins, P. B., Coren, J.
Journal of Osteopathic Medicine, 2024/03
Free full text

326

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03

327

Medical Students' Knowledge, Attitudes Toward, and Identification of Adverse Childhood Experiences and Trauma-Informed Care
Piszczor, R., Barry, C., Gundacker, C., Wallace, C., Shibuya, J., Perle, J.
The Permanente Journal, 2024/03
Free full text

328

Academic Degree Bias Among Speaking and Leadership Roles at the American Academy of Orthopaedic Surgeons Annual Meetings, 2016-2021
Bartlett, L., Daley, A., Kazimierczak, A., Klein, B., Humbyrd, C., Bitterman, A., Cohn, R.
Cureus, 2024/03
Free full text

329

Cross-Sectional Analysis of the Effect of Physical Activity, Nutrition, and Lifestyle Factors on Medical Students' Academic Achievement
Neuman, J., Ina, E. A., Huq, S. O., Blanca, A., Petrosky, S. N.
Cureus, 2024/03
Free full text

330

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03

331

Prevalence and quality of medical Spanish education in US osteopathic medical schools: a national survey
Dey, K., Romero Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2024/02
Free full text

332

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text

333

The Prevalence and Distribution of Osteopathic Chief Residents in Emergency Medicine
Wandro, E., Rammaha, S., McGurk, K.
Cureus, 2024/02
Free full text

334

Identified strategies to mitigate medical student mental health and burnout symptoms
Ozan, K. G., McGough, J. E. G., Gabel, J., Snow, M., Michel, N., Cooper, L., Robinson, K.
Journal of Osteopathic Medicine, 2024/02
Free full text

335

An assessment of surgery core rotation quality at osteopathic medical schools
Casey, T., Brennan, Z., Pereira, K., Young, G., Paluri, S. N., Gudakunst, C.
Journal of Osteopathic Medicine, 2024/02
Free full text

336

The clinical anatomy fellowship: A participants' perspective
Thiel, G. E., Murtha, C. M., Dennis, J. F., Hopper, M.
Anatomical Sciences Education, 2024/02

337

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text

338

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text



341

The Effect of the Coronavirus (COVID-19) Pandemic on Gender and Medical School Diversity in Gastroenterology Fellowship Matching
Almujarkesh, M. K., Alsakarneh, S., Almeqdadi, M., Al Ta'ani, O., Mohamad, B., Kinnucan, J.
Gastro Hep Advances, 2024/01
Free full text


343

Visual Health Impact of Online Learning During COVID-19 in Osteopathic Medical Students
Syed, Z., Quadri, S.
Journal of Osteopathic Medicine, 2023/12

344


345

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12

346

A Student-Driven Mindfulness Curriculum for First-Year Osteopathic Medical Students: A Pilot Study
Nielsen, C., Katz, S., Parker, M., Trefsgar, J., Bcharah, H., Kalin, J., Delavary, D., Brunk-Grady, M., Jaqua, B.
Journal of Osteopathic Medicine, 2023/12
Free full text

347

Besonderheiten osteopathischer Forschung
(Peculiarities of osteopathic research)
Scheuchl, F., Peuker, E., Kamp, R.
Osteopathische Medizin, 2023/12

348

Letter to the Editor: Underlining there is nothing wrong with osteopathy
Espírito Santo, J., Moita, J., Campos, B., Nunes, A.
International Journal of Osteopathic Medicine, 2023/12

349

Osteopathic Medical Students’ Preferences for Viewing Lectures at a Multi-Campus Medical School
King, L., Rodgers, J., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12

350


351

The Effect of Osteopathic Medical Students’ Age on Desired Specialty
Raidah, A., Huang, P., Tariq, N., Wong, H., Hildreth, L., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12

352

Examining Osteopathic Medical Students’ Experiences with Distance Learning and Social Connectedness
Rodgers, J., King, L., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12

353

Investigating the current published literature where osteopathic manual therapy is used as an intervention: A scoping review
Ryan, H., Friedlander, T., Anderson, H., Mason, J.
International Journal of Osteopathic Medicine, 2023/12

354

Letter o the Editor: Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12

355

Letter to the Editor: There is nothing wrong with osteopathy
van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2023/12


357

Building Interest in the Primary Care Specialty Through Enhanced Global Health Experience
Hernandez, M., Ibiwoye, M. O., Ledbetter, M., Thacker, R., Diaz, S.
Cureus, 2023/12
Free full text

358

Mental health differences in medical students based on curriculum and gender
Jestin, M., Sharma, S., Jhaveri, D., Mitchell, B., Micciche, D., Venkataraman, V., Lambert, K.
BMC Medical Education, 2023/12
Free full text

359

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text

360

Improving Transparency in the Residency Application Process: Survey Study
Ulin, L., Bernstein, S. A., Nunes, J. C., Gu, A., Hammoud, M. M., Gold, J. A., Mirza, K. M.
JMIR Formative Research, 2023/12
Free full text

361

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12

362

Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12

363

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/12
Free full text

364

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/12
Free full text

365

Evaluation of Using Three-Dimensional Sacral Models in the Education of Sacral Osteopathic Manipulative Treatment: A Quality Improvement Study
Carr, G., Schury, C., Hammer, T., Lippert, J., Azevedo, L.
Journal of Osteopathic Medicine, 2023/12

366



368

Healthcare Camp for High School Students Enhances the Understanding of Foundations of Osteopathic Medicine, Identifying Implicit Bias, and Recognizing Social Determinants of Health
Flanagan, M. K., Liu, E. L., Neff, A. R., Klink, A. M., Kruse, K. M., Vroegop, J. M., Orr, A. L., Skinner, B. W., Hum, J. M.
Journal of Osteopathic Medicine, 2023/12

369

Empathy Fatigue in Osteopathic Medical Students
Gernert, E., Malaker, P., Nguyen, T., Uptegrove, L., Nagireddi, S.
Journal of Osteopathic Medicine, 2023/12

370

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12


372

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12

373

Efficacy of Virtual Reality Programs versus Traditional Lectures on Osteopathic Medicine Information Retention
Jacob, T. J., Jose, R. M., Abraham, A., Syed, F., Tran, T.
Journal of Osteopathic Medicine, 2023/12


375

Assessing the Quality and Quantity of Research Among Incoming First-Year Osteopathic Medical Students
Lynch, S., Byrne, J., Sharieff, K.
Journal of Osteopathic Medicine, 2023/12

376

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12

377

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12

378

The Effectiveness of Disinfecting Protocols in Osteopathic Family Medicine Offices
Phyu, R., Patrizio, H. A., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12



381

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12

382

Ultrasound-assisted bony landmark palpation in untrained palpators
Nichols, J. W., Schmidt, C., Raghuraman, D., Turner, D.
Journal of Osteopathic Medicine, 2023/11
Free full text

383

A Pilot Study of Symptoms of Major Depressive Disorder in Medical Students at an Osteopathic Medical School Before and After High-Stakes Examinations
Arabatzis, T. J., Doroshenko, J., Ashraf, M. A., Smith, R. M.
Advances in Medical Education and Practice, 2023/11
Free full text


385

Valid and Invalid Indications for Osteopathic Interventions: A Systematic Review of Evidence-Based Practices and French Healthcare Society Recommendations
Khalaf, Z. M., Margulies, P., Moussa, M. K., Bohu, Y., Lefevre, N., Hardy, A.
Cureus, 2023/11
Free full text

386

Time Until Proof of Credentials Significantly Decreases With the Use of Blockchain Technology and the Document Management System
Tissier, E. A., Berglund, A., Johnson, G. J., Sanzone, Z. A., Goodbread, A. P., Parker, H., Lucas, J., Kashmer, D.
Cureus, 2023/11
Free full text

387

Building Interest in Cardiothoracic Surgery at an Osteopathic Medical School: Results of an Institutional Study and a Guide for Medical Schools
Vogel, A. D., Wynn, A., Sindoni, M., Richards, M. C., Eppler, A. R., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2023/11
Free full text

388

Neurosurgery Clerkships in United States Medical Schools: A Survey of MD- and DO-Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2023/11

389


390

Enhancing Future Healthcare Professional Education Surrounding Substance Use Disorders
Riccio, K. K. C., Hales, K., Whittaker, A.
Journal of Addiction Medicine, 2023/10

391

Effects of a focused training on first-year osteopathic medical students' ability to incorporate point-of-care ultrasound in assessment of the anterior knee
Weaver, C., Heath, D. M., Makin, I. R. S., Hanamaika'i, K., Kanumalla, R., Matsushita, S., Chatta, P., Adhikari, S.
Journal of Osteopathic Medicine, 2023/10
Free full text

392

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09

393

The extent and quality of evidence for osteopathic education: A scoping review
MacMillan, A., Gauthier, P., Alberto, L., Gaunt, A., Ives, R., Williams, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/09

394

The effectiveness of disinfection protocols in medical school osteopathic manipulative medicine labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/09
Free full text

395

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09

396

The Effectiveness of a Mobile Health Clinic Delivering Mandatory and Elective Middle School Immunizations: A Descriptive Analysis
LaGattuta, N. R., Wilson, T. C., Failla, J. A., Stoner, A. M., Fradua, K., Brown, J., Byrd, S. C., Wilson, A., Jones, D., Carroll, L.
Cureus, 2023/09
Free full text

397

Assessing interest in cardiothoracic surgery at an osteopathic medical school: Results of an institutional survey
Vogel, A. D., Wynn, A., Richards, M. C., Sindoni, M., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
JTCVS Open, 2023/09

398

Equal but Separate: The Slow Assimilation of Osteopathic Surgery Residents Two Years After the Unified Match
Bello, G., Lyles, E., Owens, S., Wilson, A. S., Westby, R. W., Evans, W., Edmondson, E., Lindsey, T. G. II., Falcone, J. L., Boyev, A.
Journal of Surgical Education, 2023/09


400

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09



403

Understanding the Use of Program Resources During Virtual Recruitment by Psychiatry Residency Applicants
Bernstein, S. A., Hodgins, G. E., Abu-Hamad, S., Gih, D. E., Gold, J. A.
Academic Psychiatry, 2023/08
Free full text

404

The Evaluation of a Digital Health Intervention to Improve Human Papillomavirus Vaccine Recommendation Practices of Medical Students
Richman, A. R., Torres, E., Wu, Q., Eldridge, D., Lawson, L.
Journal of Cancer Education, 2023/08

405

Diversity Differences Among Cardiovascular Fellowships Across Five Geographic Regions in the United States
Dye, M., Saeed, A., Nguyen, T. Q., Yu, S., Bey, J., Hefner, D., Walk, C. T., Lantz, R.
Cureus, 2023/08
Free full text

406

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text

407

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07

408

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/07

409

Surgical simulation in osteopathic medical schools
Seely, K. D., Hansen, M., Paluri, S. N., Rasmussen, K., Carter, S., Nigh, A.
Journal of Osteopathic Medicine, 2023/07
Free full text

410

Integrating A Student Co-Created Health Systems Science Curriculum Within UME
Ethridge, B., Steadman, M., Crews, B.
Southern Medical Journal, 2023/07

411

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text

412

Study Size Variation Based on Specialty and Intervention Type
Asseraf, N., Torres, J.
The AAO Journal, 2023/06
Free full text

413

Effect of Objective Training Programs on Symmetry and Accuracy of Passive Motion Force Application
Hajicek, J., Huhn, M., Starks, Z., Wang, Y.F., Degenhardt, B.
The AAO Journal, 2023/06
Free full text

414

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06

415

Assessing Differences in Palpation Pressure between Osteopathic Medical Students and Osteopathic Physicians
Jacob, T., Khalid, A., Syed, F., Jose, R., Nikprelaj, K., Frankini, E., Yao, S., Toma, M.
The AAO Journal, 2023/06
Free full text

416

International Overview of Osteopathic Manipulative Treatment in Infants with Nonsynostotic Plagiocephaly: A Scoping Review to Aid in the Inclusion of OMT into the Current Evidence-Based Treatment Guidelines
Jimenez, R., Cao, G., Bomstad, C., Myxter, K., Lozano, A., Tran, M.T., Roettger, V., Gubler, K. D., Brooks, B., Branda, A.
The AAO Journal, 2023/06
Free full text

417

Learning abnormal physical examination signs: an introductory course
Sabirov, A., Chludzinski, M., Eminof, E., Eddy, A., Gallagher, J., Jung, I.
Journal of Osteopathic Medicine, 2023/06
Free full text

418

The Planetary Benefit of Suspending USMLE Step 2 CS: Estimating Carbon Emissions Associated with US Medical Students' Travel to Testing Centers
Sherpa, J. R., Donahue, L., Tsai, J., Nguemeni Tiako, M. J.
The Yale Journal of Biology and Medicine, 2023/06
Free full text

419

Incorporation of an osteopathic-focused lecture series into an already established pediatric residency curriculum
Wysong, M., Copenheaver, D., Powers, L., Flaherty, R.
The AAO Journal, 2023/06
Free full text

420

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06

421

The first step to strengthening graduate level osteopathic education: a national review
Cain, R. A.
Journal of Osteopathic Medicine, 2023/06
Free full text

422

Combating poor mental health in emergency responders: Helping Emergency Responders Overcome (HERO) Act
Derynda, B., Gupta, K. A., Bhattacharya, S., Hollar, T. L.
Osteopathic Family Physician, 2023/06


424

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06

425

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists: An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/06


427

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/06
Free full text



430

Assessing Clinical Reasoning in Medical Students Using a Virtual Patient Simulator
Abdulnour, R., O'Rourke, M., Smith, T.
Diagnosis, 2023/05

431

Virtual Deliberate Practice: Assessing Clinical Reasoning Using an Illness Script-based Simulator
Abdulnour, R. E., Furfaro, D., Sternschein, R., Smith, T. M., Drazen, J. M.
American Journal of Respiratory and Critical Care Medicine, 2023/05

432

Allopathic and Osteopathic Residents Perform Similarly on the Orthopedic In-Training Examination (OITE)
Gomez, C., Ranson, R., Gianakos, A., Miskimin, C., Mulcahey, M. K.
Journal of Surgical Education, 2023/05
Free full text





437

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists : An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/05

438

Medical Education Fellowship: Who's Doing It and Why?
Cueva, J., Jobeun, N., Mody, S.
Western Journal of Emergency Medicine, 2023/05
Free full text

439

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match. Letter
Bohler, F., Aggarwal, N. D.
The Journal of Urology, 2023/04
Free full text


441

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match
Bohler, F., Aggarwal, N. D.
The Journal of Urology, 2023/04

442

Realistic Assessment of Research Publications by Neurosurgery Residency Applicants
Hasley, H. L., O'Malley, G. R., Jr., Bala, S., Weisman, H. E., Roth
World Neurosurgery, 2023/04

443

Barriers to research opportunities among osteopathic medical students
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2023/04
Free full text

444

Understanding and preference toward DOs and OMT before and after an osteopathic principles and practice fellow lecture series
Ellson, L., Wong, N., Harper, J., Williamson, G., Zapata, I., Putnam, K., Roberts, J.
Journal of Osteopathic Medicine, 2023/03
Free full text

445

Interventional Radiology in Osteopathic Medical Education
Cyphers, E., Groskreutz, D., Grilli, C., Ahuja, R.
Journal of Vascular and Interventional Radiology, 2023/03

446

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03

447

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text

448

Response to Lo et al. regarding “The role of 3D digital applications in Manual Therapy Education – A scoping review”
Kovanur Sampath, K., Arumugam, A., Jull, G.
International Journal of Osteopathic Medicine, 2023/03
Free full text


450

Osteopathic education: A scoping review protocol
MacMillan, A., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/03

451

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03

452

Evaluating the impact of a curriculum intervention using an assessment rubric for communication skill development of osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2023/03


454

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text

455

Characteristics of patients presenting at a university outpatient department for com-plementary and integrative medicine
Rotter, G., Binting, S., Teut, M., Ortiz, M., Willich, S. N., Brinkhaus, B.
Complementary Medicine Research, 2023/02


457

Perceived Value of Osteopathic Recognition
Maier, R., Weaver, J., Ginoza, J. A., Meyer, D., Gothard, D.
Family Medicine, 2023/02
Free full text

458

To the Editor: COMLEX-USA vs USMLE? Irrelevant
Terry, R., Lavertue, S.
Journal of Graduate Medical Education, 2023/02
Free full text

459

The Impact of Complementary and Integrative Medicine Following Traumatic Brain Injury: A Scoping Review
Kim, S., Mortera, M. H., Wen, P. S., Thompson, K. L., Lundgren, K., Reed, W. R., Sasson, N., Towner Wright, S., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
The Journal of Head Trauma Rehabilitation, 2023/02
Free full text



462

Factors Leading to Successful Performance on U.S. National Licensure Exams for Medical Students: A Scoping Review
Jeyaraju, M., Linford, H., Bosco Mendes, T., Caufield-Noll, C., Tackett, S.
Academic Medicine, 2023/01

463

Trends in the Sports Medicine Match: An Analysis of the National Resident Matching Program Data from 2010 to 2021
Zaremski, J. L., Waterbrook, A. L., Monseau, A. J., Kliethermes, S. A.
Current Sports Medicine Reports, 2023/01
Free full text


465

Influence of Preventive Medicine Residency Programs and Combined Master of Public Health Programs on Specialty Selection
Harding, M. C., Jung, P.
American Journal of Preventive Medicine, 2023/01
Free full text

466

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12




470

Evocations of Osteopathy's founder and questions for contemporary osteopathic professional identity: A thematic analysis
Skinner, D., Esber, T., Walkowski, S.
International Journal of Osteopathic Medicine, 2022/12


472

A web-based review of global health programs in U.S. allopathic and osteopathic medical schools
Edwards, M. K., An, C., Rohrbaugh, R., Peluso, M. J., Lam, S. K.
Medical Teacher, 2022/12

473

Gender Differences in Stress, Anxiety, and Depression Perceived by Osteopathic Medical Students Within the Context of the COVID-19 Pandemic
Herr, V., Emanuel, J., Farid, A., Morris, A., Balentine, J., Blazey, W., Krishnamachari, B.
Journal of Osteopathic Medicine, 2022/12

474

A Peer-led Program to Increase Diversity in Osteopathic Medical Schools: Three Year Update
Hu, J., Smart, H., Garo, J. A., Rachdi, O., Fernandes Paul, M.
Journal of Osteopathic Medicine, 2022/12

475

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12

476

Student Developed Didactic Series Rooted in Osteopathic Philosophy
Newman, N., Ahmed, S., Shiffler, V., Sinitsa, I., Harold, Z., Naeem, A., Lovett, G., Nazar, A.
Journal of Osteopathic Medicine, 2022/12

477

Measuring the Perception of Readiness with an EHR Training: A Look into Primary Care
Saldivar, E.
Unpublished Dissertation, 2022/11
Free full text

478

The Austrian Osteopathic Practitioners Estimates and RAtes (OPERA): A cross-sectional survey
van Dun, P. L. S., Arcuri, L., Verbeeck, J., Esteves, J. E., Cerritelli, F.
PLoS One, 2022/11
Free full text

479

A Systematic Review on Spinal Asymmetries in Case Studies of Unilateral Nephroptosis from a Viscerosomatic Point of View
Oliva-Pascual-Vaca, Á, Castillo-Cañuelo, M. J., Oliva-Pascual-Vaca, J., Pérez-Montalbán, M., Ordonez, F. J., Martínez-Fernández, J. A.
Healthcare, 2022/11
Free full text

480

Podiatric Medical Resident Wellness: A Group Survey Study
Deheer, P. A., Wolfe, W., Nichols, J. A., Badell, B. J., Patel, N. A.
Journal of the American Podiatric Medical Association, 2022/11

481

The Profile of Belgian Osteopaths: A Cross-Sectional Survey
van Dun, P. L. S., Verbeeck, J., Arcuri, L., Esteves, J. E., Cerritelli, F.
Healthcare, 2022/10
Free full text

482

Non-Pharmacological Management od Systematic Lupus Erythematosus and Systematic Sclerosis: A Systematic Literature Review to Inform Eular Recommendations
Parodis, I., Gomez, A., Tsoi, A., Chow, J. W., Pezzella, D., Girard, C., Stamm, T., Boström, C.
Lupus Science and Medicine, 2022/10
Free full text

483

Osteopathic manipulative treatment use among family medicine residents in a teaching clinic
Caldwell, G., Zeng, L., Kaufman, J., Bates, J.
Journal of Osteopathic Medicine, 2022/10
Free full text

484

A Thematic Analysis of Osteopathic Physicians' Identities and Experiences in North American Professional Sports
Blacha, K., Cade, A., Russell, T., Skinner, D.
Open Access Journal of Sports Medicine, 2022/09
Free full text


486

The utilisation and attitudes to patient reported outcome measures by Australian osteopaths: A cross sectional study
Fleischmann, M., Fryer, G
International Journal of Osteopathic Medicine, 2022/09


488

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text

489

The Predictive Value of the Residency AOBFP In-Service Exam, Produced and Administered by ACOFP
Torres, J. W., Bowling, J. R., Zipp, C., Williams, N., Sandella, J. M., Martinez, L., Moore, B.
Family Medicine, 2022/09
Free full text

490

Student Attitudes About Osteopathic Medical Schools: Increasing Student Willingness to Apply
Mattiace, S. M.
Unpublished Dissertation, 2022/08
Free full text

491

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text

492

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08

493

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text

494

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/08
Free full text

495

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07

496

Osteopathic practice in the United Kingdom: A retrospective analysis of practice data
Plunkett, A., Fawkes, C., Carnes, D.
PLoS One, 2022/07
Free full text


498

Im Gespräch mit … Christian Hartmann
(In dialog with ... Christian Hartmann)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07


500

Osteopathic medical students’ understanding of race-based medicine
Jivens, M., Okafor, I., Beverly, E. A.
Journal of Osteopathic Medicine, 2022/06
Free full text

501

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text




505

To the Editor: Limitations and Alternative Solutions to a USMLE COMLEX-USA Concordance
Jurich, D., Liu, C., Clauser, A.
Journal of Graduate Medical Education, 2022/06
Free full text

506

To the Editor: Response to: Limitations and Alternative Approaches to a USMLE COMLEX-USA Concordance
Sandella, J., Boulet, J., Barnum, S., Tsai, T. H., Wang, Y.
Journal of Graduate Medical Education, 2022/06
Free full text

507

Professional identity in osteopathy: A scoping review of peer-reviewed primary osteopathic research
Phillips, A. R.
International Journal of Osteopathic Medicine, 2022/06
Free full text



510

Complementary medicine visits by palliative care patients: a cross-sectional survey
Steel, Amie, Schloss, Janet, Diezel, Helene, Palmgren, Per J., Maret, Jean Baptiste, Filbet, Marilène
BMJ Supportive and Palliative Care, 2022/05

511

Cross-Sectional Study of Osteopathic General Surgeons in University-Based General Surgery Departments
Khan, M. T., Patnaik, R., Wheeler, C., Ibrahim, M., Wolf, H., Baumgardner, K. C., Lovely, R. S.
Cureus, 2022/05
Free full text

512

Advocacy for Change: An Osteopathic Review of Traumatic Brain Injury Among Combat Veterans
Pendlebury, G. A., Oro, P., Haynes, W., Byrnes, T. R., Keane, J., Goldstein, L.
Cureus, 2022/05
Free full text

513

The Effect of Clinical Anatomy Integration on Medical Student Academic Performance and Learning Approach
Stoudemire, Claire, Terrell, Mark, McCarthy, Sarah, Gulati, Raj, Fonner, Christopher, Kulesza, Randy
FASEB journal, 2022/05
Free full text

514

Parental leave in medical school: supporting students as parents
Ortega, S. R., Barnes, J. M., Waller, J. D.
Journal of Osteopathic Medicine, 2022/05
Free full text

515

Assessing the United States' most frequently asked questions about osteopathic medicine, osteopathic education, and osteopathic manipulative treatment
Sajjadi, N. B., Ottwell, R., Shepard, S., Bray, N., Dyer, R., Wilson, J., Vassar, M., Hartwell, M.
Journal of Osteopathic Medicine, 2022/05
Free full text

516

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text

517

Osteopathy as a complementary/alternative medicine for breast cancer: a Canadian case study and comprehensive review
Fortin, J., Beaupré, A., Thamar Louis, L. A., Roy, C.A., Bourque, M. A., Cappeliez, S., Fadhlaoui, A.
Breast Cancer Management, 2022/04
Free full text

518

Store-and-forward teledermatology impact on diagnosis, treatment and dermatology referrals: Comparison between practice settings
Pasadyn, S. R., McAfee, J. L., Vij, A., Warren, C. B.
Journal of Telemedicine and Telecare, 2022/04

519

Attracting Medical Students to Family Medicine: An Historical View
Young, R. A., Tinger, S.
Family Medicine, 2022/04
Free full text


521

Retention of tissue texture change after cervical muscle energy and high velocity low amplitude intervention: implications for treatment intervals
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2022/04
Free full text

522

A Content Analysis of Osteopaths' Attitudes for a More Inclusive Clinical Practice towards Transgender People
Baldin, I., Esteves, J. E., Tramontano, M., Macdonald, M., Baroni, F., Lunghi, C.
Healthcare, 2022/03
Free full text

523

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text

524

Student Perception of an OMM Virtual Practical Examination: In the Setting of Social Distancing
Berenbeim, G., Metzler, I., Lewis, D., Jie, C.
The AAO Journal, 2022/03
Free full text


526

Patellofemoral pain syndrome: a review of the literature with osteopathic emphasis
Balint, T., Jones, J., Paquette, M., Amalfitano, J.
The AAO Journal, 2022/03
Free full text

527

A Concordance Study of COMLEX-USA and USMLE Scores
Barnum, S., Craig, B., Wang, X., Sandella, J., Tsai, T.H., Boulet, J., Wang, Y.
Journal of Graduate Medical Education, 2022/03
Free full text



530


531

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text

532

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text

533

The Role of Advanced Academic Degrees in Orthopaedic Sports Medicine Faculty
Chen, A. Z., Greaves, K. M., Fortney, T. A., Ahmad, C. S., Levine, W. N., Trofa, D. P., Lynch, T. S.
Orthopaedic Journal of Sports Medicine, 2022/02
Free full text

534

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02

535

20/20 Vision
Finch, T.
Health Communication, 2022/01
Free full text

536

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01



539

Undergraduate pre-requisite coursework: Six important tips for pre-medical students considering Osteopathic Medical school in the USA
Kadavakollu, S., Moullet, Z., Yoshida, M., Qureshi, M., Graneto, J., Boyanovsky, B.
International Journal of Osteopathic Medicine, 2021/12

540

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text

541

Adaptation and validation of the SEGUE checklist to assess osteopathy students' clinical communication skills
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2021/12


543

Perceptions of COVID-19 vaccines among osteopathic medical students (OMS)
Al Janabi, T., Chinsky, R., Pino, M. A.
International Journal of Osteopathic Medicine, 2021/12
Free full text

544

Pain knowledge and fear-avoidance beliefs of French osteopathy students and educators towards chronic low back pain: An osteopathic educational institution-based cross-sectional survey
Mhadhbi, H., Thierry-Hildenbrand, B., Draper-Rodi, J., Esteves, J. E., Ménard, M.
International Journal of Osteopathic Medicine, 2021/12


546


547

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

548

Factors Influencing Osteopathic Medical Students’ Decision to Pursue a Surgical Specialty
Keever, K., Kiernan, R. N., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12

549

Factors Affecting Osteopathic Medical Students’ Specialty Choice in Light of a Future Pass/Fail COMLEX Level 1 and USMLE Step 1
Kiernan, R. N., Keever, K., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12

550

Understanding medical student perspectives in virtual osteopathic manipulative medicine education during the COVID pandemic
Liu, T., Torrents, M., Sharma, S., Burke, D., Giovanis, A.
Journal of Osteopathic Medicine, 2021/12

551

A Pilot Study to Examine Medical Students’ Perception of their Osteopathic Manipulative Therapy Education
Mazzi, J., Leavitt, N., Kisby, G.
Journal of Osteopathic Medicine, 2021/12

552

Improving Upon Osteopathic Palpatory Skills using a 3D Printed Rotational Lumbar Spine Model
Rey, T., Thomas, A., Nolin, J., Sanders, J. G., Cedoz, K., Berwick, R.
Journal of Osteopathic Medicine, 2021/12

553

The Importance of Dermatology Education During Osteopathic Preclerkship Curriculum
Tan, V., Schukow, C., Vitale, V., Restini, C.
Journal of Osteopathic Medicine, 2021/12

554

MD and DO: Differing Medical Degrees and the Associated Perceptions
Harfouch, N., Grunhut, J., Hsu, A., Pinsky, S., Chacko, J., Raden, M., Slanetz, P. J., Sarkany, D.
Current Problems in Diagnostic Radiology, 2021/11

555

A comparative study of the effectiveness of an osteopathic primary care sports medicine led intervention on performance in men's collegiate lacrosse players
Rao, N. C., Zwibel, H., Berezanskaya, J., Pena, P., Jung, M. K.
Journal of Osteopathic Medicine, 2021/11
Free full text


557

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text

558

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11


560

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text

561

Comprehensive Reform and Greater Equity in Applying to Residency-Trainees' Mixed Responses to a Pass/Fail USMLE Step 1
Ganesh Kumar, N., Pontell, M. E., Makhoul, A. T., Drolet, B. C.
Journal of Graduate Medical Education, 2021/10
Free full text


563


564

The Challenges of Implementing a Joint Interprofessional Education Program Between a Pharmacy College and an Osteopathic Medical College: A Case Study
Huggins, C., Basu, P., Senhaji-Tomza, B., Warwick, S., Anthony, M. E.
International Journal of Osteopathic Medicine, 2021/09

565

The legacy and implications of the body-mind-spirit osteopathic tenet: a discussion paper evaluating its clinical relevance in contemporary osteopathic care
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/09


567

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text

568

Embracing industry sponsored research to expand osteopathic medical student research experiences
Morehouse, Z. P., Nash, R. J.
Journal of Osteopathic Medicine, 2021/09
Free full text

569

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09


571

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09

572

Resident opinions of diabetes management in training: a survey
Healy, A. M., Uhrig, J. L., Shubrook, J. H., Aung, N. L., Sadhu, A. R.
Journal of Osteopathic Medicine, 2021/09
Free full text



575

Osteopathic interventions via telehealth in a pediatric population: a retrospective case series
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2021/08
Free full text

576


577

Arkansas College of Osteopathic Medicine Simulated Emergency Response Team: A Student Driven Pilot Program
Newman, C. W., Ackerman, R., Brown, T., Ramsey, H., Spector, D., Carson, J., Sanders, K., Daniels, D., Potts, H.
Southern Medical Journal, 2021/08

578

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text


580

Effect of a required online graded curriculum in the clerkship years on medical student national standardized examination performance
Glaser, K., Pazdernik, V. K., Sackett, D., Sheridan, V.
Journal of Osteopathic Medicine, 2021/08
Free full text




584

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text

585

Knowledge of osteopathic manipulative medicine and osteopathic physicians in a New York South Asian community
Lee, J., Maung, C., Espares, J., Chen, J., Yip, F., Lin, W., Zhao, L., Li, T. S.
Journal of Osteopathic Medicine, 2021/07
Free full text



588

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07

589

The use of visceral techniques in Australian osteopathic practice: A descriptive cross-sectional study
Fleischmann, M., Vaughan, B., Grace, S., Stewart, A., Hart, C., Brew, E., Masters, G., Smeeton, L., Thompson, L., Brooks, M.
Advances in Integrative Medicine, 2021/07

590

Perceptions and experiences of a manual therapy trial: a qualitative study of people with moderate to severe COPD
Baxter, D. A., Shergis, J. L., Hill, C. J., Worsnop, C., Coyle, M. E.
Chiropractic & Manual Therapies, 2021/07
Free full text


592

Efficacy of implementing intermittent STOP THE BLEED® reviews on long term retention of hemorrhage control skills of first year medical students
Sainbayar, E., Holt, N., Jacobson, A., Bhatia, S., Weaver, C.
Journal of Osteopathic Medicine, 2021/06
Free full text


594

The development and application of a remediation process in an osteopathic curriculum
Aubin, A., Boulanger, C., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2021/06

595

Inclusivity and accessibility in undergraduate osteopathic education for students with disability: A scoping review
MacMillan, A., Corser, A., Clark, Z.
International Journal of Osteopathic Medicine, 2021/06

596

Diversity and Inclusion on General Surgery, Integrated Thoracic Surgery, and Integrated Vascular Surgery Residency Program Websites
Mortman, R., Frazier, H. A., Haywood, Y. C.
Journal of Graduate Medical Education, 2021/06
Free full text


598

Effect of a standardized patient encounter on first year medical student confidence and satisfaction with telemedicine
Unrue, E. L., White, G., Cheng, N., Lindsey, T.
Journal of Osteopathic Medicine, 2021/06
Free full text




602

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06

603

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text

604

Scholar 12: Beta Trial of an Osteopathic Research Cultural Development Computer Application
Rowane, M.J., Hellmann, D. E., Branning, R. A., Cola, H. M., Fahoum, J. M., Snyder, B. M., Healy, A. M., Qi-Lytle, X., Rowane, M. P., Terrell, M. A., Hostoffer, R. W.
The AAO Journal, 2021/06
Free full text

605

Current state of nutrition and nutritional supplement training in medical schools
Lowther, D. P.
Unpublished PhD thesis, 2021/05
Free full text

606

The importance of epistemological consideration in the reporting of evidence for osteopathic care in Covid-19 papers
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/05
Free full text

607

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

608

Osteopathic Medicine: What Radiologists Need to Know
Gunderman, L. D., Gunderman, R. B.
Academic Radiology, 2021/05




612

Direct measurement of the rhythmic motions of the human head identifies a third rhythm
Rasmussen, T. R., Meulengracht, K. C.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text


614

Using contact-based education to destigmatize opioid use disorder among medical students
Mort, S. C., Díaz, S. R., Beverly, E. A.
Teaching and Learning in Medicine, 2021/04

615

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04

616

Osteopathic manipulative treatment to improve exclusive breast feeding at 1 month
Danielo Jouhier, M., Boscher, C., Roze, J. C., Cailleau, N., Chaligne, F., Legrand, A., Flamant, C., Muller, J. B.
Archives of Disease in Childhood. Fetal and Neonatal Edition, 2021/04

617

Mentors’ experiences in an osteopathic medical student research program
Hamby, T., Bowman, W. P., Wilson, D. P., Basha, R.
Journal of Osteopathic Medicine, 2021/04
Free full text


619

The use of 3D printing for osteopathic medical education of rib disorders
Moriles, K., Ramnot, A., Lai, M., Jacobs, R. J., Qureshi, Y.
Journal of Osteopathic Medicine, 2021/03
Free full text

620

Predictors of research self efficacy in first-year osteopathic medical students
Jacobs, R. J., Kane, M. N.
International Journal of Osteopathic Medicine, 2021/03


622

Objectivation of an Educational Model in Cranial Osteopathy Based on Experience
Requena-García, J., García-Nieto, E., Varillas-Delgado, D.
Medicina (Kaunas), 2021/03

623

Impact of different types of revision materials on the learning of musculoskeletal techniques
Launay, F., Ménard, M., Bourgin, M., Mhadhbi, H., Sutre, F., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2021/03

624

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text


626

Thomas L. Northup Lecture: Accepting the Death of Osteopathy: A New Beginning
Jealous, J. S.
The AAO Journal, 2021/03
Free full text

627

Poor match rates of osteopathic applicants into ACGME dermatology and other competitive specialties
Craig, E., Brotzman, E., Farthing, B., Giesey, R., Lloyd, J.
Journal of Osteopathic Medicine, 2021/03
Free full text

628

Osteopathic students and graduates matching into pathology residency, 2011–2020
Jajosky, R. P., Coulson, H. C., Rosengrant, A. J., Jajosky, A. N., Jajosky, P. G.
Journal of Osteopathic Medicine, 2021/02
Free full text

629

The flipped classroom: a novel approach to physical examination skills for osteopathic medical students
Bhai, S. A., Poustinchian, B.
Journal of Osteopathic Medicine, 2021/02
Free full text

630

Diversity in osteopathic medical school admissions and the COMPASS program
Dady, N., Mungroo, K. A., Young, T., Akinsanya, J., Forstein, D.
Journal of Osteopathic Medicine, 2021/02
Free full text

631

Predictors of emotional wellbeing in osteopathic medical students in a COVID-19 world
Jacobs, R., Lanspa, M., Kane, M., Caballero, J.
Journal of Osteopathic Medicine, 2021/02
Free full text


633

Should Osteopathic Medical Students Take the USMLE?
Lenchus, J.
Academic Medicine, 2021/02
Free full text

634

Education, Perceptions, and Delivery: Factors Shaping the Perceived Role in the Pre-Exposure Prophylaxis (PrEP) Care Continuum Among a Sample of Osteopathic Medical Students
O'Neil, A. M., Meyers, H. J., DeBoy, K. R., Stowe, M., Hamrick, J., Giano, Z., Hubach, R. D.
AIDS Education and Prevention, 2021/02

635

Associations between stress, anxiety, depression, and emotional intelligence among osteopathic medical students
Doyle, N. A., Davis, R. E., Quadri, S. S. A., Mann, J. R., Sharma, M., Wardrop, R. M., Nahar, V. K.
Journal of Osteopathic Medicine, 2021/02
Free full text

636

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Spanish osteopaths
Alvarez, G., Justribo, C., Sundberg, T., Thomson, O. P., Leach, M. J.
BMC Health Services Research, 2021/02
Free full text



639

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01

640

Transforming a clerkship with telemedicine
Bhatia, R. K., Cooley, D., Collins, P. B., Caudle, J., Coren, J.
Journal of Osteopathic Medicine, 2021/01
Free full text

641

Journal of Osteopathic Medicine: a refreshed and refocused publication for our profession
Zafonte, R. D.
Journal of Osteopathic Medicine, 2021/01
Free full text



644

Perceptions of the Osteopathic Profession in New York City's Korean Communities
Justin Chin, D. O., Haeinn Woo, Oms-Iv, Diane Choi, O. M. S., III, Emily Dube, M. S., Mikhail Volokitin, Md Do, Christine Lomiguen
Osteopathic Family Physician, 2021/01
Free full text

645

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text

646

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text

647

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text

648

Embryologische Wellenreiter
(Embryological surfers)
Keown, D.
Osteopathische Medizin, 2020/12



651

The importance of rigour in the reporting of evidence for osteopathic care in Covid-19 papers
Draper-Rodi, J., Vaucher, P., Thomson, O. P.
Explore (NY), 2020/12
Free full text

652

Comparison of State Medical Licensing Board Disclosures Regarding Resident Performance for United States Allopathic, Osteopathic, and Foreign Medical Graduates
Gajewski, M., Hillen, M., Matassa, D., Kunac, A., Anana, M., Pompeo, L., Kothari, N., Murano, T.
The Journal of the American Osteopathic Association, 2020/12
Free full text



655

Motivating High School Students From Rural Areas to Attend College and Pursue Careers as Osteopathic Physicians
Kadavakollu, S., Shindi, R. S., Nummerdor, H. R., Singh, V. K., Pillai, S. B., Ontiveros, S. J., Boyanovsky, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

656

A piece of the puzzle: Response to Esteves et al
Kovanur Sampath, K., Fairs, E.
International Journal of Osteopathic Medicine, 2020/12

657

Training Osteopathic Medical Students for Drastic 2021 Health Record Documentation Policy Changes
Bains, R., Gill, A., Singh, J., Antos, A., Lim, S., Molga, H., Malik, A., St. Pierre, S., Davis, G., Warner, M.
The Journal of the American Osteopathic Association, 2020/12

658

The effect of osteopathic medicine on pain in musicians with nonspecific chronic neck pain: a randomized controlled trial
Rotter, G., Fernholz, I., Binting, S., Keller, T., Roll, S., Kass, B., Reinhold, T., Willich, S. N., Schmidt, A., Brinkhaus, B.
Therapeutic Advances in Musculoskeletal Disease, 2020/12
Free full text

659

Hand Model Utility for Osteopathic Pelvic Diagnosis in a Remote Learning Setting
Burg, B. J., Ketigian, L. A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/12

660

Effects of the COVID-19 Pandemic on Osteopathic Medical Students’ Screen Time
Edimo, C. O., Espares, J. K., Falus, N. A., Bupathi, S. K., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12

661

Prevalence of Computer Vision Syndrome (CVS) Symptoms on Osteopathic Medical Students
Espares, J. K., Edimo, C. O., Bupathi, S. K., Falus, N. A., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12

662

Burn-out in Osteopathic Medical Students: The Effects of Meditation Before and After the Arrival of the COVID-19 Pandemic
Krishnamachari, B., Morris, A., Chinsky, R., Pendyala, R., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2020/12

663

Levels of Resilience & Coping of Osteopathic Medical Students during COVID-19: Implications for Mental Health Innovations for Physicians in Training
Lanspa, M. E., Jacobs, R. J., Patel, K. C.
The Journal of the American Osteopathic Association, 2020/12

664

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12

665

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12

666

Toward Resilience: Medical Students' Perception of Social Support
Casapulla, S., Rodriguez, J., Nandyal, S., Chavan, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text


668

[PREPRINT] “Somebody Who Does Something Other Than Osteopathy“
Sajjadi, N. B., Shepard, S.
The Journal of the American Osteopathic Association, 2020/11
Free full text

669

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text

670

Status of Entrustable Professional Activities (EPA) Implementation at Colleges of Osteopathic Medicine in the United States and Future Considerations
Linsenmeyer, M., Wimsatt, L., Speicher, M., Basehore, P., Sexton, P. S.
The Journal of the American Osteopathic Association, 2020/11

671

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text

672

Evaluating the quality of clinical teaching in osteopathy
Vaughan, B.
Unpublished PhD thesis, 2020/10
Free full text

673

New investigator editorial: the osteopathic medical student perspective on research
Persand, D., Maddie, N.
American Journal of Physiology. Heart and Circulatory Physiology, 2020/10
Free full text

674

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text

675

Osteopathie in Norwegen
(Osteopathy in Norway)
Becher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10

676

Im Gespräch mit … Diana Stöckl
(In dialog with … Diana Stöckl)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10


678

Musculoskeletal disorders and complaints in professional musicians: a systematic review of prevalence, risk factors, and clinical treatment effects
Rotter, G., Noeres, K., Fernholz, I., Willich, S. N., Schmidt, A., Berghöfer, A.
International archives of occupational and environmental health, 2020/09
Free full text


680

Aquatic Osteopathy Treatment Assessment by Infrared Thermography on Healthy Subjects After Thermoneutral Water Immersion
Maxel, X., Girollet, F., Stubbe, L., Boudot, E., Darraillans, L., Bodnar, J. L.
Journal of Chiropractic Medicine, 2020/09
Free full text

681

What Makes an Osteopathic Treatment Effective From a Patient's Perspective: A Descriptive Phenomenological Study
Consorti, G., Marchetti, A., De Marinis, M. G.
Journal of Manipulative and Physiological Therapeutics, 2020/09

682



684

Finding a way between osteopathic principles and evidence-based practices: Response to Esteves et al
Ménard, M., Draper-Rodi, J., Merdy, O., Wagner, A., Tavernier, P., Jacquot, E., Mhadhbi, H.
International Journal of Osteopathic Medicine, 2020/09

685

Osteopathie für Neugeborene in der Klinik?: Eine qualitative Studie
Osteopathy for newborns in hospitals?: A qualitative study
Brintrup, V., Hartmann, M., Herrmann, H., Belz, S., Esch, S.
Osteopathische Medizin, 2020/09

686

Response to: Models and theoretical frameworks for osteopathic care - A critical view and call for updates and research
Santiago, R., Campos, B., Moita, J., Nunes, A. C. L.
International Journal of Osteopathic Medicine, 2020/09



689

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

690

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text

691

Telemedicine During a Pandemic with Osteopathic Considerations
Rhoads, A.
Osteopathic Family Physician, 2020/08
Free full text


693

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text

694

Vestibular failure managed with osteopathic manipulative treatment: A report of two cases
Origo, D., Tarantino, A. G., Romagnoli, M.
Journal of Bodywork and Movement Therapies, 2020/07

695

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07

696

Services and staffing practices in academic health sciences libraries serving college of osteopathic medicine programs: a mixed methods study
Muellenbach, J. M., Duncan, W. C., Vanier, C., Ennis, L. A., Yang, A.
Journal of the Medical Library Association, 2020/07
Free full text


698

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06




702

Does Empathy Decline in the Clinical Phase of Medical Education? A Nationwide, Multi-Institutional, Cross-Sectional Study of Students at DO-Granting Medical Schools
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
Academic Medicine, 2020/06
Free full text

703

Pain knowledge, attitudes and beliefs of Australian osteopaths drawn from a nationally representative sample of the profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Austin, P.
Journal of Bodywork and Movement Therapies, 2020/06

704

Professional identity in the evolution of osteopathic models: Response to Esteves et al
Alvarez, G., Van Biesen, T., Roura, S.
International Journal of Osteopathic Medicine, 2020/06




708

Does a manual therapy approach improve the symptoms of functional constipation? A systematic review of the literature
Erdrich, L. M., Reid, D., Mason, J.
International Journal of Osteopathic Medicine, 2020/06


710

PROMIS® General Life Satisfaction scale: construct validity in musculoskeletal pain patients
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/06
Free full text

711

Efficacy of osteopathic manipulative treatment on postural control in Parkinsonian patients with Pisa syndrome: A pilot randomized placebo-controlled trial
Zarucchi, A., Vismara, L., Frazzitta, G., Mauro, A., Priano, L., Maestri, R., Bergna, A., Tarantino, A. G.
NeuroRehabilitation, 2020/06




715

Osteopathic Manipulative Medicine Practice Patterns of Third-Year and Fourth-Year Osteopathic Medical Students: An Educational Research Project
Snider, K. T., Couch, R., Bhatia, S.
The Journal of the American Osteopathic Association, 2020/05
Free full text

716

Double Jeopardy: The USMLE for Osteopathic Medical Students
Ahmed, H., Carmody, J. B.
Academic Medicine, 2020/05
Free full text

717

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text

718

Osteopathie auf dem Prüfstand
[Osteopathy under scrutiny]
Dräger, K., Heller, R.
Bundesgesundheitsblatt Gesundheitsforschung Gesundheitsschutz, 2020/05


720

Transitions in Undergraduate Medical Education
Baker, J., Wright, A.
The Journal of the American Osteopathic Association, 2020/05

721

Medizinischer Notfall in der Praxis: Ich packe meinen Koffer …
(Medical emergency in the practice: I pack my suitcase ...)
Merkt, P., Grasmück, J., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04

722

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04


724

More Information on Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/04
Free full text

725

Severe Postoperative Chronic Constipation Related to Anorectal Malformation Managed with Osteopathic Manipulative Treatment
Vismara, L., Cozzolino, V., Pradotto, L. G., Gentile, R., Tarantino, A. G.
Case Reports in Gastroenterology, 2020/04
Free full text

726


727

A new perspective for Somatic Dysfunction in Osteopathy: the Variability Model
Bergna, A., Vismara, L., Parravicini, G., Farra, F.
Journal of Bodywork and Movement Therapies, 2020/03

728

Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research
Esteves, J. E., Zegarra-Parodi, R., van Dun, P., Cerritelli, F., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/03
Free full text

729

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text

730

Life satisfaction and musculoskeletal complaints in a population seeking osteopathy care: consecutive sample of 611 patients
Vaughan, B., Mulcahy, J., Allen, T., Coupe, E., Gobbo, D., Nasser, L., Pain, K., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/03


732

Pre-professional reflective practice: Strategies, perspectives and experiences
McLeod, G. A., Vaughan, B., Carey, I., Shannon, T., Winn, E.
International Journal of Osteopathic Medicine, 2020/03


734

Evaluation of the Clarity and Completeness of Reporting in Orthopedic Clinical Practice Guidelines
Fishbeck, K., Checketts, J. X., Cooper, C. M., Scott, J. T., Vassar, M.
The Journal of the American Osteopathic Association, 2020/02
Free full text


736

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01


738

Perceptions of the osteopathic profession in New York City’s Chinese Communities
Chin, J., Li, S., Yim, G., Zhou, Y. Q., Wan, P., Dube, E., Volokitin, M., Sahni, S., Terrell, M., Lomiguen, C.
Family Medicine and Community Health, 2020/01
Free full text


740

The use of complementary medicine in palliative care in France: an observational cross-sectional study
Filbet, M., Schloss, J., Maret, J.-B., Diezel, H., Palmgren, P. J., Steel, A.
Supportive care in cancer, 2020/01

741

Determinants of health, health behaviours and demographic profile of patients attending an Australian university student-led osteopathy clinic
Vaughan, B., Fitzgerald, K., Fleischmann, M., Mulcahy, J.
Chiropractic & Manual Therapies, 2020/01
Free full text

742

Im Gespräch mit … Professor Karl-Ludwig Resch
(In dialog with...Professor Karl-Ludwig Resch)
Engemann, K. Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01


744

Influence of Future Prescribers’ Personal and Clinical Experiences With Opioids on Plans to Treat Patients With Opioid Use Disorder
Mort, S. C., Díaz, S. R., Miller, C., Bowlby, M., Henderson, D., Beverly, E. A.
The Journal of the American Osteopathic Association, 2019/12
Free full text



747

Self-directed learning and practice of Italian osteopathic students during summer break: a cross-sectional survey
D'Alessandro, G., Consorti, G., Cerritelli, F.
BMC Complementary and Alternative Medicine, 2019/12
Free full text



750

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12

751

Perceptions and Awareness of Osteopathic Medicine Among Students in Other Health Professions
Dyches, R. P., Ruck, L. D., Stein, A. B., Gailius, G. C., Worden, K.
The Journal of the American Osteopathic Association, 2019/12

752

Meditation and Empathy in Osteopathic Medical Students: A Longitudinal Randomized Controlled Trial
Krishnamachari, B., Ramya, P., Shermon, S., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2019/12

753

Osteopathic Medical Students: Promoting Physical Activity
Law, A., Hollar, L., Sklar, E., Sprague, P.
The Journal of the American Osteopathic Association, 2019/12

754

The Efficacy of Treating Thoracic Cage Counterstrain Tender Points With Varied Mobile Point Time Durations in a Classroom Setting
Smith, J. M., Docherty, J., Kooyman, P., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12

755

Experience with and perception of research among first year osteopathic medical students
Jackson, K., Ogunbekun, O., Zahl, S., Lowery, J.
Poster presentation, 2019/11


757

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10

758

Medical Students' Knowledge About Children With Disabilities, Special Education Laws, and Social Services: A Preliminary Scale Development and Pilot Study
Vitalone-Raccaro, N., Sheppard, M. E., Kaari, J. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text


760

Effects of Osteopathic Visceral Treatment in Patients with Gastroesophageal Reflux: A Randomized Controlled Trial
Eguaras, N., Rodriguez-Lopez, E. S., Lopez-Dicastillo, O., Franco-Sierra, M. A., Ricard, F., Oliva-Pascual-Vaca, A.
Journal of Clinical Medicine, 2019/10

761

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10



764

Engaging with evidence-based practice in the osteopathy clinical learning environment: A mixed methods pilot study
Vaughan, B., Grace, S., Gray, B., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2019/09

765

Developing teamwork skills in pre-registration osteopathy education: A qualitative pilot investigation
Vaughan, B., Grace, S., Yoxall, J.
International Journal of Osteopathic Medicine, 2019/09

766

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text

767

Evaluating the Influence of Research on Match Success for Osteopathic and Allopathic Applicants to Residency Programs
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M., Roberts, M. B.
The Journal of the American Osteopathic Association, 2019/09
Free full text

768

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text

769

Student Perceived Value of Reading Assignments During Mandatory Clerkship-Years OMM Course
Lewis, D. D., Pickos, J. J.
The AAO Journal, 2019/09
Free full text

770

Osteopathic approach with a patient undergoing cardiac transplantation: the five diaphragms
Bordoni, B., Morabito, B., Simonelli, M., Nicoletti, L., Rinaldi, R., Tobbi, F., Caiazzo, P.
International medical case reports journal, 2019/09
Free full text

771

Patient Education of Osteopathic Manipulative Medicine as a Gateway to Treatment: A Pilot Study
Majetich, S. A., Majetich, M. W., Clegg, J. M., Ratay, S. M.
The AAO Journal, 2019/09
Free full text

772

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09

773

Enhancing Culturally Sensitive Curriculum in an Osteopathic Medical School
Lopez-Hernandez, G. Y.
Missouri Medicine, 2019/09
Free full text

774

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text

775

Expanding options: Supporting skills transfer from a post-graduate osteopathy program to clinical practice
Macfarlane, C., Cornall, D.
International Journal of Osteopathic Medicine, 2019/09

776

Introduction to Clerkship: Bridging the Gap Between Preclinical and Clinical Medical Education
Butts, C. A., Speer, J. J., Brady, J. J., Stephenson, R. J., Langenau, E., DiTomasso, R., Fresa, K., Becker, M., Sesso, A.
The Journal of the American Osteopathic Association, 2019/09

777

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy for somatoform disorders - a systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

778

Using the Multitheory Model to Predict Initiation and Sustenance of Physical Activity Behavior Among Osteopathic Medical Students
Nahar, V. K., Wilkerson, A. H., Stephens, P. M., Kim, R. W., Sharma, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

779

Ergojump evaluation of the explosive strength in volleyball athletes pre- and post-fascial treatment
Buscemi, A., Petralia, M. C., Ramaci, T., Rapisarda, A., Provazza, C., Di Corrado, D., Perciavalle, V., Perciavalle, V., Coco, M.
Experimental and Therapeutic Medicine, 2019/08
Free full text

780

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

781

Influence of Osteopathic Medical Students’ Personal Health on Attitudes Toward Counseling Obese Pediatric Patients
Whipps, J., Mort, S. C., Beverly, E. A., Guseman, E. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text

782

Novel Approach to Introducing an Ultrasonography Curriculum With Limited Instructor Resources
Evans, D. K., Thiessen, M. E. W.
The Journal of the American Osteopathic Association, 2019/08
Free full text

783

Empathy in Medicine National Norms for the Jefferson Scale of Empathy: A Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text

784

WVSOM Anatomy Lab Tour Program: An Osteopathic Medicine Pipeline With Student Teaching Opportunities
Wines, K. S.
The Journal of the American Osteopathic Association, 2019/07
Free full text

785

Student academic performance factors affecting matching into first-choice residency and competitive specialties
Mitsouras, K., Dong, F., Safaoui, M. N., Helf, S. C.
BMC Medical Education, 2019/07
Free full text


787

Simulation can offer a sustainable contribution to clinical education in osteopathy
Fitzgerald, K. M., Denning, T., Vaughan, B., Fleischmann, M. J., Jolly, B. C.
Chiropractic & Manual Therapies, 2019/07
Free full text

788

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text


790


791

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06


793

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06

794

Identifying a need and knowledge gap of osteopathic medicine in pediatric oncology providers
Belsky, J., Stanek, J., Gerhardt, C., Rose, M.
Pediatric Blood & Cancer, 2019/06

795

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06


797

Learning and teaching of patient-centred communication skills in allied healthcare manual therapy students: A systematic review
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2019/06

798

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06


800

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text

801

A National Evaluation of Scholarly Activity Requirement in Osteopathic EM Residency Programs: Survey of EM Program Directors
Kirkpatrick, A., Doran, T., Mullins, D., Gnugnoli, D., Ashurst, J.
Southern Medical Journal, 2019/05

802

Cynefin Framework for Evidence-Informed Clinical Reasoning and Decision-Making
Lunghi, C., Baroni, F.
The Journal of the American Osteopathic Association, 2019/05
Free full text

803

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05

804

Can Osteopathic Medical Students Accurately Measure Abdominal Aortic Dimensions Using Handheld Ultrasonography Devices in the Primary Care Setting?
Hower, K., Young, C. F., Wagner, A., Thorsen, D., Dugan, J.
The Journal of the American Osteopathic Association, 2019/05
Free full text

805

Comprehensive Medical College Admission Test Preparatory Course as a Strategy to Encourage Premedical Students to Pursue Osteopathic Medicine in Rural Areas
Shipley, T. W., Phu, N., Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2019/04
Free full text

806

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text

807

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text

808

Empathy, Religious Affiliation, and the Growth of Osteopathic Medicine
Cunningham, B.
Unpublished PhD thesis, 2019/04
Free full text

809

Complementary and alternative medicine research in practice-based research networks: A critical review
Lee, H., Peng, W., Steel, A., Reid, R., Sibbritt, D., Adams, J.
Complementary Therapies in Medicine, 2019/04

810

Timing of oral feeding changes in premature infants who underwent osteopathic manipulative treatment
Vismara, L., Manzotti, A., Tarantino, A. G., Bianchi, G., Nonis, A., La Rocca, S., Lombardi, E., Lista, G., Agosti, M.
Complementary Therapies in Medicine, 2019/04

811

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text



814

Rescued Root Canal: A Case Report on OMT for Jaw Pain Following Repeat Root Canal Procedure
Fong, K. F., Rummel, T. B.
The AAO Journal, 2019/03
Free full text



817

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text

818

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text

819

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text

820

Osteopathic Manipulative Treatment: A Primary Care Approach
Bodine, W. A.
American Family Physician, 2019/02

821

Assessment of the Efficacy of An Osteopathic Treatment in Infants with Biomechanical Impairments to Suckling
Herzhaft-LeRoy, J., Xhignesse, M., Gaboury, I.
Journal of Visualized Experiments, 2019/02


823

Medical Degree Disparity Among Authors in Obstetrics and Gynecology Journals
Merritt, B., Simunich, T., Ashurst, J.
The Journal of the American Osteopathic Association, 2019/02
Free full text

824

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text

825

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text

826

Zentralbahnhof Thorax
(Central station: thorax)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

827

Investigating interpretation of ACC claims in an osteopathy teaching clinic
Urgert, C.
Unpublished MSc thesis, 2019/01
Free full text

828

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01

829

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text

830

Osteopathic Physical Exam Findings in Chronic Hepatitis C: A Case Study
Chin, J., Francis, M., Lavalliere, J. M., Lomiguen, C. M.
Cureus, 2019/01
Free full text

831

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text

832

Exodus From the Classroom: Student Perceptions, Lecture Capture Technology, and the Inception of On-Demand Preclinical Medical Education
Ikonne, U., Campbell, A. M., Whelihan, K. E., Bay, R. C., Lewis, J. H.
The Journal of the American Osteopathic Association, 2018/12

833

Attitudes, skills and use of evidence-based practice among UK osteopaths: a national cross-sectional survey
Sundberg, T., Leach, M. J., Thomson, O. P., Austin, P., Fryer, G., Adams, J.
BMC Musculoskeletal Disorders, 2018/12
Free full text

834

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text



837

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

838

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text

839

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text

840

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text



843

The Influence of Medical School Debt on Specialty Choice: An Analysis of Colleges of Osteopathic Medicine
Dyches, R. P., Speicher, M. R.
The Journal of the American Osteopathic Association, 2018/11


845

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11


847

Current Trends in COMLEX-USA Level 1 and Level 2-CE Study Resources
McMurray, M., Bires, S.
The Journal of the American Osteopathic Association, 2018/11

848

Integration of Pressure Sensors in Lumbar Palpation Education
Panchmatia, J. H., Docherty, J., Kooyman, P., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

849

Where Comfort and Confidence Diverge: Missed Opportunities for Sexual and Gender Minority Competency in Osteopathic Education
Rashid, H., Schenck-Smith, N., Weirich, E., Lenox, A., Sheikh, H., Boesler, D.
The Journal of the American Osteopathic Association, 2018/11

850

Structure and Function in Medical Education: Trend Analysis of Osteopathic Medical Student Emotional Intelligence (EI) Suggests Curricular Modifications May Improve Functional Traits
Singer-Chang, G., Dong, F., Nevins, N., Seffinger, M., Blumer, J., Darmani, N., Helf, S.
The Journal of the American Osteopathic Association, 2018/11

851

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11

852

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text

853

Professional trust in osteopathy: a theory for educational practice
Mackay Tumber, L.
Unpublished Dissertation, 2018/10
Free full text

854

An Osteopathic Approach to Diagnosis and Management of Sacroiliac Joint Dysfunction
Glover, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/10
Free full text

855

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text

856

Scoping review of systematic reviews of complementary medicine for musculoskeletal and mental health conditions
Lorenc, A., Feder, G., MacPherson, H., Little, P., Mercer, S. W., Sharp, D.
BMJ Open, 2018/10
Free full text

857

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text

858

Osteopathic Evaluation of Urinary Retention Caused by Atypical Presentation of Invasive Cervical Cancer Mimicking Primary Urothelial Tumor
Martingano, D., Ramirez, L. C., Bjurlin, M. A.
The Journal of the American Osteopathic Association, 2018/10
Free full text

859

Meralgia paresthetica: A 5 model osteopathic approach
Torrents, M., Malik, R.
Osteopathic Family Physician, 2018/10
Free full text

860

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10

861

Validity of the Rule of Threes and Anatomical Relationships in the Thoracic Spine
Oakley, C. K., Janssen, S. A. K., Pankratz, J. P., McCumber, T. L., Treffer, K. D., Olinger, A. B.
The Journal of the American Osteopathic Association, 2018/10
Free full text

862

Empathy and Osteopathic Manipulative Medicine: Is It All in the Hands?
Rizkalla, M. N., Henderson, K. K.
The Journal of the American Osteopathic Association, 2018/09
Free full text

863

It depends on how things are to you
Vogel, S.
International Journal of Osteopathic Medicine, 2018/09
Free full text

864

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09


866

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09

867

Learning through multiple lenses: analysis of self, peer, near-peer and faculty assessment of a clinical history taking task in Australia
Fitzgerald, K., Vaughan, B.
Journal of Educational Evaluation for Health Professions, 2018/09
Free full text

868

The role of osteopathy in the Swiss primary health care system: a practice review
Vaucher, P., Macdonald, R. J. D., Carnes, D.
BMJ Open, 2018/09
Free full text


870

Association of Mindfulness With Residency Preference and Curriculum Selection in Preclinical Osteopathic Medical Students
Nayyar, N., Saggio, G., Plummer, M., Jung, M. K., Kappenberg, J.
The Journal of the American Osteopathic Association, 2018/09
Free full text

871

History of Research at Midwestern University/Chicago College of Osteopathic Medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2018/09
Free full text

872

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text


874

Design and development of an e-learning programme: An illustrative commentary
Draper-Rodi, J., Vogel, S., Bishop, A.
International Journal of Osteopathic Medicine, 2018/09

875

Sleep and Lifestyle Habits of Osteopathic Emergency Medicine Residents During Training
Hughes, K. E., Hughes, P. G., Hughes, M. J.
The Journal of the American Osteopathic Association, 2018/08
Free full text

876

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
listed, , No authors
The Journal of the American Osteopathic Association, 2018/08
Free full text

877

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text

878

Evaluating the effectiveness of teaching osteopathy in a combined didactics setting
Eilerman, A., Keller, M. E., Hixson, D., II, Gupta
Osteopathic Family Physician, 2018/08

879

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text

880

Resident Duty Hour Restrictions: The Implications Behind the New Data Ahead of the Single Accreditation System
Berry, A. C., McClain, E. K.
The Journal of the American Osteopathic Association, 2018/08
Free full text

881

Quantitative Description of Osteopathic Physician Authorship in Prominent Neurosurgery Journals Since 1944: Coming of Age?
Cuoco, J. A., Busch, C. M., Rogers, C. M., Guilliams, E. L., Klein, B. J., Howes, G. A., Marvin, E. A.
Cureus, 2018/08
Free full text

882

Oral Health Training in Osteopathic Medical Schools: Results of a National Survey
Simon, L., Silk, H., Savageau, J., Sullivan, K., Riedy, C.
The Journal of the American Osteopathic Association, 2018/07
Free full text

883

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07

884

Medical Students' Knowledge, Attitudes, and Behaviors With Regard to Skin Cancer and Sun-Protective Behaviors
Ivanov, N. N., Swan, A., Guseman, E. H., Whipps, J., Jensen, L. L., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text

885

UK trained osteopaths' relationship to evidence based practice - An analysis of influencing factors
Weber, V., Rajendran, D.
International Journal of Osteopathic Medicine, 2018/07

886

Blood pressure screening in an Australian osteopathy student-led clinic
Vaughan, B., Cannon, N., Davies, D., Kourtis, N., Neophitou, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2018/06

887

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text

888

First-Year Osteopathic Medical Students' Knowledge of and Attitudes Toward Physical Activity
Guseman, E. H., Whipps, J., Howe, C. A., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/06
Free full text

889

The Lancet Low Back pain series: A call to action for osteopathy?
Fitzgerald, K., Vaughan, B., Austin, P., Grace, S., Orchard, D., Orrock, P.l, Fleischmann, M.
International Journal of Osteopathic Medicine, 2018/06

890

Anastamosis
Ackert, K.
The Journal of the American Osteopathic Association, 2018/06
Free full text


892

Reducing Health Disparities: Understanding the Unintended Effects of Health Care Professional and Patient Characteristics on Treatment
Nazione, S., Nazione, A.
The Journal of the American Osteopathic Association, 2018/06
Free full text

893

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text




897

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05

898

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects
Abdelfattah, A., Abdelraoof, N., Nasef, S.
Internal Medicine Journal, 2018/05
Free full text


900

Fibromyalgia Symptoms Reduced by Osteopathic Manipulative Medicine and Gabapentin
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

901

Cervical Osteopathic Manipulation Shown to Affect Median Nerve Function
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

902

The perceptions and experiences of osteopathic treatment among cancer patients in palliative care: a qualitative study
Steel, A., Tricou, C., Monsarrat, T., Ruer, M., Deslandes, C., Sisoix, C., Filbet, M.
Supportive Care in Cancer, 2018/05


904

Faculty Vitality in Osteopathic Medical Schools: A Pilot Study
Ables, A. Z., Shan, L., Broyles, I. L.
The Journal of the American Osteopathic Association, 2018/05
Free full text

905

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

906

Factors Associated With Osteopathic Primary Care Residency Choice Decisions
Dogbey, G. Y., Collins, K., Russ, R., Brannan, G. D., Mivsek, M., Sewell, S.
The Journal of the American Osteopathic Association, 2018/04
Free full text

907

Appendix 2: American Osteopathic Association Specialty Board Certification
Wieting, J. M., Williams, D. G., Kelly, K. A., Morales-Egizi, L.
The Journal of the American Osteopathic Association, 2018/04
Free full text


909

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text

910

Profile of osteopathic practice in Spain: Results from a standardized data collection study
Alvarez Bustins, G., López Plaza, P. V., Carvajal, S. R.
BMC Complementary and Alternative Medicine, 2018/04
Free full text

911

Assessment Considerations for Core Entrustable Professional Activities for Entering Residency
Linsenmeyer, M., Wimsatt, L., Speicher, M., Powers, J., Miller, S., Katsaros, E.
The Journal of the American Osteopathic Association, 2018/04
Free full text


913

Educational Intervention in a Medically Underserved Area
Atance, J., Mickalis, M., Kincade, B.
The Journal of the American Osteopathic Association, 2018/04
Free full text

914

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text

915

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text

916

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03

917

Increasing Self-Awareness of Medical Students Through the Use of Ultrasonography
Sandefur, K., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text

918

Influence of Transverse Process Landmark Localization on Palpation Accuracy of Lumbar Spine Models
Snider, E. J., Pamperin, K., Pazdernik, V., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text

919

Tool for Predicting Medical Student Burnout From Sustained Stress Levels: Factor Analysis of the Medical Education Hassles Scale-R
Johnson, J. C., Degenhardt, B. F., Smith, C. K., Wolf, T. M., Peterson, D. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text

920

A Mokken scale analysis of the peer physical examination questionnaire
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2018/03
Free full text

921

Work-related musculoskeletal injuries among Australian osteopaths: A preliminary investigation
McLeod, G. A., Murphy, M., Henare, T. M., Dlabik, B.
International Journal of Osteopathic Medicine, 2018/03

922

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03

923

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text

924

Morphogenese
(Morphogenesis)
Leitner, M.
Unpublished MSc thesis, 2018/03
Free full text

925

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text

926

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

927

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text

928

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text

929

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text

930

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text

931

Conceptualizing Addiction From an Osteopathic Perspective: Dopamine Homeostasis
Baron, D., Blum, K., Chen, A., Gold, M., Badgaiyan, R. D.
The Journal of the American Osteopathic Association, 2018/02
Free full text

932

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

933

Effect of Ultrasonography on Student Learning of Shoulder Anatomy and Landmarks
de Vries, K. D., Brown, R., Mazzie, J., Jung, M. K., Yao, S. C., Terzella, M. J.
The Journal of the American Osteopathic Association, 2018/01
Free full text

934

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text

935

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text

936

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text

937

OMT May Be Helpful in the Management of Benign Paroxysmal Positional Vertigo
Tegeler, L., Blumer, J.
The Journal of the American Osteopathic Association, 2018/01
Free full text

938

Lymphatic Vessels Found in the Brain-Osteopathic Considerations, Part 2: Now in Humans and Monkeys
King, H. H.
The Journal of the American Osteopathic Association, 2018/01
Free full text

939

OSTMED.DR(R), an Osteopathic Medicine Digital Library
Fitterling, L., Powers, E., Vardell, E.
Medical reference services quarterly, 2018/01

940

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01

941

Gross Anatomy Education Today: The Integration of Traditional and Innovative Methodologies
Houser, J. J., Kondrashov, P.
Missouri Medicine, 2018/01
Free full text


943

Osteopathic Medical Education: Answering the Call
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text

944

Gratitude: Reflections and Belonging in the Osteopathic Family
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text

945

Osteopathy as an Aid to Treatment
Riedel, M.
Deutsches Ärzteblatt International, 2018/01
Free full text


947

Neurobiology of Sexual Assault and Osteopathic Considerations for Trauma-Informed Care and Practice
Cuevas, K. M., Balbo, J., Duval, K., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/12
Free full text


949

Predictors of Osteopathic Medical Students' Readiness to Use Health Information Technology
Jacobs, R. J., Iqbal, H., Rana, A. M., Rana, Z., Kane, M. N.
The Journal of the American Osteopathic Association, 2017/12
Free full text

950

Simulated learning activities as part replacement of clinical placements in osteopathy: A case study
Fitzgerald, K., Denning, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2017/12


952

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text

953

Defining Osteopathic Continuing Medical Education
Loveless, B.
The Journal of the American Osteopathic Association, 2017/12
Free full text


955

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text

956

Descriptive study of interprofessional collaboration between physicians and osteopaths for the pediatric population in Quebec, Canada
Morin, C., Desrosiers, J., Gaboury, I.
BMC Health Services Research, 2017/11
Free full text

957

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2017/11

958

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11


960

Empathy in Residency Years
Impens, A. J., Henderson, K., Rizkalla, M. N., Ivlovic, K.
The Journal of the American Osteopathic Association, 2017/11

961

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
The Journal of the American Osteopathic Association, 2017/11

962

Evolving Practice Settings for Osteopathic Graduates: How Debt Influences Anticipated Career Path
Kunz, M., Richards, J., Scheckel, C., Newman, J., Poole, K., Mi, L.
The Journal of the American Osteopathic Association, 2017/11

963

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text

964

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text


966

Entry of Medical School Graduates Into Family Medicine Residencies: 2016-2017
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text

967

Results of the 2017 National Resident Matching Program(R) and the American Osteopathic Association Intern/Resident Registration Program
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text

968

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text

969

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

970

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text

971

Work related musculoskeletal injuries sustained by Australian osteopaths: qualitative analysis of effects on practitioner health, clinical practice, and patient care
McLeod, G. A., Annels, K., Cohen, J., Edwards, S., Hodgins, D., Vaughan, B.
Chiropractic & Manual Therapies, 2017/10
Free full text



974

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text

975

Mother Still
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

976

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09

977

What Osteopathic Physicians Do
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2017/09
Free full text

978

Pennsylvania Otolaryngologists as a Model for the Implications of Practice Location of Osteopathic vs Allopathic Surgical Subspecialists
Griffith, S., Power, A., Strand, M.
The Journal of the American Osteopathic Association, 2017/09
Free full text

979

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text

980

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text

981

Self-efficacy of Osteopathic Medical Students in a Rural-Urban Underserved Pathway Program
Casapulla, S. L.
The Journal of the American Osteopathic Association, 2017/09
Free full text

982

Clinical Preceptors' Perceptions of Empathy: The Empathy in Osteopathic Training and Education (EMOTE) Study
Davis, G. E., Hartwig, W. C., McTighe, A. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

983

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

984

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text

985

Fundamentals for an Osteopathic Obesity Designed Study: The Effects of Education on Osteopathic Medical Students' Attitudes Regarding Obesity
Gayer, G. G., Weiss, J., Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

986

In Reply to Buser and to Shannon
Cummings, M.
Academic Medicine, 2017/08
Free full text

987

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text

988

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

989

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text


991

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

992

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text

993

Assessment of Research Interests of First-Year Osteopathic Medical Students
Carter, L., McClellan, N., McFaul, D., Massey, B., Guenther, E., Kisby, G.
The Journal of the American Osteopathic Association, 2017/07
Free full text


995

Osteopathic medical students entering family medicine and attitudes regarding osteopathic manipulative treatment: Preliminary findings of differences by sex
Baker, H. H., Linsenmeyer, M., Ridpath, L. C., Bauer, L. J., Foster, R. W.
The Journal of the American Osteopathic Association, 2017/06
Free full text


997

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text


999

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text

1000

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text

1001

A descriptive, cross-sectional study of medical student preferences for vodcast design, format and pedagogical approach
Pettit, R. K., Kinney, M., McCoy, L.
BMC Medical Education, 2017/05
Free full text

1002

Clinical classification in low back pain: best-evidence diagnostic rules based on systematic reviews
Petersen, T., Laslett, M., Juhl, C.
BMC Musculoskeletal Disorders, 2017/05
Free full text

1003

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text

1004

Response to “Contribution of Osteopathic Training to the Primary Care Workforce“
Kozakowski, S. M., Travis, A., Bentley, A., Fetter, G.
Family Medicine, 2017/04
Free full text

1005

Contribution of Osteopathic Training to the Primary Care Workforce
Malouin, R. A., Keenum, A.
Family Medicine, 2017/04
Free full text

1006

Evidence-Based Redesign of the COMLEX-USA Series
Gimpel, J. R., Horber, D., Sandella, J. M., Knebl, J. A., Thornburg, J. E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1007

Residency Program Directors' Interview Methods and Satisfaction With Resident Selection Across Multiple Specialties
VanOrder, T., Robbins, W., Zemper, E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1008

Attitudes of Family Medicine Program Directors Toward Osteopathic Residents Under the Single Accreditation System
Hempstead, L. K., Shaffer, T. D., Williams, K. B., Arnold, L. C.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1009

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1010

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1011

Can the Humanities Humanize Health Care?
Baltonado, J., Cymet, T.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1012

Changes in Osteopathic Medical Education: The Journey Continues
McClain, E. K.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1013

Opening the Doors of Medicine to Women
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/03
Free full text

1014

Use of the Spencer Technique on Collegiate Baseball Players: Effect on Physical Performance and Self-Report Measures
Curcio, J. E., Grana, M. J., England, S., Banyas, P. M., Palmer, B. D., Placke, A. E., Rieck, W. A., Jr., Eade
The Journal of the American Osteopathic Association, 2017/03
Free full text



1017

History of Osteopathic Medicine: Still Relevant?
Orenstein, R.
The Journal of the American Osteopathic Association, 2017/03
Free full text

1018

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text

1019

Correlation Between United States Medical Licensing Examination and Comprehensive Osteopathic Medical Licensing Examination Scores for Applicants to a Dually Approved Emergency Medicine Residency
Kane, K. E., Yenser, D., Weaver, K. R., Barr, G. C. Jr., Goyke, T. E., Quinn, S. M., Worrilow, C. C., Burckhart, A. J., Leonetti, A. L., Yoshioka, I. E., Dusza, S. W., Kane, B. G.
The Journal of Emergency Medicine, 2017/02

1020

JAOA Peer Reviewers, 2016
listed, No authors
The Journal of the American Osteopathic Association, 2017/02
Free full text

1021

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/

1022

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text


1024

Examining Health Care Students' Attitudes toward E-Professionalism
Gettig, J. P., Noronha, S., Graneto, J., Obucina, L., Christensen, K. J., Fjortoft, N. F.
American Journal of Pharmaceutical Education, 2016/12
Free full text

1025

Somatic dysfunction: An osteopathic conundrum
Fryer, G.
International Journal of Osteopathic Medicine, 2016/12

1026

A Survey of Disaster Medical Education in Osteopathic Medical School Curricula
Parrillo, S. J., Christensen, D., Teitelbaum, H. S., Glassman, E. S.
Prehospital and Disaster Medicine, 2016/12
Free full text

1027

Calcaneal osteoid osteoma hidden by confusing symptoms in an 18-year-old basketball player: A case report
Testa, M., Rondoni, A., Francini, L.
International Journal of Osteopathic Medicine, 2016/12


1029

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text

1030

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text

1031

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text


1033

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text

1034

T4 syndrome – A distinct theoretical concept or elusive clinical entity? A case report
Hirai, P. M., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2016/10

1035

Using Patient Perspective Sessions to Increase Empathy and Recall in Preclinical Medical Students
Hendriksz, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text


1037

A.T. Still’s osteopathic lesion theory and evidence-based models supporting the emerged concept of somatic dysfunction
Liem, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text

1038

Effect of Medical Education on Empathy in Osteopathic Medical Students
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text

1039

Correlation Between Standardize Patients' Perceptions of Osteopathic Medical Students and Students' Self-Rated Empathy
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text

1040

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text

1041

The use of critical reflection to foster reflective practice in student osteopaths
McLeod, G. A.
Unpublished PhD thesis, 2016/09
Free full text


1043

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

1044

Berufsgesetz Osteopathie
(Occupational law for osteopathy)
Newiger, C.
Osteopathische Medizin, 2016/09

1045

Osteopathic Manipulative Treatment in Pediatric and Neonatal Patients and Disorders: Clinical Considerations and Updated Review of the Existing Literature
Bagagiolo, D., Didio, A., Sbarbaro, M., Priolo, C. G., Borro, T., Farina, D.
American Journal of Perinatology, 2016/09


1047

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

1048

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text

1049

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text

1050

The effectiveness of complementary manual therapies for pregnancy-related back and pelvic pain A systematic review with meta-analysis
Hall, H., Cramer, H., Sundberg, T., Ward, L., Adams, J., Moore, C., Sibbritt, D., Lauche, R.
Medicine (Baltimore), 2016/08
Free full text

1051


1052

Health literacy screening of patients attending a student-led osteopathy clinic: A pilot investigation
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Complementary Therapies in Clinical Practice, 2016/08

1053

Quantitative Description of Medical Student Interest in Neurology and Psychiatry
Ramos, R. L., Cuoco, J. A., Guercio, E., Levitan, T.
The Journal of the American Osteopathic Association, 2016/07
Free full text



1056

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text

1057

The Use of COMLEX-USA and USMLE for Residency Applicant Selection
Sandella, J. M., Gimpel, J. R., Smith, L. L., Boulet, J. R.
Journal of Graduate Medical Education, 2016/07
Free full text

1058

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text

1059

Osteopathic Approach to the Diagnosis of Appendiceal Mucinous Cystadenocarcinoma Mimicking Primary Ovarian Malignant Neoplasm
Martingano, D., Gurm, H., Oliff, A., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2016/07
Free full text


1061

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06

1062

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text



1065

Time, space and form: Necessary for causation in health, disease and intervention?
Evans, D. W., Lucas, N., Kerry, R.
Medicine, Health Care and Philosophy, 2016/06

1066

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text

1067

Osteopathic manipulative treatment in gynecology and obstetrics: A systematic review
Ruffini, N., D'Alessandro, G., Cardinali, L., Frondaroli, F., Cerritelli, F.
Complementary Therapies in Clinical Practice, 2016/06


1069

Osteopathic medical students' perception of teaching effectiveness of their primary care clinical preceptors
Ojano Sheehan, O., Brannan, G., Dogbey, G.
International Journal of Osteopathic Medicine, 2016/06

1070

(Manual medicine and osteopathic methods on the growing spine)
Kayser, R., Harke, G.
Der Orthopäde, 2016/06

1071

State of affairs of osteopathy in the Benelux: Benelux Osteosurvey 2013
van Dun, P. L. S., Nicolaie, M. A., Van Messem, A.
International Journal of Osteopathic Medicine, 2016/06

1072

Non-specific mechanisms in orthodox and CAM management of low back pain (MOCAM): theoretical framework and protocol for a prospective cohort study
Bradbury, K., Al-Abbadey, M., Carnes, D., Dimitrov, B. D., Eardley, S., Fawkes, C., Foster, J., Greville-Harris, M., Harvey, J. M., Leach, J., Lewith, G., MacPherson, H., Roberts, L., Parry, L., Yardley, L., Bishop, F. L.
BMJ Open, 2016/05

1073

Proposed Amendments to the AOA Constitution, Bylaws, and Code of Ethics
listed, No authors
The Journal of the American Osteopathic Association, 2016/05
Free full text


1075

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

1076

Premedical Students’ Attitudes Toward Primary Care Medicine
Beverly, E. A., Wietecha, D. A., Nottingham, K., Rush, L. J., Law, T. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

1077

ENGAGE Initiative: Showcasing Osteopathic Scholarly Activity
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/05
Free full text

1078

Preparation Strategies of Osteopathic Medical Students for the COMLEX-USA Level 2-PE
Sandella, J. M., Peters, A., Smith, L. L., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1079

Advising Needs of Osteopathic Medical Students Preparing for the Match
Speicher, M. R., Pradhan, S. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1080

Program Characteristics Influencing Allopathic Students' Residency Selection
Stillman, M. D., Miller, K. H., Ziegler, C. H., Upadhyay, A., Mitchell, C. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1081

Effect of a Mandatory Third-Year Osteopathic Manipulative Treatment Course on Student Attitudes
Heineman, K. L., Lewis, D. D., Finnerty, E. P., Crout, S. V., Canby, C.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1082

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1083

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1084

Perceptions of US and Australian Medical Students and Instructors About Clinical Professional Attire: LAPEL Study
Bramstedt, K. A., Colaco, C. M. G., de Silva, E., Rehfield, P. L., Blumenthal-Barby, J. S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1085

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text



1088

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text


1090

The Glymphatic-Lymphatic Continuum: Opportunities for Osteopathic Manipulative Medicine
Hitscherich, K., Smith, K., Cuoco, J. A., Ruvolo, K. E., Mancini, J. D., Leheste, J. R., Torres, G.
The Journal of the American Osteopathic Association, 2016/03
Free full text


1092

Letter to the Editor Regarding “A global view of osteopathy – Mirror or echo chamber”
King, H. H.
International Journal of Osteopathic Medicine, 2016/03

1093

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text

1094

Factors Modifying Burnout in Osteopathic Medical Students
Lapinski, J., Yost, M., Sexton, P., LaBaere, R. J.
Academic Psychiatry, 2016/02



1097

Burnout Among Osteopathic Residents: A Cross-sectional Analysis
Chan, A. M., Cuevas, S. T., Jenkins, J.
The Journal of the American Osteopathic Association, 2016/02
Free full text

1098

Use of complementary and alternative medicine (CAM) by parents in their children and adolescents with epilepsy - Prevelance, predictors and parents' assessment
Hartmann, N., Neininger, M. P., Bernhard, M. K., Syrbe, S., Nickel, P., Merkenschlager, A., Kiess, W., Bertsche, T., Bertsche, A.
European Journal of Paediatric Neurology, 2016/01


1100

Prevalence and characteristics of women who consult with osteopathic practitioners during pregnancy; a report from the Australian Longitudinal Study on Women's Health (ALSWH)
Frawley, J., Sundberg, T., Steel, A., Sibbritt, D., Broom, A., Adams, J.
Journal of Bodywork and Movement Therapies, 2016/01

1101

Evaluating medical student engagement during virtual patient simulations: a sequential, mixed methods study
McCoy, L., Pettit, R. K., Lewis, J. H., Allgood, J. A., Bay, C., Schwartz, F. N.
BMC Medical Education, 2016/01
Free full text

1102

An indication of current views of Australian general practitioners towards chiropractic and osteopathy: a cross-sectional study
Engel, R. M., Beirman, R., Grace, S.
Chiropractic & Manual Therapies, 2016/01
Free full text

1103

Management of Acute Isolated Soleal Vein Thrombosis in a Pregnant Patient With an Osteopathic Approach to Evaluation
Martingano, D., Eisenberg, J., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text

1104

Gamification and Multimedia for Medical Education: A Landscape Review
McCoy, L., Lewis, J. H., Dalton, D.
The Journal of the American Osteopathic Association, 2016/01
Free full text


1106

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text

1107

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text


1109

GME Graduate Retention Rates: A Single Institution Study
Frieswyk, T. J.
Unpublished PhD thesis, 2015/12
Free full text

1110

Assessment in the final year clinical practicum of an Australian osteopathy program
Vaughan, B., Morrison, T.
International Journal of Osteopathic Medicine, 2015/12




1114

A National Study of Primary Care Provided by Osteopathic Physicians
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2015/12
Free full text


1116

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text


1118

Incorporating Osteopathic Curriculum Into a Family Medicine Residency
Hempstead, L. K., Harper, D. M.
Family Medicine, 2015/11

1119

Development of Peer Tutoring Services to Support Osteopathic Medical Students’ Academic Success
Swindle, N., Wimsatt, L.
The Journal of the American Osteopathic Association, 2015/11
Free full text

1120

Incidence of Somatic Dysfunction in Healthy Newborns
Waddington, E. L., Snider, K. T., Lockwood, M. D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2015/11
Free full text


1122

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11

1123

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text

1124

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text

1125

Feasibility of Using Ultrasonography to Establish Relationships Among Sacral Base Position, Sacral Sulcus Depth, Body Mass Index, and Sex
Lockwood, M. D., Kondrashova, T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/11
Free full text


1127

Patients' expectations of osteopathic care: a qualitative study
Cross, V., Leach, C. M., Fawkes, C. A., Moore, A. P.
Health Expectations, 2015/10
Free full text

1128


1129

Antwort von Prof. Fuessl.
[Reply from Prof. Fuessl]
MMW - Fortschritte der Medizin, 2015/10




1133

Perceived teaching quality between near-peer and academic tutors in an osteopathic practical skills class
Vaughan, B., Macfarlane, C.
International Journal of Osteopathic Medicine, 2015/09



1136

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09

1137

Approaching the Single Accreditation System: Curricular Variation in Allopathic, Osteopathic, and Dually Accredited Family Medicine Residency Programs
Mims, L. D., Wannamaker, L. R., Bressler, L. C.
Journal of Graduate Medical Education, 2015/09
Free full text




1141

Improving our impact and developing high-level clinical expertise
Moran, R.
International Journal of Osteopathic Medicine, 2015/09
Free full text

1142

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1143

Effect of Table Trainer-to-Student Ratios on Outcome in Student Assessments of Cervical Muscle Energy Techniques
Snider, K. T., Dowling, D. J., Seffinger, M. A., Channell, M. K., Yao, S. C., Gustowski, S. M., Johnson, J. C., Pryor, M. J.
The Journal of the American Osteopathic Association, 2015/09
Free full text

1144

Basic Mechanisms of Osteopathic Manipulative Treatment: A Must Read
Patterson, M. M.
The Journal of the American Osteopathic Association, 2015/09
Free full text

1145

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1146

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text

1147

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1148

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1149

Im Gespräch mit … Jane Eliza Stark
(In dialog with Jane Eliza Stark)
Höppner, J.P., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07



1152

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text

1153

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

1154

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

1155

Oral cancer knowledge, behavior, and attitude among osteopathic medical students
McCready, Z. R., Kanjirath, P., Jham, B. C.
Journal of Cancer Education, 2015/06

1156

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06

1157

Learning Environment, Preparedness and Satisfaction in Osteopathy in Europe: The PreSS Study
Luciani, E., van Dun, P. L., Esteves, J. E., Lunghi, C., Petracca, M., Papa, L., Merdy, O., Jakel, A., Cerritelli, F.
PLoS One, 2015/06
Free full text

1158

Proposed Amendments to the AOA Constitution
listed, No authors
The Journal of the American Osteopathic Association, 2015/06
Free full text

1159

A global view of osteopathic practice – mirror or echo chamber?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2015/06

1160

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1161

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05

1162

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1163

Variations in the diagnosis and treatment of somatic dysfunction between 4 osteopathic residency programs
Hon, G. A., Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1164

The extent of familial hypercholesterolemia instruction in US schools and colleges of medicine, pharmacy, and osteopathic medicine
Withycombe, B., Winden, J. C., Hassanyn, R., Duell, P. B., Ito, M. K.
Journal of Clinical Lipidology, 2015/05

1165

Student perceptions of gamified audience response system interactions in large group lectures and via lecture capture technology
Pettit, R. K., McCoy, L., Kinney, M., Schwartz, F. N.
BMC Medical Education, 2015/05
Free full text

1166

The meaning of fascia in a changing society
Adstrum, N. S.
Unpublished PhD thesis, 2015/04

1167

Transitions in osteopathic medical education
Cymet, T. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1168

Challenges of teaching live and distance audiences simultaneously
Davis, S. S., Hurtubise, L.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1169

Comparison of COMLEX-USA scores, medical school performance, and preadmission variables between women and men
Dixon, D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1170

Evolution of AOA specialty board certification
Scheinthal, S., Wieting, J. M., Elko, E., Bowling, J., Gonzalez, F., Librizzi, R., Murcek, B., Simms, B.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1171

Relationship between residency placement and clerkship site enrollment: a retrospective analysis
Elliott, S. P., Goldstein, L. B., Meinberg, D., Jeger, A. M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1172

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1173

President's message
Morrone, W.
Journal of Addictive Diseases, 2015/04

1174

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1175

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text


1177

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1178

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1179

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1180

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1181

Osteopathic postdoctoral training institutions' 2014 annual report
Biszewski, M., Ball, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1182

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1183

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1184

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1185

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text



1188

In reply to brock and scott
Kauffman, M.
Academic Medicine, 2015/03
Free full text

1189

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03


1191

Osteopathic medical students' understanding of the Patient Protection and Affordable Care Act: a first step toward a policy-informed curriculum
Beverly, E. A., Skinner, D., Bianco, J. A., Ice, G. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text

1192

Evidence-based medicine and osteopathic medicine: no paradox
Noll, D. R.
The Journal of the American Osteopathic Association, 2015/03
Free full text

1193

Osteopathic graduates perceptions of stress and competence – A longitudinal study
Subramaniam, P., Eaton, S.A., Cranfield, J., Mulcahy, J., McLaughlin, P., Morrison, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2015/03


1195

Research in the osteopathic medical profession: roadmap to recovery-conundrums in osteopathic research require consensus and collaboration
Walkowski, S. A., Eland, D. C., Hain, S., Byron, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text

1196

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text

1197

Relationship of admissions variables and college of osteopathic medicine variables to performance on COMLEX-USA level 3
Baker, H. H., Shuman, V. L., Ridpath, L. C., Pence, L. L., Fisk, R. M., Jr., Boisvert
The Journal of the American Osteopathic Association, 2015/02
Free full text

1198

Impact of the Single Accreditation Agreement on GME Governance and the Physician Workforce
Buser, B. R.
The Journal of the American Osteopathic Association, 2015/02
Free full text



1201

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01




1205

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text

1206

Experiential Learning: An Irreplaceable Tool in Osteopathic Student Education
Bikman, T. J., Ford, J., Schmidt, D., Ridpath, L.
The Journal of the American Osteopathic Association, 2014/12


1208

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text

1209

Osteopathic emergency medicine programs infrequently publish in high-impact emergency medicine journals
Baskin, S. M., Lin, C., Carlson, J. N.
Western Journal of Emergency Medicine, 2014/11
Free full text



1212

Professionalism score and academic performance in osteopathic medical students
Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text


1214

A modified Delphi consensus study to identify UK osteopathic profession research priorities
Rushton, A. B., Fawkes, C. A., Carnes, D., Moore, A. P.
Manual Therapy, 2014/10


1216

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1217

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1218

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text



1221

Relationships between the Comprehensive Osteopathic Medical Achievement Test (COMAT) subject examinations and the COMLEX-USA Level 2-Cognitive Evaluation
Li, F., Kalinowski, K. E., Song, H., Bates, B. P.
The Journal of the American Osteopathic Association, 2014/09
Free full text

1222

Osteopaths' professional views, identities and conceptions – A qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/09

1223

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09

1224

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09

1225

Results, solutions, and learning: The continuing maturation of osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2014/09

1226

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text

1227

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text

1228

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text


1230

A degree of difference: the origins of osteopathy and the first use of the “DO“ designation
Stark, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text

1231

Nonmedical Use of Stimulants Among Medical Students
Wasserman, J. A., Fitzgerald, J. E., Sunny, M. A., Cole, M., Suminski, R. R., Dougherty, J. J.
The Journal of the American Osteopathic Association, 2014/08
Free full text

1232

Multitasking behaviors of osteopathic medical students
Shah, A. V., Mullens, D. J., Van Duyn, L. J., Januchowski, R. P.
The Journal of the American Osteopathic Association, 2014/08
Free full text

1233

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text

1234

Serious adverse events associated with pediatric complementary and alternative medicine
Zorzela, L., Boon, H., Mior, S., Yager, J., Gross, A., Vohra, S.
European Journal of Integrative Medicine, 2014/08

1235

Burnout among osteopathic otolaryngology residents: identification during formative training years
Yost, M. G., Johnson, J. C., Johns, M. M., Burchett, K. D.
The Journal of the American Osteopathic Association, 2014/08
Free full text

1236

A systematic review investigating the effectiveness of Complementary and Alternative Medicine (CAM) for the management of low back and/or pelvic pain (LBPP) in pregnancy
Close, C., Sinclair, M., Liddle, S. D., Madden, E., McCullough, J. E., Hughes, C.
Journal of Advanced Nursing, 2014/08
Free full text

1237

Im Gespräch mit … Gert Roncada
(In dialog with Gert Roncada)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07

1238

Association between cervical and thoracic somatic dysfunction among second-year osteopathic medical students
Brindise, J. P., Nelson, K. E., Kappler, R. E.
The Journal of the American Osteopathic Association, 2014/07
Free full text

1239

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text

1240

Perception-based effects of clinical exposure to osteopathic manipulative treatment on first- and second-year osteopathic medical students
Vazzana, K. M., Yao, S. C., Jung, M. K., Terzella, M. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text

1241

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text


1243

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06



1246

Application of osteopathy in the cranial field to treat left superior homonymous hemianopsia
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2014/06

1247

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06

1248

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text

1249

Predictive relationship of osteopathic manual medicine grades and COMLEX-USA Level 1 total scores and osteopathic principles and practice subscores
Lewis, D. D., Johnson, M. T., Finnerty, E. P.
The Journal of the American Osteopathic Association, 2014/06
Free full text

1250

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text


1252

The Journal of the American Osteopathic Association: the next generation
Orenstein, R.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1253

Osteopathic graduate medical education: new research standards needed
Shulman, H. M., Cooper, K., Devine, W., Trzeciak, M., Burney, U., Chan, W. P., Gomez, A., Humpherys, J., Safavi, H., Yoshida, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1254

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1255

The DREEM, part 2: psychometric properties in an osteopathic student population
Vaughan, B., Mulcahy, J., McLaughlin, P.
BMC Medical Education, 2014/05
Free full text

1256

The DREEM, part 1: measurement of the educational environment in an osteopathy teaching program
Vaughan, B., Carter, A., Macfarlane, C., Morrison, T.
BMC Medical Education, 2014/05
Free full text

1257

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1258

Introducing an osteopathic approach into neonatology ward: the NE-O model
Cerritelli, F., Martelli, M., Renzetti, C., Pizzolorusso, G., Cozzolino, V., Barlafante, G.
Chiropractic & Manual Therapies, 2014/05
Free full text

1259

Investigation into factors influencing roles, relationships, and referrals in integrative medicine
Gray, B., Orrock, P.
The Journal of Alternative and Complementary Medicine, 2014/05
Free full text

1260

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text

1261

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text


1263

The use of technology and perceptions of its effectiveness in training physicians
Mason, P. B., Turgeon, B. M., Cossman, J. S., Lay, D. M.
Medical Teacher, 2014/04

1264

Reevaluating osteopathic medical education for the 21st century and beyond
Shannon, S. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text


1266

Concurrent validity of the Osteopathic General Surgery In-Service Examination
Falcone, J. L., Rosen, M. E.
The Journal of the American Osteopathic Association, 2014/04
Free full text

1267

Student- and faculty-reported importance of science prerequisites for osteopathic medical school: a survey-based study
Binstock, J., Junsanto-Bahri, T.
The Journal of the American Osteopathic Association, 2014/04
Free full text

1268

Unified graduate medical education accreditation: a better plow
Bulger, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text

1269

Moving from EBM to EBOM: an osteopathic perspective on evidence-based medicine
Danto, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text

1270

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text

1271

Relationship between COMLEX-USA scores and performance on the American Osteopathic Board of Emergency Medicine Part I certifying examination
Li, F., Gimpel, J. R., Arenson, E., Song, H., Bates, B. P., Ludwin, F.
The Journal of the American Osteopathic Association, 2014/04
Free full text

1272

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text


1274

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text



1277

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03

1278

Factors important to applicants to osteopathic versus allopathic emergency medicine residency programs
St Amour, B. A.
Western Journal of Emergency Medicine, 2014/03
Free full text

1279

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text

1280

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text

1281

Evidence of declining empathy in third year osteopathic medical students
Caruso, H. M., Bernstein, B.
International Journal of Osteopathic Medicine, 2014/03

1282


1283

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text


1285

Correlation of the emergency medicine resident in-service examination with the American Osteopathic Board of Emergency Medicine Part I
Levy, D., Dvorkin, R., Schwartz, A., Zimmerman, S., Li, F.
Western Journal of Emergency Medicine, 2014/02
Free full text

1286

Should osteopathic students applying to allopathic emergency medicine programs take the USMLE Exam?
Weizberg, M., Kass, D., Husain, A., Cohen, J., Hahn, B.
Western Journal of Emergency Medicine, 2014/02
Free full text

1287

Mini-medical school programs are an effective tool to introduce students to osteopathic medicine
Kaye, K. E., Berns, A. L., Cress, L. R., Nazar, A. M.
The Journal of the American Osteopathic Association, 2014/02
Free full text


1289

Spatial medicine--a call to 'arms'
Myers, T.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text

1290

No place like HOME
Pham, J. T.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1291

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text


1293

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text


1295

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text


1297

Prevention curricula assessment of osteopathic medical schools in the United States
Dombrowski, H. T., Vincent, O. D., Wiley, C. L.
International Journal of Osteopathic Medicine, 2013/12

1298

Patient perception of osteopathic training in the UK and patient reported experience
Drysdale, I. P., Hinkley, H., Rolfe, K. J.
International Journal of Osteopathic Medicine, 2013/12

1299

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12

1300

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12

1301

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12

1302

Emotional processing and its relationship to chronic low back pain
Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12


1304

On the oft-debated question of what it means to be an osteopathic physician
Benzoni, T.
The Journal of the American Osteopathic Association, 2013/12
Free full text

1305

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text

1306

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text

1307

Osteopathic graduate medical education: a way forward
Terry, R.
The Journal of the American Osteopathic Association, 2013/12
Free full text

1308

Assessing undergraduate osteopaths in the identification of patients' excess body weight
Bright, P., Wasik, C.
International Journal of Osteopathic Medicine, 2013/12




1312

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text

1313

Tobacco dependence curricula in US osteopathic medical schools: a follow-up study
Griffith, B. N., Montalto, N. J., Ridpath, L., Sullivan, K.
The Journal of the American Osteopathic Association, 2013/11
Free full text

1314

Pursuit of Complementary and Alternative Medicine Treatments in Adolescents With Cerebral Palsy
Majnemer, A., Shikako-Thomas, K., Shevell, M. I., Poulin, C., Lach, L., Schmitz, N., Law, M., Group the, Q.
Journal of Child Neurology, 2013/11



1317

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1318

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1319

Patients' appraisals of public and private healthcare: a qualitative study of physiotherapy and osteopathy
Bradbury, K. J., Bishop, F. L., Yardley, L., Lewith, G.
Journal of Health Psychology, 2013/10

1320

Theory, mechanisms and methods – What's missing?
Vogel, S.
International Journal of Osteopathic Medicine, 2013/09
Free full text

1321

High-velocity low-amplitude thrust manipulation of the lumbar spine immediately modifies soleus T reflex in asymptomatic adults
Boët, C., Fugier, S., Marsault, J., Toublan, D., Valot, M.E., Cheval, A., Amyot d'Inville, G., Niel, S., Guihéneuc, P., Guihard, G.
International Journal of Osteopathic Medicine, 2013/09



1324

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text

1325

Frequency of counterstrain tender points in osteopathic medical students
Snider, K. T., Glover, J. C., Rennie, P. R., Ferrill, H. P., Morris, W. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text


1327

Osteopath is incorrect term for osteopathic physicians
Kaufman, B.
American Family Physician, 2013/08
Free full text

1328

One of ours
Burhop, J.
The Journal of the American Osteopathic Association, 2013/08
Free full text

1329

Relighting the fire in our bellies
Cain, R. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text

1330

Effects of Osteopathic Manipulative Treatment on Self-Perceived Stress in First-Year Osteopathic Medical Students
Bianchi, W., Cooper, M., Roberts, C., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

1331

Portfolios in Osteopathic Medical Education: A Qualitative Pilot Study
Miner, A., Pierce, L. J., Sidhu, K., Menini, T.
The Journal of the American Osteopathic Association, 2013/08

1332

Reducing Medical Student Fatigue With Osteopathic Manipulative Treatment
Wiegand, S., Jordan, L., Van Tiem, M., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

1333

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1334

Osteopathic Training for MDs
Fredericks, T. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1335

Fascia's function: classical osteopathic perspectives and current research compared
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2013/07
Free full text

1336

Recognising patient-centred care in clinical trials of osteopathy – towards a more pragmatic approach
Moran, R.
International Journal of Osteopathic Medicine, 2013/06
Free full text

1337

Item development for a questionnaire investigating patient self reported perception, satisfaction and outcomes of a single osteopathy in the cranial field (OCF) treatment
Mulcahy, J., Vaughan, B., Boadle, J., Klas, D., Rickson, C., Woodman, L.
International Journal of Osteopathic Medicine, 2013/06

1338

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1339

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text

1340

Osteopathic evaluation of somatic dysfunction and craniosacral strain pattern among preterm and term newborns
Pizzolorusso, G., Cerritelli, F., D', Orazio, M., Cozzolino, V., Turi, P., Renzetti, C., Barlafante, G., D', Incecco, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1341

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1342

Patients' expectations of private osteopathic care in the UK: a national survey of patients
Leach, C. M., Mandy, A., Hankins, M., Bottomley, L. M., Cross, V., Fawkes, C. A., Fiske, A., Moore, A. P.
BMC Complementary Medicine and Therapies, 2013/05
Free full text

1343

He walked with confidence into the wilderness of life: a tribute to Philip E. Greenman, DO (1928-2013)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text


1345

Response
Suminski, R. R., Wasserman, J. A., Guillory, V. J., Hendrix, D., May, L. E.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1346

The use of placebo interventions in clinical practice
Linde, K.
Complementary Therapies in Medicine, 2013/04
Free full text

1347

Osteopathic postdoctoral training institutions and academic sponsorship
Biszewski, M.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1348

Osteopathic graduate medical education 2013
DeRosier, A., Lischka, T. A., Martinez, B.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1349

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1350

Bibliometric measures and National Institutes of Health funding at COMs, 2006-2010
Gugliucci, A.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1351

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text

1352

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1353

Impact indices shed false light
McDonald, R. G.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1354

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1355

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1356

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1357


1358

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text

1359

Osteopathic principles in the modern world
Cotton, A.
International Journal of Osteopathic Medicine, 2013/03

1360

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03

1361

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03


1363

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03

1364

An historical perspective on principles of osteopathy
Stark, J. E.
International Journal of Osteopathic Medicine, 2013/03

1365

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03


1367

Special issue: Osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2013/03


1369

Somatic hygiene: osteopathic manipulative medicine as preventive treatment
Bowers, R. J.
The Journal of the American Osteopathic Association, 2013/03
Free full text

1370

Achieving Effective and Efficient Musculoskeletal Pain Relief Through TCM and OMM
Moy, C., Yu, J., Chiu, R., Hwang, Y. C., Lin, W., Lin, S.L., Burns, J., Lin, A.
The Journal of the American Osteopathic Association, 2013/03


1372

How patients choose osteopaths: a mixed methods study
Bishop, F. L., Bradbury, K., Hj Jeludin, N. N., Massey, Y., Lewith, G. T.
Complementary Therapies in Medicine, 2013/02

1373

Predictors of scoring at least 600 on COMLEX-USA Level 1: successful preparation strategies
Vora, A., Maltezos, N., Alfonzo, L., Hernandez, N., Calix, E., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2013/02
Free full text

1374

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text

1375

Fracture healing with osteopathy in traditional Mongolian medicine
Zhao, N., Wang, M., Li, X.
Journal of Traditional Chinese Medicine, 2013/02
Free full text

1376

A new look for the Journal of the American Osteopathic Association
Berneath Lang, D., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2013/01
Free full text

1377

2012 student research abstracts and poster competitions
Neufeld, K. S.
The Journal of the American Osteopathic Association, 2013/01
Free full text


1379

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12

1380

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12


1382

Methods of assessment used by osteopathic educational institutions
Vaughan, B., Sullivan, V., Gosling, C., McLaughlin, P., Fryer, G., Wolff, M., Gabb, R.
International Journal of Osteopathic Medicine, 2012/12

1383

A systematic review to evaluate the clinical benefits of craniosacral therapy
Jäkel, A., von Hauenschild, P.
Complementary Therapies in Medicine, 2012/12

1384

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1385

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1386

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1387

OCC: will it never end?
Sylvara, J. T.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1388

Touch - more than a basic science
Lalonde, F.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1389

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1390

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1391

Bibliometric measures and National Institutes of Health funding at colleges of osteopathic medicine, 2006-2010
Suminski, R. R., Hendrix, D., May, L. E., Wasserman, J. A., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1392

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1393

Osteopathic manipulative treatment: much more than simply a “hands-on“ phenomenon
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text



1396

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text

1397

Combined manual therapy techniques for the treatment of women with infertility: a case series
Kramp, M. E.
The Journal of the American Osteopathic Association, 2012/10
Free full text

1398

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text

1399

Consent in osteopathy: A cross sectional survey of patients' information and process preferences
Daniels, G., Vogel, S.
International Journal of Osteopathic Medicine, 2012/09

1400

Osteopathic education: Editorial call for papers
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2012/09






1406

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text

1407

Advancing osteopathic medicine through research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2012/09
Free full text

1408

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the USMLE
Lenchus, J. D.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1409

Health-related Internet use among patients of osteopathic physicians
Cooley, D. L., Mancuso, A. M., Weiss, L. B., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1410

Spinal manipulations for tension-type headaches: A systematic review of randomized controlled trials
Posadzki, P., Ernst, E.
Complementary Therapies in Medicine, 2012/08

1411

Preventative Osteopathic Manipulative Treatment and the Elderly Nursing Home Resident: A Pilot Study
Snider, K. T., Snider, E. J., Johnson, J. C., Hagan, C., Schoenwald, C.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1412

Touch: vital to patient-physician relationships
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1413

Frequency of specific osteopathic manipulative treatment modalities used by candidates while taking COMLEX-USA Level 2-PE
Langenau, E. E., Dowling, D. J., Dyer, C., Roberts, W. L.
The Journal of the American Osteopathic Association, 2012/08
Free full text


1415

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1416

Assessing Palpation Thresholds Using Static Lumbar Spine Models
Snider, E. J., Pamperin, K. L., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2012/08

1417

Burnout Among Osteopathic Otolaryngology Residents: Identification, Prevention, and Treatment During Formative Training Years
Yost, M., Johnson, J. C., Burchett, K.
The Journal of the American Osteopathic Association, 2012/08


1419

We have met the enemy and he is us
Vanderburgh, A. J.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1420

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1421

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1422

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1423

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text


1425

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text

1426

Rigor in medical writing: quoting accurately
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text

1427

Empathy in osteopathic medical students: a cross-sectional analysis
Kimmelman, M., Giacobbe, J., Faden, J., Kumar, G., Pinckney, C. C., Steer, R.
The Journal of the American Osteopathic Association, 2012/06
Free full text

1428

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text


1430

Letter About “Thanks, but No Thanks: How Denial of Osteopathic Service in the World Wars Shaped the Profession–1”
Stiger, J.
The Journal of the American Osteopathic Association, 2012/05
Free full text

1431

Thanks but no thanks: how denial of osteopathic service in the world wars shaped the profession
Schriner, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text

1432

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text

1433

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text

1434

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text


1436

Redirect terminology debate toward improved definition of osteopathic medicine
Ching, L. M.
The Journal of the American Osteopathic Association, 2012/03
Free full text





1441

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03


1443

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the United States Medical Licensing Examination
Hasty, R. T., Snyder, S., Suciu, G. P., Moskow, J. M.
The Journal of the American Osteopathic Association, 2012/02
Free full text



1446

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text

1447

Oral health awareness for osteopathic medical students--a medical and dental collaborative effort
Rosenheck, A. H., Scott, G. J., Dombrowski, H. T., Cohen, H. V., York, J. A., Kleiman, A., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/02
Free full text

1448

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text

1449

Cranial osteopathic manipulative medicine's growing evidence base
King, H. H.
The Journal of the American Osteopathic Association, 2012/01
Free full text

1450

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12

1451

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text

1452

Background and methodology of the Osteopathic Survey of Health Care in America 2010 (OSTEOSURV 2010)
Licciardone, J. C., Kearns, C. M., Ruggiere, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text




1456

Osteopathie in Österreich
(Osteopathy in Austria)
Schulmeyer, A.
Osteopathische Medizin, 2011/12

1457

Time to direct COM candidates away from the MCAT?
Kauffman, M.
The Journal of the American Osteopathic Association, 2011/11
Free full text

1458

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text

1459

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text

1460

Promoting safe and efficacious vaccines for adults
Grogg, S. E.
The Journal of the American Osteopathic Association, 2011/10
Free full text

1461

Support for women in osteopathic medicine who breastfeed: a call for action
Pieh-Holder, K. L.
The Journal of the American Osteopathic Association, 2011/10
Free full text

1462

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text

1463

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09

1464

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text

1465

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text




1469

Call for papers: An invitation to contribute to a special issue on osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2011/09

1470

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Melnick, A.
The Journal of the American Osteopathic Association, 2011/09
Free full text


1472

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Perrotta, A. L.
The Journal of the American Osteopathic Association, 2011/09
Free full text

1473

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?
Shaw, H. H.
The Journal of the American Osteopathic Association, 2011/08
Free full text

1474

What Drew You to Osteopathic Medicine? A Survey of Osteopathic Medical Students From 10 Schools
Draper, B. B., Johnson, J. C., Chamberlain, N.
The Journal of the American Osteopathic Association, 2011/08

1475

Evaluation of Osteopathic Manipulative Medicine Pretreatment for the Prevention of Acute Mountain Sickness
Li, R.C., Hwang, J., Shultz, L., Burns, J. M., Garcia-Russell, N.
The Journal of the American Osteopathic Association, 2011/08

1476

Osteopathic Medical Students' Attitude Toward Complementary and Alternative Medicine
Shubrook, J. H., Kanadiya, M. K.
The Journal of the American Osteopathic Association, 2011/08

1477

Improving Resident Research Projects by Providing a Focused Research Infrastructure and Training on Evidence-Based Practice
Weiss, L. B., Filipetto, F. A., Zipp, C. P., Gupta, A. K., Switala, C. A.
The Journal of the American Osteopathic Association, 2011/08

1478

Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes
Langenau, E. E., Sandella, J. M.
The Journal of the American Osteopathic Association, 2011/07
Free full text

1479

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text

1480


1481

An investigation into the transition from student to practising osteopath
Davidson, Y. M.
Unpublished MSc thesis, 2011/07
Free full text


1483

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06

1484

Research: A way of helping us be less wrong
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2011/06

1485

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06

1486

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text

1487

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text

1488

Diagnostic Palpation in Osteopathic Medicine: A Putative Neurocognitive Model of Expertise
Esteves, J. E. d. J.
Unpublished PhD thesis, 2011/06
Free full text


1490

Flawed science is not evidence-based osteopathic medicine
Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text


1492

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1493

DOs should endorse an evidence-based national healthcare policy
Graham, J. D.
The Journal of the American Osteopathic Association, 2011/05
Free full text


1495

Are clinical protocols for osteopathic manipulative procedures truly “osteopathic“?
Kirsch, J. R.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1496

One osteopathic physician's path through an ACGME-Accredited Residency
Patchett, D. C.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1497

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text


1499

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1500

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1501

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1502

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1503

Interprofessional education: cooperation among osteopathic medicine, pharmacy, and physician assistant students to recognize medical errors
Meszaros, K., Lopes, I. C., Goldsmith, P. C., Knapp, K. K.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1504

Osteopathic Issues Raised by the September 2010 JAOA
Patriquin, D. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1505

Understanding osteopathic medical school applicants and the class of 2014
Ramos, R. L., Zhou, C., Hasan, M., Herrera, S. J., Bono, N. A., Hallas, B. H.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1506

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1507

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1508

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1509

Evaluation of colleges of osteopathic medicine: training for the evaluators
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1510

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04

1511

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03

1512

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text

1513

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text

1514

Osteopathic manipulative treatment in developing countries: a call for education and research
Szkwarko, D.
The Journal of the American Osteopathic Association, 2011/03
Free full text

1515

Somatische Dysfunktion
(Somatic dysfunction)
Adler-Michaelson, P.
Osteopathische Medizin, 2011/03

1516

Muscle energy technique: An evidence-informed approach
Fryer, G.
International Journal of Osteopathic Medicine, 2011/03

1517

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text


1519

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03


1521

New COMLEX-USA-to-USMLE conversion formula needed
Burmeister, J. D.
The Journal of the American Osteopathic Association, 2011/02
Free full text

1522

Communication by degrees
Melnick, A.
The Journal of the American Osteopathic Association, 2011/02
Free full text

1523

Student abstracts and poster competitions: encouraging research
Prinsen, J. K.
The Journal of the American Osteopathic Association, 2011/01
Free full text

1524

Relationship between encounter time and candidate performance on COMLEX-USA Level 2-PE
Sandella, J. M., Roberts, W. L., Langenau, E. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text

1525

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text




1529

OMM and TCM: Comparisons of Manipulative Treatment
Zhang, A., Chen, S., Yen, H.R.
The Journal of the American Osteopathic Association, 2011/01





1534

`Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1535

Osteopathic Medicine's Holistic Approach Is More Important Than Ever
Goldberg, P. M.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1536

Progression through osteopathic training in Australia: The student experience
Hartup, J. K., Murphy, R. A., Plowman, L. M., Myers, R.
International Journal of Osteopathic Medicine, 2010/12

1537

Osteopathic medical terminology--redux
Allen, T. W.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1538

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 2: Treatment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12

1539

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 1: Assessment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12

1540

It Means Just What I Choose It to Mean--Neither More nor Less
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1541

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text


1543

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1544


1545

Medical business education in colleges of osteopathic medicine
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2010/11
Free full text

1546

How the AOA established the first national guidelines for OMT
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2010/11
Free full text

1547

Reliability of bony anatomic landmark asymmetry assessment in the lumbopelvic region: application to osteopathic medical education
Stovall, B. A., Kumar, S.
The Journal of the American Osteopathic Association, 2010/11
Free full text

1548

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11




1552

Realigning the JAOA to sharpen our focus
Capobianco, P. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text

1553

Development, implementation, and outcomes of an initiative to integrate evidence-based medicine into an osteopathic curriculum
Laird, S., George, J., Sanford, S. M., Coon, S.
The Journal of the American Osteopathic Association, 2010/10
Free full text

1554

Soul sickness: a frequently missed diagnosis
Tobe, E. H.
The Journal of the American Osteopathic Association, 2010/10
Free full text

1555

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text


1557

Placebo: Missverständnisse und Vorurteile
(Placebo: Misconceptions and prejudices)
Breidert, M., Hofbauer, K.
Osteopathische Medizin, 2010/09

1558

8th International conference on advances in osteopathic research – ICAOR 2010
International Journal of Osteopathic Medicine, 2010/09

1559

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text

1560

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text

1561

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07


1563

COMLEX Level 2-PE Performance Differences between Left-handed and Right-handed Candidates
Langenau, E. E., Dyer, C.
The Journal of the American Osteopathic Association, 2010/08

1564

Standardized Patients and Osteopathic Manipulative Treatment During COMLEX-USA Level 2-PE
Sandella, J. M., Pugliano, G.
The Journal of the American Osteopathic Association, 2010/08

1565

Research and osteopathy: an interview with Dr Gary Fryer by Helge Franke
Franke, H.
Journal of Bodywork and Movement Therapies, 2010/07
Free full text

1566

Defining osteopathic medicine: can you put your finger on it?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2010/07
Free full text

1567

Medecine manuelle - osteopathie en France.
(Manual medicine-osteopathy in France)
Vautravers, P.
Annals of Physical and Rehabilitation Medicine, 2010/06

1568

Relating a manual medicine diagnostic test of cervical motion function to specific three-dimensional kinematic variables
Bush, T. R., Vorro, J., Alderink, G., Gorbis, S., Li, M., Leitkam, S.
International Journal of Osteopathic Medicine, 2010/06



1571

Commentary on the globalization of osteopathic medicine
Qureshi, Y., Kusienski, A. M.
Osteopathic Family Physician, 2010/05

1572

Changes in US healthcare: our time is now, but for what?
Cain, R. A.
The Journal of the American Osteopathic Association, 2010/05
Free full text

1573


1574

The anachronistic fight for osteopathic distinctiveness
Shore, E. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text

1575

Adding MI principles to your communication skills: an interview with Susan Butterworth, PhD
Butterworth, S.
The Journal of the American Osteopathic Association, 2010/04
Free full text

1576

Call to action: aggressively managing lipid levels
Carr, L. L.
The Journal of the American Osteopathic Association, 2010/04
Free full text

1577

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text

1578

An introduction to clinical research in osteopathic medicine
Earley, B. E., Luce, H.
Primary Care: Clinics in Office Practice, 2010/03
Free full text








1586



1588

Osteopathy 2.0: Osteopathy and the new web
Lucas, N. P.
International Journal of Osteopathic Medicine, 2010/03

1589

AOA should support IOM report on resident work hours
Conklin, J. H.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1590

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1591

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1592

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1593

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text


1595

Osteopathic medical education in 2010: another decade of growth
Shannon, S. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1596

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1597

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text


1599

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01

1600

Osteopathic Medicine and Primary Care: one journal, two audiences
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2010/01
Free full text

1601


1602

The Efficacy of OMT by Osteopathic Medical Students on Musculoskeletal Pain and Somatic Findings
Hallas, S. J., Seffinger, M., Hurwitz, E.
The Journal of the American Osteopathic Association, 2010/01

1603

Osteopathic Manipulative Treatments in the Emergency Department: Osteopathic Emergency Physicians’ Perspectives
Holbrook, N. B., Fryer, G., Johnson, J. C., Holbrook, C.
The Journal of the American Osteopathic Association, 2010/01

1604

Anterior Cruciate Ligament Function in Osteopathic Medical Education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2010/01

1605

A Study to Investigate the Efficacy of a Novel Interactive Web-Based Virtual Clinical Scenario System (Virtual People Factory) in Medical Education
Surkunalingam, N., Walker, J., McCaskill, S., Taranto, C., Blanchard, C., Lind, D. S., Rossen, B., Lok, B.
The Journal of the American Osteopathic Association, 2010/01

1606

Gary Fryer –”...there is not much that we can say without any doubt.”
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01

1607

Perception of osteopathic medicine among allopathic physicians in the deep central southern United States
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text

1608

Keeping the osteopathic medical profession parallel and distinctive
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/12
Free full text

1609

Reject influence of pharmaceutical industry
McPartland, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text

1610

Feel, think, treat – A review of the German Osteopathic Congress Berlin Nov 20–23 2008
Donnelly, D.
International Journal of Osteopathic Medicine, 2009/12

1611

Profile of members of the Australian Osteopathic Association: Part 2 - The patients
Orrock, P.
International Journal of Osteopathic Medicine, 2009/12


1613

Billing and coding for OMT
Doss, Y. L., Snider, K. T.
The Journal of the American Osteopathic Association, 2009/11
Free full text


1615

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text


1617

Maintaining distinctiveness and affordability of osteopathic medical education
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/10
Free full text

1618

Personality types and performance: COMLEX-USA Level 2-CE
Getz, R., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2009/10
Free full text

1619

Curricular analysis of competency-based osteopathic medical education: application of a matrix for quality enhancement to a standardized patient encounter example
Lockwood, M. D., Tucker-Potter, S., Sargentini, N. J.
The Journal of the American Osteopathic Association, 2009/09
Free full text

1620

Interest in rural medicine among osteopathic residents and medical students
Colegrove, D. J., Whitacre, B. E.
Rural and Remote Health, 2009/09

1621



1623

Teaching Psychiatry in Osteopathic Medical Schools: A Survey of Current Curriculum and a Suggested Primary Care Approach
Lowe, M., Murphy, M.
The Journal of the American Osteopathic Association, 2009/08

1624

Spiritual and Religious Characteristics of Osteopathic Medical Students
Workman, G. M., Lee, M. M., Nichols, K. J., Workman, D. E., Christian, V. L., Orlinsky, D. E.
The Journal of the American Osteopathic Association, 2009/08

1625

The DO difference: an analysis of causal relationships affecting the degree-change debate
Bates, B. R., Mazer, J. P., Ledbetter, A. M., Norander, S.
The Journal of the American Osteopathic Association, 2009/07
Free full text

1626

Stop smoking, save money, get free OMM
Byrnes Jr., T. R.
The Journal of the American Osteopathic Association, 2009/07
Free full text



1629

The appropriate amount of force used must always be individualized for each patient during each treatment session
Abu-Sbaih, R.
The Journal of the American Osteopathic Association, 2009/07
Free full text

1630

Intent to “teach“ and pay to play in osteopathic medical education
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/06
Free full text

1631

Measuring awareness, interest, and involvement in the osteopathic community through board certification: a survey of DO residents in ACGME-accredited training programs
Scott, S. C., O'Connor, E. M., Marlow, R. A.
The Journal of the American Osteopathic Association, 2009/06
Free full text

1632

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text


1634

Monitoring self-reported adverse events: A prospective, pilot study in a UK osteopathic teaching clinic
Rajendran, D., Mullinger, B., Fossum, C., Collins, P., Froud, R.
International Journal of Osteopathic Medicine, 2009/06

1635

AM Last Page: Osteopathic medicine in the U.S.A
Cummings, M., Rohrer, J.
Academic Medicine, 2009/06
Free full text

1636

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text

1637

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text


1639

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text


1641

The Changing Face of Medical Education: The Role of Religion, Integrative Medicine and Osteopathy
Grossoehme, D. H., Ragsdale, J., Dixon, C., Berz, K., Zimmer, M.
The Open Medical Education Journal, 2009/05
Free full text


1643

Intent to “teach“ and pay to play in osteopathic medical education
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/04
Free full text


1645

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1646

Prevention, diagnosis, and management of osteoporosis-related fracture
Fakih, M.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1647

Don't neglect the “art“ of medicine
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1648

Dual and parallel postdoctoral training programs: implications for the osteopathic medical profession
Burkhart, D. N., Lischka, T. A.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1649

Osteopathic medical education in 2009: sails set for improved healthcare?
Shannon, S. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1650

Evolution of colleges of osteopathic medicine: a discussion of the COCA's “substantive change“ policies
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1651

Profile of members of the Australian Osteopathic Association: Part 1 - The practitioners
Orrock, P.
International Journal of Osteopathic Medicine, 2009/03

1652

New horizons for research and education in osteopathic manipulative medicine
Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2009/02
Free full text

1653

Osteopathie und (Hatha-)Yoga
(Osteopathy and (Hatha) yoga)
Liem, T.
Osteopathische Medizin, 2009/02

1654

Collaboration and excellence in osteopathic medical research
Manion, K. M.
The Journal of the American Osteopathic Association, 2009/01
Free full text

1655

An Analysis of the Use of Web-Based Materials by Medical Students and its Relationship to Learning Style
Halbert, C., Fresa-Dillon, K., Kriebel, R., Coughlin, P., Cuzzolino, R.
The Journal of the American Osteopathic Association, 2009/01

1656

A for-profit medical school
Mychaskiw, G., 2nd, Wiltshire
Academic Medicine, 2009/01
Free full text

1657

Performing Preclerkship Pelvic Examinations Improves Student Perceptions of Clerkship Preparedness
Lievens, A. M., May, L. E.
The Journal of the American Osteopathic Association, 2009/01


1659

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12

1660

Research underpins the evidence base for osteopathic medicine
Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12
Free full text

1661

Three pathways to a physician career: applicants to U.S. MD and DO schools and U.S. Citizen applicants to international medical schools
Jolly, P., Garrison, G., Boulet, J. R., Levitan, T., Cooper, R. A.
Academic Medicine, 2008/12

1662

Response: Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Fitzgerald, M.
The Journal of the American Osteopathic Association, 2008/12
Free full text

1663

Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Lanier, W. L.
The Journal of the American Osteopathic Association, 2008/12
Free full text

1664

COMLEX-USA and in-service examination scores: tools for evaluating medical knowledge among residents
Sevensma, S. C., Navarre, G., Richards, R. K.
The Journal of the American Osteopathic Association, 2008/12
Free full text

1665

The introduction of a novel approach to the teaching and assessment of osteopathic manipulative medicine assessment skills
Fossum, C., Snider, E., Fryer, G., Gillette, N., Degenhardt, B.
International Journal of Osteopathic Medicine, 2008/12

1666

Modern Reception of A.T.Still´s TRIUNE MAN in Germany
Kaiser, F.
Unpublished MSc thesis, 2008/11
Free full text



1669

Supporting and promoting osteopathic medicine through community-based family practice preceptorships: a survey-based study
Aguwa, M. I., Monson, C. L., Liechty, D. K., Fowler, L. V., Kost, M. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text

1670

Prevention, diagnosis, and management of osteoporosis-related fracture: a multifactoral osteopathic approach
Gronholz, M. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text

1671

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text

1672

The Meaning of Tensegrity Principles in Osteopathic Medicine
Pflüger, C.
Unpublished MSc thesis, 2008/09
Free full text

1673


1674

Will the ‘real’ osteopathy please speak up?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/09
Free full text

1675

Commentary on ‘Is there a place for science in the definition of osteopathy’?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09

1676

Osteopathic certification evolving into a continuous certification model
Moskowitz, J. S.
The Journal of the American Osteopathic Association, 2008/09
Free full text


1678

Assessing Educational Impact of Osteopathic Pre-doctoral Teaching Fellows
Cross, B. M., Villanueva, R., Glover, J. C., Hiserote, R. M., Davis, G.
The Journal of the American Osteopathic Association, 2008/08

1679

Use of Ultrasonography in the Preclinical Education of Osteopathic Medical Students: A Pilot Study
Syperda, V. A., Trivedi, P. N., Melo, L. C., Freeman, M. L., Ledermann, E. J., Smith, T. M., Alben, J. O.
The Journal of the American Osteopathic Association, 2008/08

1680

Osteopathic medicine and community health fairs: increasing public awareness while improving public health
Stamat, H. M., Injety, K. R., Liechty, D. K., Pohlod, C. A., Aguwa, M. I.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1681

Evidence-based publications: balancing research mission and our community's needs
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1682

Keeping the flames of OMM burning
Hogarty, D. C.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1683

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1684

Eliminating bad, bad medicine: problems with P4P initiatives
McDonald, R.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1685

Dangers of for-profit education: more than just words
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1686

Election year's first shot over the bow: reforms needed
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1687

Increase efforts to promote primary care
Rapp, R. W.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1688

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1689

AOA is strong advocate for debt relief and primary care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1690

Living in fast forward
Harper, D. L.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1691

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1692

The osteopathic research center will remain key to osteopathic medical profession
Licciardone, J. C., King, H. H., Kearns, C. M.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1693

Culture drives research funding
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1694

DOs need to define value of osteopathic medicine
Snow, R. J., Seffinger, M. A., McGill, S. L., Vincent, R. A.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1695

Role of exercise therapy in osteopathic education, treatment and management
Zamani, J. M.
Unpublished PhD thesis, 2008/07
Free full text

1696


1697


1698

Consistency of standing and seated posture of asymptomatic male adults over a one-week interval: A digital camera analysis of multiple landmarks
Pownall, P. J., Moran, R. W., Stewart, A. M.
International Journal of Osteopathic Medicine, 2008/06

1699

Educating osteopaths to be researchers - what role should research methods and statistics have in an undergraduate curriculum?
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2008/06
Free full text


1701

Saying what you mean and meaning what you say
Rogers, F. J.
The Journal of the American Osteopathic Association, 2008/06
Free full text

1702

AAO Convocation in Dallas, Texas
Beck, M.
Osteopathische Medizin, 2008/05



1705

Constraints to caring: service to medically indigent patients by allopathic and osteopathic physicians
Chirayath, H. T., Wentworth, A. L.
Journal of Health Care for the Poor and Underserved, 2008/05

1706

Excessive tuition does not equal excellent education
Andrews, C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text

1707

Award-winning debt-management education
Goeppinger, K. H.
The Journal of the American Osteopathic Association, 2008/05
Free full text

1708

Mortgaging our future, foreclosing our profession
Kraus II., C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text

1709

Working to ease debt burdens
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/05
Free full text

1710

The virtual haptic back: a simulation for training in palpatory diagnosis
Howell, J. N., Conatser, R. R., Williams II., R. L., Burns, J. M., Eland, D. C.
BMC Medical Education, 2008/04

1711

Expression of the endocannabinoid system in fibroblasts and myofascial tissues
McPartland, J. M.
Journal of Bodywork and Movement Therapies, 2008/04

1712

A randomized controlled trial of the effectiveness of osteopathy-based manual physical therapy in treating pediatric dysfunctional voiding
Nemett, D. R., Fivush, B. A., Mathews, R., Camirand, N., Eldridge, M. A., Finney, K., Gerson, A. C.
Journal of Pediatric Urology, 2008/04
Free full text

1713

Spirituality and medicine: prevalence of spirituality-in-medicine instruction at osteopathic medical schools
McClain, E. K., McClain, R. L., Desai, G. J., Pyle, S. A.
The Journal of the American Osteopathic Association, 2008/04
Free full text

1714

Embrace evidence...with both eyes open
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/04
Free full text

1715

OSTEOPAThic Health outcomes in chronic low back pain: The OSTEOPATHIC Trial
Licciardone, J. C., King, H. H., Hensel, K. L., Williams, D. G.
Osteopathic Medicine and Primary Care, 2008/04

1716

Towards an osteopathic understanding of evidence
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/03
Free full text

1717

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1718

Pushing bodies through COMs
Lisowsky, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1719

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03

1720

Osteopathic medical education in 2008: course corrections and new horizons
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1721

Medical education summits: building a solid foundation for the future of the osteopathic medical profession
Watson, D. K., Nichols, K. J.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1722

Medical conditions in works of art
Salter, V., Ramachandran, M.
British Journal of Hospital Medicine, 2008/02

1723

OMM education vs “real world“ medicine
Davidson, S. M.
The Journal of the American Osteopathic Association, 2008/02
Free full text

1724

Ignorance in high places
Ha, L.
The Journal of the American Osteopathic Association, 2008/02
Free full text

1725

Colleges of osteopathic McMedicine?
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2008/02
Free full text

1726

Debt control for young DOs
Wagner, E.
The Journal of the American Osteopathic Association, 2008/02
Free full text

1727

Doctors’ knowledge of osteopathy in the district of Bregenz
Seewald, S.
Unpublished MSc thesis, 2008/02
Free full text


1729

Osteopathic manipulative medicine and the athlete
Gunnar Brolinson, P., McGinley, S. M., Kerger, S.
Current Sports Medicine Reports, 2008/01


1731

Palpatory diagnosis training on the virtual haptic back: performance improvement and user evaluations
Howell, J. N., Conatser, R. R., Williams, R. L., Burns, J. M., Eland, D. C.
The Journal of the American Osteopathic Association, 2008/01
Free full text

1732

Attitudes toward pay-for-performance initiatives among primary care osteopathic physicians in small group practices
Locke, R. G., Srinivasan, M.
The Journal of the American Osteopathic Association, 2008/01
Free full text



1735


1736

Evidence-informed management of chronic low back pain with prolotherapy
Dagenais, S., Mayer, J., Haldeman, S., Borg-Stein, J.
The Spine Journal, 2008/01



1739

Self-reported health behaviors of osteopathic physicians
McNerney, J. P., Andes, S., Blackwell, D. L.
The Journal of the American Osteopathic Association, 2007/12
Free full text

1740

Psychological response in spinal manipulation (PRISM): a systematic review of psychological outcomes in randomised controlled trials
Williams, N. H., Hendry, M., Lewis, R., Russell, I., Westmoreland, A., Wilkinson, C.
Complementary Therapies in Medicine, 2007/12
Free full text

1741

Is there a place for science in the definition of osteopathy?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/12

1742


1743

Relationships between clinical rotation subscores, COMLEX-USA examination results, and school-based performance measures
Cope, M. K., Baker, H. H., Foster, R. W., Boisvert, C. S.
The Journal of the American Osteopathic Association, 2007/11
Free full text

1744

Evolution of osteopathic graduate medical education: integration of osteopathic principles and practice in postdoctoral training
Lemley, W. W., Steele, K. M., Shires, W. E., McMahan, R. M.
The Journal of the American Osteopathic Association, 2007/11
Free full text

1745

Andrew Taylor Still (1828-1917): founder of osteopathic medicine
Tan, S. Y., Zia, J. K.
Singapore Medical Journal, 2007/11

1746

Nonprofit and for-profit COMs: investing in the future of osteopathic medicine
Ajluni, P. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text

1747

Lake Erie College of Osteopathic Medicine's preclinical problem-based learning pathway program: an alternative medical school curriculum design
Ferretti, S. M., Krueger, W. A., Gabel, L. L., Curry, J. J.
The Journal of the American Osteopathic Association, 2007/10
Free full text


1749

RVUCOM: striving to meet the needs of the osteopathic medical profession
Martin, R. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text


1751


1752

Treatment of irritable bowel syndrome with osteopathy: results of a randomized controlled pilot study
Hundscheid, H. W., Pepels, M. J., Engels, L. G., Loffeld, R. J.
Journal of Gastroenterology and Hepatology, 2007/09
Free full text

1753

Three Shortcomings of Current Osteopathic Medical Education Curricula, a Student Perspective
Alvarez, R. A., Feitell, S., Jones, A. C., Landry, B. W., Mapley, A. C., Mason, C. R., Sarmiento, P. A., Schrick-Senasac, S. L.
Journal of Osteopathic Medicine, 2007/08

1754

Applicant Selection Criteria for Osteopathic Residency Programs
Ballam, G. O., Guillory, V. J.
Journal of Osteopathic Medicine, 2007/08

1755

Awareness of Health Disparities in Organ Donation among Osteopathic Medical Students
Burch, D. M., Gordon, A. R., Burnett, P. A.
The Journal of the American Osteopathic Association, 2007/08

1756

Attitudes towards Osteopathic Manipulation in Career Choices (ATOMICC)
Dunbar, B. D., Desai, G. J.
The Journal of the American Osteopathic Association, 2007/08

1757

Measuring pressures used by physicians and students for cervical diagnosis of segmental somatic dysfunction using the Iso-TOUCH® Palpation Monitor System
Jean, N. T., Kuchera, M. L., Schoenfeldt, B., Dombrowski, R. T., Vardy, T., Williams, L.
The Journal of the American Osteopathic Association, 2007/08

1758

Teaching Palpatory Force to Osteopathic Medical Students
Marchioni, R. M., Badoolah, A. H., Caban-Martinez, A., Patterson, M. M.
The Journal of the American Osteopathic Association, 2007/08

1759

Factors Contributing to Osteopathic Manipulation Usage at Army Family Medicine Residency Programs
Platz, K. E., Asplund, C. A.
The Journal of the American Osteopathic Association, 2007/08

1760

Treating the cause
Stimson, N.
British Dental Journal, 2007/08

1761

Getting “beyond the barriers“ in reforming osteopathic medical education
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2007/07
Free full text

1762

Emphasizing research in osteopathic medical education
Martin, K. D.
The Journal of the American Osteopathic Association, 2007/07
Free full text

1763

COM Accreditation: the Flexner Report revisited
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2007/07
Free full text

1764

Getting back to the country
Ortolon, K.
Texas Medicine, 2007/07

1765

Trichotillomania: a rare but serious disorder
Rodos, J. J.
The Journal of the American Osteopathic Association, 2007/07
Free full text

1766

Is estimating USMLE performance useful?
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2007/06
Free full text

1767

Should your GP be an osteopath? Patients' views of an osteopathy clinic based in primary care
Westmoreland, J. L., Williams, N. H., Wilkinson, C., Wood, F., Westmoreland, A.
Complementary Therapies in Medicine, 2007/06
Free full text

1768

Repatriating DOs with MD-affiliated residencies
Forte, T. E.
The Journal of the American Osteopathic Association, 2007/05
Free full text

1769

Promoting an osteopathic medical research culture
Lee, R. P.
The Journal of the American Osteopathic Association, 2007/05
Free full text

1770

Competence levels in musculoskeletal medicine: a call to action
Ruane, J. J.
The Journal of the American Osteopathic Association, 2007/05
Free full text

1771

Irresistible indexes for somatic dysfunction
Sucher, B. M.
The Journal of the American Osteopathic Association, 2007/05
Free full text




1775

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text

1776

Osteopathic medical education in 2007: plumbing the depths with the questions we ask
Shannon, S. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text

1777

Practice patterns among osteopathic dermatologists in the United States
Yoo, J. Y., Lee, H., Kimball, A. B.
Journal of the American Academy of Dermatology, 2007/03

1778

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03


1780

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2007/02
Free full text

1781

Osteopathy. Sensing and Philosophy
Weber, K.H.
Unpublished MSc thesis, 2007/01
Free full text

1782

Osteopathic degrees overseas
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2007/01
Free full text

1783

Teaching “doctoring“: a model curriculum for family medicine
Wilson, M. A., Blondefield, P. J.
The Journal of the American Osteopathic Association, 2007/01
Free full text

1784

Approval of ACGME Training as an AOA-approved internship: history and review of current data
Bulger, J. B.
The Journal of the American Osteopathic Association, 2006/12
Free full text

1785

Cranial osteopathy: its fate seems clear
Hartman, S. E.
Chiropractic & Manual Therapies, 2006/12
Free full text

1786

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text

1787

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11

1788

Interests in research electives among osteopathic medical students
Pheley, A. M., Lois, H., Strobl, J.
The Journal of the American Osteopathic Association, 2006/11
Free full text

1789

Teaching critical appraisal: a pilot randomized controlled outcomes trial in undergraduate osteopathic medical education
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/11
Free full text

1790

Craniosacral therapy and professional responsibility
Flynn, T. W., Cleland, J. A., Schaible, P.
The Journal of Orthopaedic and Sports Physical Therapy, 2006/11
Free full text

1791

Evidence based-Medizin (EBM)
(Evidence-based medicine (EBM))
Krause, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10


1793

A problem-based learning pathway for medical students: Improving the process through action research
Chegwidden, W. R.
Annals of the Academy of Medicine Singapore, 2006/09
Free full text

1794

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text

1795

Computer-assisted instruction: a survey on the attitudes of osteopathic medical students
Forman, L. J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text

1796

Teaching Osteopathic Manipulative Treatment to Allopathic Family Medicine Residents: The Role of the Community Preceptor
Jorgensen, S., Quinlan, J., Soldo, T.
The Journal of the American Osteopathic Association, 2006/08

1797

Assessing the Effectiveness of OMT Provided by Undergraduate Teaching Fellows as Measured by a Visual Analog Pain Scale
Lerma, C. M., Render, R. M., Sarkaria, J. A., Homertgen, K. D., Hruby, R. J.
The Journal of the American Osteopathic Association, 2006/08

1798

AOA certifying boards are credible and capable
Reeves, R. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text

1799

Blinding protocols, treatment credibility, and expectancy: methodologic issues in clinical trials of osteopathic manipulative treatment
Licciardone, J. C., Russo, D. P.
The Journal of the American Osteopathic Association, 2006/08
Free full text

1800

Worlds of Western medicine and Chinese medicine learning from each other
Wu, E.
The Journal of the American Osteopathic Association, 2006/07
Free full text

1801

Proof-of-concept learning: acrylic templates as empiric evidence
White, J. E.
The Journal of the American Osteopathic Association, 2006/07
Free full text

1802

Future of osteopathic medicine depends on investing in graduate medical education
Tosca, M.
The Journal of the American Osteopathic Association, 2006/07
Free full text

1803

Addressing substance abuse in medical school curricula
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2006/07
Free full text

1804

Suggestions and questions for osteopathic medical education
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2006/06
Free full text

1805

Competence levels in musculoskeletal medicine: comparison of osteopathic and allopathic medical graduates
Stockard, A. R., Allen, T. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text

1806

Front-line osteopathic medicine
Hayes, D. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text

1807

Manipulative treatment for idiopathic impotence in a 24-year-old water polo player
Crow, W. T.
International Journal of Osteopathic Medicine, 2006/06

1808

Progressive idea for osteopathic medical education
Belsky, D. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1809

Relationships between scores on the COMLEX-USA Level 2-Performance Evaluation and selected school-based performance measures
Baker, H. H., Cope, M. K., Adelman, M. D., Schuler, S., Foster, R. W., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1810

Will the last DO turn off the lights?
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1811

Survey on the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, J. R., Weidner, A. C.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1812

Let the beauty of the marketplace benefit healthcare
Bliss, G.
The Journal of the American Osteopathic Association, 2006/04
Free full text

1813

Whole person medicine: a definition articulated osteopathically
Rosen, M. E.
The Journal of the American Osteopathic Association, 2006/04
Free full text

1814

Altern und Osteopathie: Die Rolle von Beweisen
(Aging and Osteopathy: The Role of Evidence)
McGovern, R. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

1815

Credit where credit's due: forebears of the Osteopathic Research Center
Goldsmith, D. M.
The Journal of the American Osteopathic Association, 2006/04

1816

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text

1817

Center or periphery? The future of osteopathic principles and practices
Gevitz, N.
The Journal of the American Osteopathic Association, 2006/03
Free full text

1818

What If? Thomas L. Northup Lecture, 2005
Dowling, D. J.
The AAO Journal, 2006/03
Free full text

1819

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text

1820

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1821

Osteopathic medical education in 2006: charting a course for the future
Shannon, S. C.
The Journal of the American Osteopathic Association, 2006/02
Free full text


1823

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1824

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1825

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1826

Computer animation and improved student comprehension of basic science concepts
Thatcher, J. D.
The Journal of the American Osteopathic Association, 2006/01
Free full text

1827

Plans for new conjoint certificate of added qualifications in hospice and palliative medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2006/01


1829

Navigation in neurologic localization: web site launch
Hoegerl, C.
The Journal of the American Osteopathic Association, 2006/01
Free full text

1830

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12


1832


1833

Dynamic duo: Maine-Dartmouth Family Practice Residency program and University of New England College of Osteopathic Medicine
Perakis, C.
The Journal of the American Osteopathic Association, 2005/11
Free full text

1834

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text


1836

Surprised by surgery statistics
Kattner, K. A.
The Journal of the American Osteopathic Association, 2005/10
Free full text


1838

Missed opportunity for osteopathic medical education
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

1839

The “Big DO“
Werrell, B. H.
The Journal of the American Osteopathic Association, 2005/10
Free full text

1840

Jumping through hoops for osteopathic internships
Snyder, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

1841

Graduate medical education: accuracy of AOA's annual data-reporting mechanisms questioned
Cummings, M.
The Journal of the American Osteopathic Association, 2005/10
Free full text


1843

Teacher, heal thyself
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/09

1844

Evidence base presented--and expanding--for investment in tobacco dependence curricula for osteopathic medical education
Montalto, N. J., Priester, T. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1845

Loyalty to the profession, not the AOA: evidence base necessary for member support of association policies
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1846

Attention applicants: please submit emotional intelligence scores
Sefcik, D. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1847

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text


1849

The short term effect of atlanto-axial high velocity low amplitude manipulation with cavitation on Edge Light Pupil Cycle Time
Gosling, C. M. R., Kinross, T., Gibbons, P., Holmes, M.
International Journal of Osteopathic Medicine, 2005/09

1850

Osteopathy in the cranial field – moving towards evidence for causality and effectiveness
Moran, R. W.
International Journal of Osteopathic Medicine, 2005/09

1851

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text

1852

Medical students' perceptions of medical education research and their roles as participants
Forester, J. P., McWhorter, D. L.
Academic Medicine, 2005/08
Free full text

1853

CV4 technique as a tool to decrease psychological stress in osteopathic medical students
Shah, A., Donaldson, N., Campomanes, C., Barragan, H., Menini, T., Binkerd, J.
The Journal of the American Osteopathic Association, 2005/07

1854

Dreigliedrige Osteopathie
(Triune osteopathy)
Pöttner, M., Hartmann, C.
Osteopathische Medizin, 2005/07

1855

The Impact of Osteopathic Manipulative Treatment on Future Osteopathic Physicians
Williams, J., Howell, J. P.
The Journal of the American Osteopathic Association, 2005/07

1856

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text

1857

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text

1858

Psychosocial factors in osteopathic practice: To what extent should they be assessed?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/06

1859

Promoting active engagement with osteopathic principles and practice in interns and residents
Cain, R. A.
The Journal of the American Osteopathic Association, 2005/05
Free full text

1860

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text

1861

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text

1862

Outpatient Osteopathic SOAP Note Form: preliminary results in osteopathic outcomes-based research
Sleszynski, S. L., Glonek, T.
The Journal of the American Osteopathic Association, 2005/04
Free full text

1863

Kudos on electronic-only COMLEX-USA
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1864

Same as it ever was
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1865

“Hardship exception“ is necessary
Zawadzki, E.
The Journal of the American Osteopathic Association, 2005/03

1866

Osteopathic medical training revisited: developing tomorrow's physicians
Innes, K.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1867

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03

1868

Chairman of COPT concludes debate on “hardship exception“
Opipari, M. I.
The Journal of the American Osteopathic Association, 2005/02
Free full text

1869

The biodynamic model of osteopathy in the cranial field
McPartland, J. M., Skinner, E.
Explore (NY), 2005/01

1870

Rebuttal regarding the “hardship exception“
Steier, K. J.
The Journal of the American Osteopathic Association, 2005/01



1873

Osteopathie und Chiropraktik
(Osteopathy and chiropractic)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

1874

Don’t Raise Your Hand – Put it on the Patient
Dowling, D. J.
The AAO Journal, 2004/12
Free full text


1876

Osteopathic medical training: developing the seasoned osteopathic physician
Clark, R. C.
The Journal of the American Osteopathic Association, 2004/11

1877

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text

1878

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text


1880

The elephant in the room: does OMT have proved benefit?
Bledsoe, B. E.
The Journal of the American Osteopathic Association, 2004/10
Free full text

1881

DO outlines steps to malpractice reform
Michaud, R. G.
The Journal of the American Osteopathic Association, 2004/10
Free full text


1883

DO notes difference between residency programs
Hornbeck, K. L.
The Journal of the American Osteopathic Association, 2004/09
Free full text

1884

A review of King HH and Lay EM, “Osteopathy in the Cranial Field,“ in Foundations for Osteopathic Medicine, 2nd ed
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2004/09



1887

Interview: Jane Stark
(An interview with Jane Stark)
Stark, J.
Osteopathische Medizin, 2004/08


1889

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text

1890

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text

1891

Tobacco dependence curricula in undergraduate osteopathic medical education
Montalto, N. J., Ferry, L. H., Stanhiser, T.
The Journal of the American Osteopathic Association, 2004/08
Free full text

1892

Conclusion of frequently used unsupported by data
Smith, R. M.
The Journal of the American Osteopathic Association, 2004/08
Free full text

1893

In opposition to Resolution 42
Steier, K. J.
The Journal of the American Osteopathic Association, 2004/08
Free full text

1894

Yes, Dr Still, an MD won the 2004 Northup Writing Award!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/07
Free full text


1896

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text

1897

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text

1898

Evaluating the rationale of the osteopathic internship
Smith, A. B.
The Journal of the American Osteopathic Association, 2004/06
Free full text


1900

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text


1902

A divisional approach to enhancing research among osteopathic family practice residents
Smith-Barbaro, P., Fulda, K. G., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2004/04
Free full text

1903

Osteopathic emergency medicine
Anderson, G. V.
Annals of Emergency Medicine, 2004/03
Free full text

1904

Energy medicine: an osteopath's personal view
Handoll, N.
The Journal of Alternative and Complementary Medicine, 2004/03

1905

Status of complementary and alternative medicine in the osteopathic medical school curriculum
Saxon, D. W., Tunnicliff, G., Brokaw, J. J., Raess, B. U.
The Journal of the American Osteopathic Association, 2004/03
Free full text

1906

Interdisciplinary approach to teaching medication adherence to pharmacy and osteopathic medical students
Singla, D. L., MacKinnon, G. E., 3rd, MacKinnon, K. J., Younis, W., Field
The Journal of the American Osteopathic Association, 2004/03
Free full text


1908

Strength in collaboration
Quinn, A.
The Journal of the American Osteopathic Association, 2004/02
Free full text

1909

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text

1910

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text

1911



1913




1916

Inter-examiner and intra-examiner reliability of the seated flexion test
O'Keefe, P.
Unpublished MSc thesis, 2004/01
Free full text

1917

Osteopathic emergency physician training and use of osteopathic manipulative treatment
Ray, A. M., Cohen, J. E., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text


1919

Bedside cardiology skills training for the osteopathic internist using simulation technology
Issenberg, S. B., Gordon, M. S., Greber, A. A.
The Journal of the American Osteopathic Association, 2003/12
Free full text

1920

Support needed for clinical faculty in osteopathic emergency medicine residencies
Minor, S. K., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2003/12
Free full text


1922

Relations between academic performance by medical students and COMLEX-USA Level 2: a multisite analysis
Evans, P., Goodson, L. B., Schoffman, S. I., Baker, H. H.
The Journal of the American Osteopathic Association, 2003/11
Free full text

1923

Correlation between prior exercise and present health and fitness status of entering medical students
Peterson, D. F., Degenhardt, B. F., Smith, C. M.
The Journal of the American Osteopathic Association, 2003/11
Free full text

1924

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text


1926

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text

1927

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10

1928

A prospective study of osteopathic medical students' attitudes toward use of osteopathic manipulative treatment in caring for patients
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2003/10
Free full text

1929

Characteristics of the courses that best predict COMLEX-USA level 1 performance
Sefcik, D. J., Prozialeck, W. C., O'Hare, T. H.
The Journal of the American Osteopathic Association, 2003/10
Free full text

1930

Editorial
Moran, R., Lucas, N.
Journal of Osteopathic Medicine, 2003/10
Free full text

1931

Productivity outcomes for recent grants and fellowships awarded by the American Osteopathic Association Bureau of Research
Rose, R. C., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2003/09
Free full text

1932

Development of the Attitudes Toward Osteopathic Principles and Practice Scale (ATOPPS): preliminary results
Russo, D. P., Stoll, S. T., Shores, J. H.
The Journal of the American Osteopathic Association, 2003/09
Free full text

1933

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text

1934

Osteopathic and Allopathic Family Practice Residents' Attitudes Toward OMT/OPP
Allee, B. A., Pollak, M. H., Malnar, K. F., Elfrink, L. D., Mulkey, L. E.
Journal of Osteopathic Medicine, 2003/08

1935

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text

1936

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text

1937

Predictive validity of osteopathic medical licensing examinations for osteopathic medical knowledge measured by graduate written examinations
Cavalieri, T. A., Shen, L., Slick, G. L.
The Journal of the American Osteopathic Association, 2003/07
Free full text

1938

Osteopathic graduate medical education opportunities abound in south Florida
Pinto, M. G.
The Journal of the American Osteopathic Association, 2003/07
Free full text

1939

Emergency medicine resident work productivity and procedural accomplishment
Deveau, J. P., Lorenz, J. E., Hughes, M. J.
The Journal of the American Osteopathic Association, 2003/06
Free full text

1940

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text


1942

Regarding the editorial on tobaccoism
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/04

1943

Thanks for professional support
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2003/04

1944

Time to forge affiliations between osteopathic medical schools and hospitals
Belsky, D. H.
The Journal of the American Osteopathic Association, 2003/03
Free full text

1945

Tobaccoism revisited
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/03
Free full text

1946

Failure to convince osteopathic medical students of OMT's worth increases risk of subspecialization
Corbett, R. M.
The Journal of the American Osteopathic Association, 2003/02
Free full text

1947

Benefits of osteopathic schools
Blackstone, E. A.
Health Affairs, 2003/01

1948

Results of a survey of inaugural class graduates of a college of osteopathic medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2003/01
Free full text




1952

Clinical thinking: does your choice of university make a difference?
Harris, M.
Unpublished MSc thesis, 2003/01
Free full text


1954

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text

1955

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01

1956


1957

Reasons for student debt during medical education: a Michigan study
Zonia, S. C., Stommel, M., Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 2002/12
Free full text

1958

Improving the oral health knowledge of osteopathic medical students
Skelton, J., Smith, T. A., Betz, W. T., Heaton, L. J., Lillich, T. T.
Journal of Dental Education, 2002/11

1959

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1960

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1961

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11

1962

Selection criteria for applicants in primary care osteopathic graduate medical education
Bates, B. P.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1963

State of the art in standardized patient programs: a survey of osteopathic medical schools
Errichetti, A. M., Gimpel, J. R., Boulet, J. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text


1965

Institutional impact of a part-time faculty development fellowship program for osteopathic community-based physicians
Pinheiro, S. O., Liechty, D. K., Busch, K. V., Johnson, E. S., Dora, D. L., Butler, R. M.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1966

Training family medicine residents for assessment and advocacy of older adults
Robbins, M. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1967

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1968

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1969

Working less, training harder
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2002/10
Free full text

1970

Research Interests and Motivations Among Osteopathic Medical Students: Results of a Pre-Clinical Student Survey
Licciardone, J. C., Fulda, K., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/09

1971

Re: Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
McGovern, J. J., McGovern, R. J., Lemley, W. W.
The AAO Journal, 2002/09
Free full text

1972

Students', Interns' and Residents' Comfort and Confidence With Their OMT Skills
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2002/09

1973

Establishment of a Research Culture in an Osteopathic Family Medicine Department: Results of a Three-Year Project
Smith-Barbaro, P., Knisley, C., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2002/09

1974

Student performance on the Comprehensive Osteopathic Medical Licensing Examination-USA level 2 following a clinical evaluation, feedback, and intervention program
Agostini, D. E., Stano, A. S., Parente, D. H.
The Journal of the American Osteopathic Association, 2002/09
Free full text

1975

Differences in the Evaluation and Treatment of Neck and Back Pain among Osteopathic and Allopathic Family Physicians
Pedersen, B., Guillory, V. J., Lynch, J. K.
The Journal of the American Osteopathic Association, 2002/08

1976

The anatomy professor that ate New York: some dinosaurs are teachers, and some teach about dinosaurs
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2002/08
Free full text

1977

Rating interest in clinical research among osteopathic medical students
Licciardone, J. C., Fulda, K. G., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/08
Free full text


1979

Resources in bioethics at osteopathic medical schools
Peppin, J., Leeper, K., Garloff, D.
Academic Medicine, 2002/05
Free full text

1980

Can we afford to lose another osteopathic teaching facility?
Dickason, R. H.
The Journal of the American Osteopathic Association, 2002/05
Free full text

1981

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text

1982

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text

1983

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04


1985

Editorial
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2002/04

1986

Osteopathy: A Noun Not Just An Adjective
Habenicht, A. L.
The AAO Journal, 2002/03
Free full text

1987

Osteopathic philosophy must be the foundation of osteopathic medical education
Beals-Becker, L.
The Journal of the American Osteopathic Association, 2002/03
Free full text

1988

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text

1989

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02

1990

Proposed tenets of osteopathic medicine and principles for patient care
Rogers, F. J., D'Alonzo, G. E., Jr., Glover, J. C., Korr, I. M., Osborn, G. G., Patterson, M. M., Seffinger, M. A., Taylor, T. E., Willard
The Journal of the American Osteopathic Association, 2002/02
Free full text

1991

Interexaminer reliability and cranial osteopathy
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2002/01

1992

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text

1993

An alert regarding Canada's financial aid for an osteopathic medical education
Campbell, A.
The Journal of the American Osteopathic Association, 2002/01
Free full text

1994

End-of-life care focus critical to a complete medical education
Gaber, R.
The Journal of the American Osteopathic Association, 2002/01
Free full text

1995

Identifying competencies for effective osteopathic physicians in the 21st century
Walrod, S.
Unpublished PhD thesis, 2002/01
Free full text

1996

Osteopathic approach may be helpful in war on terrorism
Rogers, F. J.
The Journal of the American Osteopathic Association, 2002/01
Free full text

1997

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text


1999

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text

2000

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text

2001

Is there any osteopathy in the specialty training of osteopathic residents?
Glover, J. C.
The AAO Journal, 2001/12
Free full text

2002

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text


2004

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text



2007

Guide OPTI development beyond organizational differences
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

2008

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

2009

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

2010

A Fact: The Medical Industry Doesn't Support Hands-On CME!
Noone, S. J.
The AAO Journal, 2001/12
Free full text

2011

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

2012

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text

2013

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text

2014

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text

2015

Examining diagnostic tests: An evidence-based perspective
Fritz, J., Wainner, R.
Journal of Osteopathic Medicine, 2001/10


2017

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09

2018

Marketing lessons and retaining the traditional osteopathic internship
Broder, D. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2019

Knowing more than the score: providing sideline medical care coverage for athletic competition
Brolinson, G., Cibor, G. M.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2020

Development of the Attitudes Toward Osteopathic Principles and Practices Scale (ATOPPS): Preliminary Results of a Pilot Project
Russo, D. P., Stoll, S. T., Shores, J.
The Journal of the American Osteopathic Association, 2001/09

2021

Elbow injuries in golf
Stockard, A. R.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2022

The DO May issue bridges medical philosophies
Steigman, C. K.
The Journal of the American Osteopathic Association, 2001/08
Free full text

2023

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text

2024

Osteopathic medical schools should foster sense of identity
Fogel, R. M.
The Journal of the American Osteopathic Association, 2001/06
Free full text

2025

Signifying what?
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

2026

Sixty-five pieces of silver
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

2027

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2028

President Bush's 2002 budget proposal would hamper geriatric education
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2029

A systematic review of workplace interventions to prevent low back pain
Maher, C. G.
Journal of Osteopathic Medicine, 2001/04

2030

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text

2031

Balanced on a tight rope between low back pain and evidence-based practice
Shacklock, M.
Journal of Osteopathic Medicine, 2001/04

2032

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text


2034

Researched and demonstrated: inquiry and infrastructure at osteopathic institutions
Gevitz, N.
The Journal of the American Osteopathic Association, 2001/03
Free full text

2035

Going global with osteopathic medicine
Smith, D. A.
The Journal of the American Osteopathic Association, 2001/03
Free full text

2036

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text

2037

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text

2038

Testing osteopathic medical school graduates for licensure: is COMLEX-USA the most appropriate examination?
Graneto, J.
The Journal of the American Osteopathic Association, 2001/01
Free full text

2039

Collaboration between pharmacy and osteopathic medicine to teach via the Internet
Sweeney, M. A., Schuster, M. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2040

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2041

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2042

The venous side: current directions in anticoagulant therapy
Kaatz, S.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2043

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2044

A fresh look at osteopathic medical education in 2000
Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2000/11

2045

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2046

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2047

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text


2049

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2050

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2051

An examination of the status of osteopathic medicine from 1960 to 2000
Steinberg, S. H.
Unpublished PhD thesis, 2000/10

2052

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2053

Use of a computer-assisted clinical case (CACC) SOAP note exercise to assess students' application of osteopathic principles and practice
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2054

Rural osteopathic family physician supply: past and present
Tooke-Rawlins, D.
The Journal of Rural Health, 2000/06

2055

Survey of medical ethics in US medical schools: a descriptive study
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2056

Letters to the Editor
Cummings, C. H., Norton, J. M., Nelson, K. E.
The AAO Journal, 2000/06
Free full text

2057

Osteopathic success in the treatment of influenza and pneumonia. 1919
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/05
Free full text

2058

Relationship between academic achievement and COMLEX-USA Level 1 performance: a multisite study
Baker, H. H., Foster, R. W., Bates, B. P., Cope, M. K., McWilliams, T. E., Musser, A., Yens, D.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2059

Unity may preserve osteopathic ideals
Adair, A. D.
The Journal of the American Osteopathic Association, 2000/03
Free full text

2060

Relationship of preadmission variables and first- and second-year course performance to performance on the National Board of Osteopathic Medical Examiners' COMLEX-USA Level 1 examination
Baker, H. H., Cope, M. K., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2000/03
Free full text


2062

Meaning and Mechanism in Osteopathy
Nanke, L. G. M.
Unpublished PhD thesis, 2000/01
Free full text

2063

Take the time to teach to ensure the legacy and future of our profession
Steier, K. J.
Journal of Osteopathic Medicine, 1999/12
Free full text

2064

Comparison of osteopathic and allopathic medical schools' support for primary care
Peters, A. S., Clark-Chiarelli, N., Block, S. D.
Journal of General Internal Medicine, 1999/12

2065

A new challenge: Replacing opinion-based with evidence-based decisions
Heath, D. M., Kelso, A. F.
The AAO Journal, 1999/12
Free full text

2066

Importance of OMT cannot be overemphasized
Abend, D. S.
Journal of Osteopathic Medicine, 1999/12
Free full text


2068

An overview of osteopathic medicine
Lesho, E. P.
Archives of Family Medicine, 1999/11

2069

Osteopathic unity must continue
Ross, K. E.
Journal of Osteopathic Medicine, 1999/10
Free full text

2070

Health services research: Evidence-based medicine and the AAO five-year strategy
Kelso, A. F., Heath, D. M.
The AAO Journal, 1999/09
Free full text

2071

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text


2073

Professional identification and affiliation of the 1992 graduate class of the colleges of osteopathic medicine
Aguwa, M. I., Liechty, D. K.
Journal of Osteopathic Medicine, 1999/08
Free full text

2074

Osteopathic family physicians' attitudes, knowledge, and self-reported practices regarding obesity
Harris, J. E., Hamaday, V., Mochan, E.
Journal of Osteopathic Medicine, 1999/07
Free full text

2075

Training osteopathic geriatric academicians: impact of a model geriatric residency program
Cavalieri, T. A., Basehore, P., Perweiler, E., Chopra, A.
Journal of Osteopathic Medicine, 1999/07
Free full text

2076

OMM beyond the classroom – The Future is now
Veneziano, M.
The AAO Journal, 1999/06
Free full text

2077

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text

2078


2079

Visualization technology in medical education
Gorbis, S., Hallgren, R. C.
Journal of Osteopathic Medicine, 1999/04
Free full text

2080

Call to develop and implement dually approved residency programs
Daftarian, H.
Journal of Osteopathic Medicine, 1999/04
Free full text

2081

1998 Louisa Burns Memorial Lecture: can teaching and research coexist?
Yorio, T.
Journal of Osteopathic Medicine, 1999/03
Free full text

2082

Chiropractic and osteopathic education at Royal Melbourne Institute of Technology. A student perspective
French, S. D., Marshall, S. J., Webb, M., Tucker, C.
Australasian Chiropractic & Osteopathy, 1999/03
Free full text

2083

Making a difference: the osteopathic approach lecture series
Danto, J. B., Kavieff, T. R.
Journal of Osteopathic Medicine, 1999/03
Free full text

2084

Seize opportunity to foster osteopathic pride
Bahrami, P.
Journal of Osteopathic Medicine, 1999/03
Free full text


2086

Time to tell the world about osteopathic medicine
Oliveri, E. A., Osborn, G. C.
Journal of Osteopathic Medicine, 1999/02
Free full text


2088

An international study of osteopathic practice
Cameron, M.
Unpublished MSc thesis, 1999/01
Free full text

2089

Comparison of the scope of allopathic and osteopathic medical school health promotion programs for students
Hooper, J., Cox, C. C., Cambre, K., Wilburn, D., Webster, M., Wolf, T.
American Journal of Health Promotion, 1999/01


2091

Student Movement of the Medicine/Public Health Initiative promotes nationwide preventive healthcare approach
Cardarelli, R., Pierce, T.
Journal of Osteopathic Medicine, 1998/12
Free full text

2092

The meaning of natural medicine: an interpretive study
Di Stefano, V.
Unpublished MSc thesis, 1998/12
Free full text

2093

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text

2094

Osteopathic medical education in 1998 prepares for the future
Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text

2095




2098

Osteopathic medical school applicants not allopathic medical school 'rejects'
Kasovac, M.
Journal of Osteopathic Medicine, 1998/10
Free full text

2099

Correction to 'professional identity' article
Tettambel, M. A.
Journal of Osteopathic Medicine, 1998/09
Free full text

2100

Key to our survival lies in honesty
Olson, C. D.
Journal of Osteopathic Medicine, 1998/09
Free full text

2101

L'ostéopathie et la chiropraxie.
(Osteopathy and chiropractic)
Klein, P.
Revue médicale de Bruxelles, 1998/09

2102

Alternative therapies and complementary medicine: a mutiny in the making
Friedman, H. D.
Journal of Osteopathic Medicine, 1998/09
Free full text

2103

An 'apples-to-apples' comparison of training hours for DOs, PAs, NPs
Truthan, C. E.
Journal of Osteopathic Medicine, 1998/08
Free full text

2104

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text


2106


2107

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05


2109

Partners for two decades: AOA and the National High Blood Pressure Education Program
Nickey, W. A., Lenfant, C.
Journal of Osteopathic Medicine, 1998/03


2111

The medical school curriculum for the 21st century
Wood, D. L., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/02

2112

Re-examining the number of osteopathic residency programs
Baker, H. H.
Journal of Osteopathic Medicine, 1998/02

2113

Osteopathic versus allopathic care
Wakham, M.
Hospital Practice, 1998/01

2114

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01

2115

Pain: a functional disorder
Ernst, E.
British Journal of General Practice, 1997/12
Free full text

2116

Leading the pace of change: crisis or opportunity?
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/12
Free full text

2117

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text

2118

Anatomy of an OPTI dissected: structure, function, and the impact of budget reconciliation legislation
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/11
Free full text

2119

A snapshot of osteopathic medical education in 1997
Retz, K. C.
Journal of Osteopathic Medicine, 1997/11
Free full text

2120

Forecast for osteopathic medical education programs in the for-profit hospital environs
Spink, G. C.
Journal of Osteopathic Medicine, 1997/11
Free full text

2121

Anatomy of an OPTI: Part I. Form, function, and relationships
Meyer, C. T., Mann, M. P., Riley, C., Portanova, R.
Journal of Osteopathic Medicine, 1997/10
Free full text

2122

Osteopathic manipulative treatment: Practice use and and opinions of the Texas College of Osteopathic Medicine alumni
Gamber, R. G., Kennedy, D. A., Erickson, R. C., Moss, J. A., McKay Hart, C., Zengerle, C., Stone, R. C., Gish, E. E.
The AAO Journal, 1997/09
Free full text

2123

Pondering the effects of the Reconciliation Budget law on osteopathic medical education
Wood, D. L.
Journal of Osteopathic Medicine, 1997/09
Free full text

2124

A challenge to the profession: initiate evidence-based osteopathic medicine now
Goldstein, M.
Journal of Osteopathic Medicine, 1997/08
Free full text

2125

An osteopathic prescription for medical education reform: Part 2. Specialty mix and community integration
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/08
Free full text

2126

An osteopathic prescription for medical education reform: Part 1. Curriculum and infrastructure
Ross-Lee, B., Wood, D. L., Mann, D. D., Portanova, R. P., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/07
Free full text


2128

Osteopathic manifesto. VI. The light of the profession. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/06
Free full text

2129

Comparing medical knowledge of osteopathic medical trainees in DO and MD programs: a random effect meta-analysis
Shen, L., Cavalieri, T., Clearfield, M., Smoley, J.
Journal of Osteopathic Medicine, 1997/06
Free full text


2131

Comparison of entrance requirements for health care professions
Doxey, T. T., Phillips, R. B.
Journal of Manipulative and Physiological Therapeutics, 1997/02

2132

Variables influencing the use of osteopathic manipulative treatment in family practice
Johnson, S. M., Kurtz, M. E., Kurtz, J. C.
Journal of Osteopathic Medicine, 1997/02
Free full text

2133

Osteopathic manipulative treatment: student attitudes before and after intensive clinical exposure
Magnus, W. W., Gamber, R. G.
Journal of Osteopathic Medicine, 1997/02
Free full text

2134

A national study of factors influencing the career choice of osteopathic and allopathic family physicians
Xu, G., Cummings, M., Veloski, J. J., Brose, J.
The Journal of the American Osteopathic Association, 1996/12
Free full text

2135

AOA continuing medical education
MacPherson, S. B., Rodgers, D. J.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2136

Osteopathic graduate medical education
Bronersky, V. M., Falbo, P. W.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2137

Geriatric education in osteopathic medical schools
Carlsen, W., Pfeiffer, B., Marx, T., Bonyo, B.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2138

Osteopathic medical education at the bridge to the 21st century
Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2139

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2140

In pursuit of generalism: basic factors influencing the specialty decisions of osteopathic medical school seniors in 1995
Singer, A. M.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2141

Research programs of the AOA and their role in osteopathic medical education
Retz, K. C., McGill, S. L.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2142

Income and expenditures of osteopathic medical colleges
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2143

Undergraduate osteopathic medical education
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2144

Osteopathic medical education: the introduction of managed care principles into our undergraduate curriculum
Musser, A. E., Vinn, N.
The Journal of the American Osteopathic Association, 1996/10
Free full text

2145

Standardization of the hospital record for osteopathic structural examination: Part 2. Effects of an educational intervention on documentation of palpatory and structural findings and diagnosis
Friedman, H. D., Johnston, W. L., Kelso, A. F., Schwartz, F. N., Beal, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 1996/09
Free full text

2146

Results of the 1996 National Resident Matching Program: family practice
Kahn, N. B., Jr., Garner, J. G., Schmittling, G. T., Ostergaard, D. J., Graham
Family Medicine, 1996/09

2147

Transforming osteopathic medical education
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/08
Free full text

2148

Osteopathic manipulative treatment applications for the emergency department patient
Paul, F. A., Buser, B. R.
The Journal of the American Osteopathic Association, 1996/07
Free full text

2149

Ambulatory care training standards for continuity of care in osteopathic family medicine
Winters, F. D., Zonia, S., Cook, J. N., Dora, D. L., Meyer, C. T.
The Journal of the American Osteopathic Association, 1996/04
Free full text

2150

Curriculum goals for the training of osteopathic family practice residents for the year 2000
Dickerman, J., Rich, P.
The Journal of the American Osteopathic Association, 1996/03
Free full text

2151

Marketing key to increased women applicants to COMs
Payson, S. M.
The Journal of the American Osteopathic Association, 1996/01
Free full text

2152

(Manual therapy, chiropractic, osteopathy. From alternative therapy to medicine)
Ylinen, J., Piispanen, J., Silen, K., Airaksinen, O.
Duodecim, 1996/01

2153

Osteopathic GME consortia
Meyer, C. T., Mann, M. P.
Academic Medicine, 1995/11

2154

Osteopathic postdoctoral training institution: the osteopathic 'road map' to graduate medical education viability
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/11
Free full text

2155

Synergism strengthens osteopathic medical education programs
Allen, T. W.
Journal of Osteopathic Medicine, 1995/10
Free full text

2156

Female enrollment in colleges of osteopathic medicine: five years and five percentage points behind
Baker, H. H.
The Journal of the American Osteopathic Association, 1995/10
Free full text

2157

OMM Residency Training and Certification
Ettlinger, H., Pelkey, Z.
The AAO Journal, 1995/09
Free full text

2158

Osteopathic graduate medical education programs must be maintained
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/09
Free full text

2159

10,000 apply to osteopathic schools
Japsen, B.
Modern Healthcare, 1995/06

2160

Osteopathic graduate medical education: don't give up the ship--yet!
Meyer, C. T.
Journal of Osteopathic Medicine, 1995/06
Free full text

2161

A standardized form for DSM-IV review of symptoms and mental status examination for students and residents
Reeves, R. R., Bullen, J. A.
The Journal of the American Osteopathic Association, 1995/06
Free full text

2162

Performance of osteopathic medical school graduates on the American Osteopathic Board of Internal Medicine certifying examinations 1985 to 1994
Slick, G. L., Dolan, S., Draba, R. E.
The Journal of the American Osteopathic Association, 1995/06
Free full text

2163

The Experimental Method of Learning
Young, M. D.
The AAO Journal, 1995/06

2164

Making sense of federal GME reforms: the need for secondary reforms
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/05
Free full text

2165

Emphasizing a preventive medicine orientation during primary care/family practice residency training
Inwald, S. A., Winters, F. D.
The Journal of the American Osteopathic Association, 1995/04
Free full text

2166

Making sense of federal GME reforms: the impact on osteopathic medicine
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/04
Free full text

2167

Time to abolish most osteopathic graduate medical education programs
Kienitz, R.
The Journal of the American Osteopathic Association, 1995/03
Free full text

2168

Challenges and opportunities in occupational medicine
McCunney, R. J.
The Journal of the American Osteopathic Association, 1995/02
Free full text

2169

A model for improving generalist physician output: the osteopathic experience
Cummings, M., Ennis, M.
Academic Medicine, 1995/01
Free full text


2171

DOs who train in allopathic residency programs not 'disloyal'
Wogec, J.
The Journal of the American Osteopathic Association, 1994/12
Free full text

2172

A perspective from osteopathic medical schools
Arnstein, S. R., Haspel, L. U.
The Milbank Quarterly, 1994/12
Free full text

2173

Healthcare reform and practice choices: a survey of osteopathic medical students
Shubrook, J. H., Jr., Solomon, J. A., Ross-Lee
The Journal of the American Osteopathic Association, 1994/11
Free full text

2174

Osteopathic medical education adapts to a changing environment
Ward, W. D.
The Journal of the American Osteopathic Association, 1994/11
Free full text

2175

The danger of complacency
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/11
Free full text

2176

Colleges of Osteopathic Medicine
The Journal of the American Osteopathic Association, 1994/11
Free full text

2177

Membership of AOA Committees on Osteopathic Medical Education 1994-1995
The Journal of the American Osteopathic Association, 1994/11
Free full text

2178

Overview of financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1994/11
Free full text


2180


2181

Results of the 1994 National Resident Matching Program: family practice
Kahn, N. B., Jr., Schmittling, G., Ostergaard, D. J., Graham
Family Medicine, 1994/09

2182

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text

2183

Effect of clerkship training at rural sites on students' clinical skills
Brandau, D., Heun, L.
Academic Medicine, 1994/08
Free full text

2184

The in-training examination in internal medicine
Garibaldi, R. A., Trontell, M. C., Waxman, H., Holbrook, J. H., Kanya, D. T., Khoshbin, S., Thompson, J., Casey, M., Subhiyah, R. G., Davidoff, F.
Annals of Internal Medicine, 1994/07

2185

Managed care and graduate medical education: mutual objectives, barriers, and prospects
Natkow, N., Fry, L. J.
The Journal of the American Osteopathic Association, 1994/07
Free full text

2186

Complexity of the healthcare crisis in rural America
Simpson, C., Simpson, M. A.
The Journal of the American Osteopathic Association, 1994/06
Free full text

2187

Specialty-oriented internships
Opipari, M. I.
The Journal of the American Osteopathic Association, 1994/06
Free full text

2188

Performance-based assessment of moral reasoning and ethical judgment among medical students
Smith, S. R., Balint, J. A., Krause, K. C., Moore-West, M., Viles, P. H.
Academic Medicine, 1994/05
Free full text

2189

More suggested changes to osteopathic medical curriculum
Clark, R. C.
The Journal of the American Osteopathic Association, 1994/05
Free full text

2190

'Parallel and distinctive': the philosophic pathway for reform in osteopathic medical education
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/04
Free full text

2191

Dark period in history of osteopathic medicine revisited
Frymann, V. M.
The Journal of the American Osteopathic Association, 1994/04
Free full text

2192

Preparing the osteopathic academic health centers for healthcare reform
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/04
Free full text

2193

Performance of candidates on the American Osteopathic Board of Internal Medicine subspecialty certifying examinations 1984-1992
Slick, G. L.
The Journal of the American Osteopathic Association, 1994/03
Free full text

2194

Revamp primary care programs to include psychiatry training
Magen, J. G.
The Journal of the American Osteopathic Association, 1994/03
Free full text

2195

Clarifying number of DOs in allopathic residency programs
Sprafka, S.
The Journal of the American Osteopathic Association, 1994/01
Free full text

2196

A strategy for the future success of osteopathic medicine
Wax, C. M.
The Journal of the American Osteopathic Association, 1994/01
Free full text

2197

The primary medicine initiative--continuity in medical education
Wood, D. L.
The Journal of the American Osteopathic Association, 1994/01
Free full text

2198

Debate continues on the call to reform the profession
Terry, R. R., Comeaux, Z., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text

2199

Crafting effective internal memos
Baker, H. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text

2200

Response: Debate continues on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/12
Free full text

2201

Focused goals of osteopathic medical education achieve results
Ward, W. D.
The Journal of the American Osteopathic Association, 1993/11
Free full text

2202

No 'paradigm shift' needed at COMs
Richwine, W. B., Papa, F. J.
The Journal of the American Osteopathic Association, 1993/11
Free full text

2203

Important characteristics of a director of medical education
Powell, V. D., Jr., George
The Journal of the American Osteopathic Association, 1993/11
Free full text

2204

Financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1993/11
Free full text

2205

An MD's note to his osteopathic medical students
Friedlander, E. R.
The Journal of the American Osteopathic Association, 1993/10
Free full text

2206

Do medical students' knowledge and attitudes about health and exercise affect their physical fitness?
Liang, M. T., Dombrowski, H. T., Allen, T. W., Chang, C. O., Andriulli, J., Bastianelli, M., Davina, E., Norris, S. D.
The Journal of the American Osteopathic Association, 1993/10
Free full text

2207

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text

2208

Lifestyle changes associated with osteopathic medical education
Crapse, F. J., Jr., Hudgins, P. M., Baker
The Journal of the American Osteopathic Association, 1993/10
Free full text

2209

Promoting the health and fitness of osteopathic medical students
Licciardone, J. C.
The Journal of the American Osteopathic Association, 1993/10
Free full text

2210

More comments on the call to reform the profession
McPartland, J. M., Pulsipher, D. W., Cope, M. K., Wagenknecht, D. A.
The Journal of the American Osteopathic Association, 1993/10
Free full text

2211

Response: More comments on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/10
Free full text

2212

Primary care DOs, specialists--and OMM--important to profession
Wax, C. M.
The Journal of the American Osteopathic Association, 1993/09
Free full text

2213

On credentials and manpower in emergency medicine
Cummings, I. W.
Annals of Emergency Medicine, 1993/09

2214


2215

Teaching residents to write a research paper
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1993/09
Free full text

2216

Die vergessenen Gutachten über die Chiropraktik
(Forgotten expertise about chiropractic)
Geiser, M.
Schweizerische Rundschau für Medizin Praxis, 1993/08

2217

The HIV-infected house officer: residency training issues
Fernandez, E. S., Troutman, H. T., Herbert, B., Condoluci, D. V.
The Journal of the American Osteopathic Association, 1993/08
Free full text

2218

Readers offer suggestions for reforms in osteopathic medicine
Rosenblum, J.
The Journal of the American Osteopathic Association, 1993/08
Free full text

2219


2220

Another view of the “crisis“ in osteopathic medicine
Baker, H. H.
Academic Medicine, 1993/07
Free full text

2221

Type “O“ disorders
Walker, B. F.
COMSIG Review, 1993/07
Free full text

2222

Helping-not hurting--residents with substance use disorders
Sells, K. W., Gorby, W. G.
The Journal of the American Osteopathic Association, 1993/06
Free full text

2223

'Blueprint' for creating classroom facilities in teaching hospitals
Hayes, O. W.
The Journal of the American Osteopathic Association, 1993/06
Free full text


2225


2226

Research important to education--and society
Retz, K. C.
The Journal of the American Osteopathic Association, 1993/05
Free full text

2227

Arranging affiliation agreements and outside rotations
Willard, R. L.
The Journal of the American Osteopathic Association, 1993/04
Free full text

2228

Osteopathic medicine: a call for reform
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/04
Free full text


2230

Outcomes assessment: 'buzz words' in medical education whose time has come
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/03
Free full text

2231

Cancer control knowledge and priorities among primary care physicians
Brownson, R. C., Davis, J. R., Simms, S. G., Kern, T. G., Harmon, R. G.
Journal of Cancer Education, 1993/03

2232

Assessing outcomes of the educational program of the West Virginia School of Osteopathic Medicine
Cope, M. K., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text

2233

Procedures to follow when dismissing an intern or resident
Opipari, M., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text

2234

An approach to training and retaining primary care physicians in rural Appalachia
Roberts, A., Foster, R., Dennis, M., Davis, L., Wells, J., Bodemuller, M. F., Bailey, C. A.
Academic Medicine, 1993/02
Free full text

2235

Managing substance use disorders in resident physicians
Benzer, D. G.
The Journal of the American Osteopathic Association, 1993/02
Free full text

2236

Clinical teaching in the ambulatory care setting: how to capture the teachable moment
Bowling, J. R.
The Journal of the American Osteopathic Association, 1993/02
Free full text

2237

Integrate osteopathic principles and practices in postgraduate medical education--now
Kasovac, M., Jones, J. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text

2238

With a look at the past, osteopathic medical education heads into its second century
Ward, D.
The Journal of the American Osteopathic Association, 1992/11
Free full text

2239

Four approaches to using patients to teach and evaluate clinical skills of residents, interns, and students
Medio, F. J., Morewitz, S. J.
The Journal of the American Osteopathic Association, 1992/11
Free full text

2240

Voices From the Future: what students, interns, and residents want from osteopathic graduate medical training
Kushner, D., Cooney, J.
The Journal of the American Osteopathic Association, 1992/10
Free full text

2241

Heed 'Voices From the Future' and reform GME training
Meyer, C. T.
The Journal of the American Osteopathic Association, 1992/10
Free full text

2242

Teaching the process of obtaining informed consent to medical students
Johnson, S. M., Kurtz, M. E., Tomlinson, T., Fleck, L.
Academic Medicine, 1992/09

2243

Challenge to osteopathic education. Returning to its primary care roots
Cummings, M.
JAMA: The Journal of the American Medical Association, 1992/09

2244

Graduate medical education
JAMA: The Journal of the American Medical Association, 1992/09

2245

Reorganizing 'traditional' case presentation enhances learning, clinical experience
Russell, B., Penney, C. W.
The Journal of the American Osteopathic Association, 1992/08
Free full text

2246

Suggestions for clinicians providing--and residents seeking--feedback
Sprafka, S.
The Journal of the American Osteopathic Association, 1992/08
Free full text

2247

Is Osteopathic Education Ready For Its Next Century?
Corbett, S. R.
The AAO Journal, 1992/06
Free full text

2248

College of Podiatric Medicine and Surgery in Des Moines
Tomczak, R. L.
Journal of the American Podiatric Medical Association, 1992/06
Free full text

2249

Guidelines for designing resident rating forms
Gugelchuk, G. M., Daum, S. G.
The Journal of the American Osteopathic Association, 1992/06
Free full text

2250

Recruiting interns and residents to an osteopathic medical training program
Slick, G. L.
The Journal of the American Osteopathic Association, 1992/05
Free full text

2251

Training osteopathic medical students in behavioral medicine and psychiatry
Magen, J.
The Journal of the American Osteopathic Association, 1992/05
Free full text

2252

The medical education system in Oklahoma
Lapolla, M., Duffy, D., Lewis, C. S.
The Journal of the Oklahoma State Medical Association, 1992/03

2253

Case presentation as a teaching tool: making a good thing better
Brose, J. A.
The Journal of the American Osteopathic Association, 1992/03
Free full text

2254

The physical fitness of first-year osteopathic medical students
Licciardone, J. C., Hagan, R. D.
The Journal of the American Osteopathic Association, 1992/03
Free full text

2255

'Blueprint' for designing a curriculum for intern and residency programs
Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 1992/02
Free full text

2256

A curriculum database with boolean natural-language searching in HyperCard
Mann, D., Goodrum, K., DeWine, J. M., McVicker, J.
Proceedings Annual Symposium on Computer Application in Medical Care, 1992/01
Free full text

2257

Superlatives and concerns in osteopathic medical education
Baker, H. H.
The Journal of the American Osteopathic Association, 1991/11
Free full text

2258

Incorporating OMT in hospital training
Cooper, G. J.
The Journal of the American Osteopathic Association, 1991/11
Free full text


2260

US osteopathic medical school finances
Reich, M. M.
The Journal of the American Osteopathic Association, 1991/11
Free full text

2261

Who Will Hatch Our Students?
Morey, L.
The AAO Journal, 1991/09
Free full text

2262

Osteopathic vs. chiropractic education: a student perspective
McNamee, K. P., Magarian, K., Phillips, R. B., Greenman, P. E.
Journal of Manipulative and Physiological Therapeutics, 1991/09

2263

A proposal to modify research and scholarly activities during osteopathic residency training
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1991/09
Free full text

2264

Osteopathic interns' attitudes toward their education and training
Shlapentokh, V., O'Donnell, N., Grey, M. B.
The Journal of the American Osteopathic Association, 1991/08
Free full text

2265

Bias in medical education? Take my word for it!
Schulte, J.
Medical Economics, 1991/08

2266

Selected characteristics of graduate medical education in the United States
Rowley, B. D., Baldwin, D. C., Jr., McGuire
JAMA: The Journal of the American Medical Association, 1991/08

2267

Osteopathic medical educators should heed lesson from interns
Johnston, W. L.
The Journal of the American Osteopathic Association, 1991/08
Free full text

2268

Osteopathic principles and practices: maintaining a vital link in osteopathic education
Kappler, R. E.
The Journal of the American Osteopathic Association, 1991/07
Free full text

2269

Guide to clinical preventive services. Report of the US Preventive Services Task Force
Allen, T. W.
The Journal of the American Osteopathic Association, 1991/03
Free full text

2270

Who should teach osteopathic manipulative medicine?
Lo, K. S.
The Journal of the American Osteopathic Association, 1991/03
Free full text

2271

Evaluation of videodisc modules: a mixed method approach
Parkhurst, P. E., Lovell, K. L., Sprafka, S. A., Hodgins, M.
Proceedings Annual Symposium on Computer Application in Medical Care, 1991/02
Free full text


2273

Retain general practitioners' identity
McAffe, D. R.
The Journal of the American Osteopathic Association, 1990/12
Free full text


2275

Have we forgotten our osteopathic heritage?
Morey, L. W.
The Journal of the American Osteopathic Association, 1990/12
Free full text


2277

Osteopathic postdoctoral education
Baker, H. H., Wachtler, J.
The Journal of the American Osteopathic Association, 1990/11
Free full text

2278

Research programs of the AOA and their role in osteopathic education
Retz, K. C.
The Journal of the American Osteopathic Association, 1990/11
Free full text

2279

Practicing what we teach: integrating osteopathic principles into practice
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/10
Free full text

2280

Politics cloud state of osteopathic medical residency programs
Donovan, P. J.
The Journal of the American Osteopathic Association, 1990/10
Free full text

2281

Allopathic residencies: current and former residents' viewpoints
Baron, M., Karp, S. J., Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/09
Free full text

2282

Commenting on L-tryptophan and osteopathic physicians in allopathic residencies
Davis, F. E.
The Journal of the American Osteopathic Association, 1990/09
Free full text


2284

Development of an Expert System to Teach Diagnostic Skills
Elieson, S. W.
Unpublished PhD thesis, 1990/08
Free full text

2285

Louisa Burns memorial lecture: research in residencies
Belsky, D. H.
The Journal of the American Osteopathic Association, 1990/07
Free full text

2286

How effectively are osteopathic medical students coping with a stressful life-style?
Kurtz, M. E., Paulsen, R. D., Ferguson, D.
The Journal of the American Osteopathic Association, 1990/07
Free full text

2287

Factors influencing osteopathic physicians' decisions to enroll in allopathic residency programs
Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/06


2289

Quality assurance monitoring of osteopathic manipulative treatment
Koss, R. W.
The Journal of the American Osteopathic Association, 1990/05
Free full text

2290

The Century Club: a model for staff-supported medical education
Meyer, C. T.
The Journal of the American Osteopathic Association, 1990/05
Free full text

2291

The pull toward the vacuum: osteopathic medical education in the 1980s
Cummings, M.
The Journal of the American Osteopathic Association, 1990/04
Free full text

2292

A second opinion on geriatric training programs
Toffol, G. J., Schultz, D. R., Root, K. E., Weintraub, J. R.
The Journal of the American Osteopathic Association, 1990/03
Free full text

2293

General practice residency training and the osteopathic profession: trends and issues for the 1990s
Aquilina, A. D.
The Journal of the American Osteopathic Association, 1990/02
Free full text




2297

The orientations of medical students to osteopathic medicine
Aho, W. R.
Unpublished PhD thesis, 1970/01

 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends