Advanced search



 
 79.9% of the records
 
 20.1 % of the records
 
 57.8 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial swellingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxishair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodialysishemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrialstriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

889 results (please see below)  Sort:    

2

Effect of osteopathic technique on respiratory parameters and pain in thoracic outlet syndrome
Elshinnawy, A. M., Eraky, Z. S., Abdallah, E. A., Elmasry, H. M., El-Samouly, H. M.
Journal of Bodywork and Movement Therapies, 2026/06


4

The effectiveness of osteopathic treatment in cervical whiplash: a randomized controlled trial
Larios-Ortega, J., Díaz-Acuña, A. M., Colón-Fraile, M. T., Rivera-Sequeiros, A., Albornoz-Cabello, M., Ruiz-Romero, M. V.
Journal of Osteopathic Medicine, 2026/02
Free full text


6

Early osteopathic treatment delivered to patients with an acute lateral ankle sprain improves recovery: an investigative study
Bournon, C., Prin-Conti, D., Douay, J., Montfajon, P.A., Kanagaratnam, L., Gennai, S.
Journal of Osteopathic Medicine, 2026/01
Free full text

7

Osteopathic manipulative treatment for enhanced pitch performance in collegiate baseball players: a feasibility study on shoulder and hip interventions
Rosten, C., Brown, S., Nandedkar, T., Pearson, A., Worthington, E., Fastring, D.
Journal of Osteopathic Medicine, 2026/01
Free full text


9

Osteopathic manipulative treatment for management of feeding dysfunction in breastfed newborns
Fons, D., Watts, K. B., Vannitamby, H., Rainey, S., Ford-Davis, J., Wang, Y., Van Heukelom, S., Wright, A.
Journal of Osteopathic Medicine, 2025/12
Free full text


11

Hands-On Relief: A Pilot Study on the Use of Osteopathic Manipulative Treatment for Tension-Type Headaches
Santos, S. G., Lee, W., Doan, E., Rabiei, Y., Redding, D.
Journal of Osteopathic Medicine, 2025/12

12

Immediate Impact of Muscle Energy on Hamstring in Comparison to Static Stretching
Virno, T., Hart, J., Tomilonus, N., van Rensburg, C., Boesler, D.
Journal of Osteopathic Medicine, 2025/12

13

Immediate effects of three different upper trapezius trigger point techniques on pain intensity and pressure threshold in students with cervical pain: a randomized clinical trial
Todri, J., Lena, O., Vázquez-Villa, C., Martínez-Fuentes, J., Ciferri, A., Murcia-González, M. A.
International Journal of Osteopathic Medicine, 2025/12

14

Effectiveness of manual therapy vs conventional physical therapy with neuromuscular training in the management of knee osteoarthritis: A randomized clinical controlled trial
Pakkir Mohamed, S. H., Albalawi, H. F., Nambi, G., Shalabi, K. M., Albalawi, M. O.
International Journal of Osteopathic Medicine, 2025/12
Free full text







21

Evaluating the acute effect of osteopathic manipulative treatment on sprint performance in young adults
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., McKinlay, K. J., Roush, A. J., Cosgrave, C.
Journal of Osteopathic Medicine, 2025/10
Free full text

22

Impact of touch interventions on brain activity in moderately preterm infants: study protocol for a pilot randomised controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., Tansini, L., Pisanu, D., Di Leo, D., Vergani, E., Righini, A., Arrigoni, F., Fanos, V., Rescigno, M., Veggiotti, P., Lista, G., Gazzolo, D.
BMJ Open, 2025/10
Free full text

23

Visceral Osteopathy in Treating Refractory Irritable Bowel Syndrome: Results of a French National Multicentre Randomised Controlled Trial
Wuestenberghs, F., Sabate, J. M., Jouet, P., Mion, F., Vidon, M., Piche, T., Napoléon, M., Roman, S., Soliman, H., Benallaoua, M., Bouchoucha, M., Benamouzig, R.
United European Gastroenterology Journal, 2025/10

24

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10

25

Does forward head posture correction improve temporomandibular joint dysfunction? A pilot randomized trial using a cervical extension traction orthotic
Mohammad Zadeh, S. A., Shousha, T., Moustafa, I. M., Khowailed, I., Harrison, D. E.
Journal of Osteopathic Medicine, 2025/09
Free full text

26

COVID-19 mRNA vaccine immune response to the addition of osteopathic manipulative treatment with lymphatic pumps: a randomized controlled trial
Martinez, E. S., Fuchs, S., Szurmant, H., Chen, X., Comer, A., Lee, E., Hruby, R., Giusti, R., Loveless, B., Sees, J. P., Crone, P., Peek, L. J., Pestano, G., Xie, B., Zammuto, J., Hostoffer Jr., R., Sanchez Jr., J.
Virus Research, 2025/09
Free full text






32

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text

33

Osteopathic diagnosis and treatment of the spine in patients with chronic back pain through the lens of medical infrared thermography: A randomized controlled pilot study
Bohlen, L., Biester, A., Rapp, O., Wentzel, J., Liem, T., Cerritelli, F., Schmidt, T.
Complementary Therapies in Clinical Practice, 2025/08

34

Effect of osteopathic manipulation on neck kinematics using X-Sens motion capture in non-specific neck pain: a protocol for randomised controlled trial
Hullumani, S., Qureshi, I., Raghumahanti, R.
BMJ Open Sport and Exercise Medicine, 2025/08
Free full text

35

A multimodal intervention of manual therapy, exercise, and psychological management for painful diabetic neuropathy: intervention development and feasibility trial protocol
Hohenschurz-Schmidt, D., Smith, S., Schmid, A. B., Bright, P., Draper-Rodi, J., Evans, M. C., Kemp, H., Esteves, N. K., Pigott, E., Scott, W., Vollert, J., Williamson, E., Pogatzki-Zahn, E. M., Vogel, S.
Pain Management, 2025/07
Free full text

36

Effects of a single osteopathic manipulative treatment on intraocular pressure reduction: a pilot study
King, H. H., Weinreb, R. N., Walker, E., Zangwill, L. M.
Journal of Osteopathic Medicine, 2025/07
Free full text

37

Effect of osteopathic manipulative treatment on comorbid depressive symptoms in patients with chronic low back pain: study protocol for a randomised controlled trial
Bohlen, L., Eggart, M., Müller-Oerlinghausen, B., Lorenz, J., Schleip, R., Liem, T., Cerritelli, F., Esteves, J. E., Shedden-Mora, M., Schmidt, T.
BMJ Open, 2025/07
Free full text

38

Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial
Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., Arnal-Gómez, A.
International Journal of Osteopathic Medicine, 2025/06
Free full text

39

Is Regression in Lumbar Disk Herniation Possible by Spinal Mobilization? A Single-Blind Randomized Controlled Clinical Study
Taşkaya, B., Taşkent, İ., Çakıllı, M., Yılmaz, Ö.
International Journal of Osteopathic Medicine, 2025/06




43

Acute changes in functional connectivity associated with first osteopathic manual treatment in chronic low back pain spatially overlap with opioid receptor expression
Tomaiuolo, F., Cerritelli, F., Sestieri, C., Keys, J., Paolucci, T., Sensi, S. L., Ferretti, A., Delli Pizzi, S.
Brain Research Bulletin, 2025/06
Free full text


45

Evaluating the Acute Effects of Osteopathic Manipulative Treatment on Sprint Times
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., Jo, K., Roush, J., Cosgrave, C.
The AAO Journal, 2025/06

46

The Anatomy of Flares: Correlations Between Inflare/Outflares and Innominate Movements
Velasquez, L., Klachian, H., Paraschiv, N., Sinsky, J., Hahn, D., Volokitin, M.
The AAO Journal, 2025/06









55

Effectiveness of osteopathic treatment in women with primary dysmenorrhea: A randomised controlled trial
Plathner, M., Wolf, L.
Journal of Bodywork and Movement Therapies, 2025/06

56

Pilot study MOVENDOP protocol - impact on quality of life following postoperative osteopathic abdominal mobilizations in patients operated for endometriosis
Comptour, A., Dechambenoit, C., Kwiatkowski, F., Vidal, A., Duval, M., De Antonio, M., Jacobs, A., Bourdel, N.
PLoS One, 2025/05
Free full text

57

Spencer Technique of the Hip Demonstrates Equivocal Changes in Hip Range of Motion
O'Rorke, J., Buchman, Z. J., Savarino, V. R., DeFrancisis, J. S., Guay, C. S., Bushman, B., Vinarski, B. M., Toldi, J., Steiner, R. E., Boesler, D.
Cureus, 2025/05
Free full text


59

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2025/05
Free full text

60

Osteopathic, logopedic and psychological assessment to improve outcome in patients undergoing cardiac surgery: A randomized clinical trial (TITANIC trial)
Volpato, E., Stilo, L., Tavanelli, M., Bordoni, B., Oreni, L., Toccafondi, A., Moraschi, A., Morici, N.
European Journal of Preventive Cardiology, 2025/05



63

The Effectiveness of Osteopathic Correction in the Complex Rehabilitation of Patients with Temporomandibular Joint Dysfunction
Makichyan, T., Gusakova, E., Khabadze, Z., Sarkisian, A.
Georgian Medical News, 2025/04
Free full text


65

Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., David, P., Jordan, K., Arcangelo, M., Daniela, C.
Scientific Reports, 2025/03
Free full text





70

Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Galeazzi, Y., Houel, N., Gouaux, L., Rohan, A., Le Heiget, H., Jung, C., Housset, B., Stubbe, L.
Pain Reports, 2025/02
Free full text

71

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text

72

Specificity of cranial cutaneous manipulations in modulating autonomic nervous system responses and physiological oscillations: A controlled study
Keller, M., Perlitz, V., Pelz, H., Borik, S., Repik, I., Geilgens, A., Cotuk, B., Müller, G., Mathiak, K., Mayer, J.
PLoS ONE, 2025/02
Free full text

73

Manual therapy plus sexual advice compared with manual therapy or exercise therapy alone for lumbar radiculopathy: a randomized controlled trial
Danazumi, M. S., Adamu, I. A., Usman, M. H., Yakasai, A. M.
Journal of Osteopathic Medicine, 2025/01
Free full text

74

Osteopathic treatment of infants with infantile colic/excessive crying: a prospective, multicentric, randomized controlled trial and nested observational trial
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
BMC Pediatrics, 2025/01
Free full text

75

Early osteopathic manipulative treatment to prevent cranial positional deformities: A randomized controlled trial
Genelot, C., Macioce, V., Huguet, H., Harrewijn, I., Cambonie, G., Dessauge, D., Mura, T., Moulis, L., Captier, G.
Archives de Pédiatrie, 2025/01
Free full text

76

Three-Dimensional Posture Analysis-Based Modifications After Manual Therapy: A Preliminary Study
Scoppa, F., Graffitti, A., Pirino, A., Piermaria, J., Tamburella, F., Tramontano, M.
Journal of Clinical Medicine, 2025/01
Free full text

77

Efficacy of an Abdominal Surgery Simulator in Didactic Medical Training: A Randomized Controlled Trial
Fincher, S. E., Koniuk, V. M., Benavidez, M. S., Benefield, M. C., Drew, D. L., Hasan, D. M., Minner, N., Prakash, T. C., Parks, M. J., Lindsey, T.
Cureus, 2025/01
Free full text

78

Effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in individuals with chronic low back pain: A double-blind, randomised placebo-controlled trial
Armbrust, D., Arêas, G. P. T., Fonseca, C. L., Arêas, F. Z. S., Duarte, N. A. C., Santana, S. A. A., Dumont, A. J. L., Neto, H. P., Oliveira, C. S.
Clinical Rehabilitation, 2024/12

79

The Effects of Osteopathic Manipulative Treatment on Arrhythmias: A Double-blind Randomized Controlled Trial in Patients with Cardiac Implantable Electronic Devices
Nikakis, J., Malkov, D., Tale, E., Mangla, M., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
The Journal of Innovations in Cardiac Rhythm Management, 2024/12
Free full text


81

The Effects of Osteopathic Manipulative Treatment on Climbing Performance
Beyer, B. R., Sheppard, C., Bolig, J., Muvvala, M.
Journal of Osteopathic Medicine, 2024/12

82

Improving Sleep with OMT: A Randomized Controlled Trial using Cervical Techniques to Improve Sleep for OMSI
Le, D., Fagen, D., Christensen, S., Jensen, C., Alacron, A., Slife, R., Thakur, C., Teo, R., Spradley, G., Jackson, S, Zamanian, P., Finley, D., Tran, N., Tran, A., Redeman, K., Marble, A., Keane, J., Mangiaracina, M.
Journal of Osteopathic Medicine, 2024/12

83

Investigation of Suboccipital Release, Muscle Energy, and Combination Therapy, Respectively Evaluating their Effect on Carotid Artery Blood Flow: Preliminary Results
Sabbagh, M., Moriarty, S., Perera, I., Dziepak, S., Santiago, M., Peddibhotla, V., Rubis, C., Anandakrishnan, R., Rawlins, F., Brolinson, P. G.
Journal of Osteopathic Medicine, 2024/12





88

Lack of pragmatic attitude of self-labelled pragmatic trials on manual therapy: a methodological review
Roura, S., Alvarez, G., Hohenschurz-Schmidt, D., Solà, I., Núñez-Cortés, R., Bracchiglione, J., Fernández-Jané, C., Phalip, J., Gich, I., Sitjà-Rabert, M., Urrútia, G.
BMC Medical Research Methodology, 2024/11/11


90

Effect of Standard Physical Exercises for Non-specific Low Back Pain Combined with Multimodal Osteopathy Treatment on Pain Intensity and Functional Capacity: A Study Protocol for a Randomized Controlled Trial
Ferreira, C. R., Hort, J. P., Bezerra, L. A., Neto, H. P., Biasotto-Gonzalez, D. A., Politti, F.
Journal of Advances in Medicine and Medical Research, 2024/10
Free full text


92

Effect of electromagnetic stimulation combined with visceral manipulation on stress urinary incontinence in postmenopausal women: A randomized controlled trial
Mohamed, D. M. A., Kamel, D. M., El-Moatasem, A. M., Ali, E. A., Radwan, M. A., Ahmed, S. M.
Journal of Bodywork and Movement Therapies, 2024/10



95

Data-driven analysis of whole-brain intrinsic connectivity in patients with chronic low back pain undergoing osteopathic manipulative treatment
Tomaiuolo, F., Cerritelli, F., Delli Pizzi, S., Sestieri, C., Paolucci, T., Chiacchiaretta, P., Sensi, S. L., Ferretti, A.
NeuroImage: Clinical, 2024/08
Free full text

96

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08

97

The effect of osteopathic manipulative treatment on quality of life in patients with cardiac implantable electronic devices
Nikakis, J., Tale, E., Malkov, D., Arora, U. S., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2024/08
Free full text

98

Effectiveness of craniosacral therapy, Bowen therapy, static touch and standard exercise program on sleep quality in fibromyalgia syndrome: A randomized controlled trial
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P., Lakshmi, R. V.
Journal of Integrative Medicine, 2024/07

99

Effect of Visceral Manipulation on Children with Refractory Chronic Functional Constipation: A Randomized Controlled Trial
Zakaryaei, S. A., Ravanbakhsh, M., Javaherizadeh, H., Hakimzadeh, M., Shaterzadeh-Yazdi, M. J.
Arquivos de Gastroenterologia, 2024/07

100

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text




104

“That’s The Way We Have Always Done It”: Resetting the Hips
Tschantz, V., Fremarek, N., Hammond, E., Digambar, S., Vargas, E., Harden, D., Tobey, A. H., Kozar, A. J.
The AAO Journal, 2024/06



107

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06


109

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic low back pain: a single-blinded randomized controlled trial
Popovich, J. M., Cholewicki, J., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan, A.
Journal of Osteopathic Medicine, 2024/05
Free full text

110

Feasibility of blinding spinal manual therapy interventions among participants and outcome assessors: protocol for a blinding feasibility trial
Muñoz Laguna, J., Kurmann, A., Hofstetter, L., Nyantakyi, E., Clack, L., Bang, H., Foster, N. E., Braun, J., Puhan, M. A., Farshad, M., Hincapié, C. A.
Pilot and Feasibility Studies, 2024/05
Free full text

111

The Efficacy of Early Osteopathic Therapy in Restoring Proper Sucking in Breastfed Infants: Preliminary Findings from a Pilot Study
Parodi, A., Ruffa, R., De Felice, V., Sartini, M., Cristina, M. L., Martino, B., Bianco, F., Di Stefano, R., Mazzella, M.
Healthcare, 2024/05
Free full text


113

Usual light touch osteopathic treatment versus simple light touch without intent in the reduction of infantile colic crying time: A randomised controlled trial
Carnes, D., Bright, P., Brownhill, K., Carroll, K., Engel, R., Grace, S., Vogel, S., Vaucher, P.
International Journal of Osteopathic Medicine, 2024/03



116

Different exposure times of flexion distraction technique in the L5-S1 distance and local pain of patients with chronic low back pain: A feasibility study
Pagnez, M. A. M., Mello, M. S., Bittencourt, J. V., Ricard, F., Nogueira, L. A. C.
International Journal of Osteopathic Medicine, 2024/03



119

The effectiveness of manipulation in combination with exercise for patients with coccydynia: Six months follow-up of a randomized controlled trial
Tufekci, O., Yilmaz, K., Gercek, H., Unuvar, B. S.
International Journal of Osteopathic Medicine, 2024/03



122

Assessment of Long-term Effects of Adding Osteopathic Manipulative Treatment to Neck Exercises for Individuals With Non-specific Chronic Neck Pain: A Randomized Trial
Groisman, S., da Silva, L., Sanches, T., Rocha, C., Malysz, T., Jotz, G.
Journal of Chiropractic Medicine, 2023/12

123

Manual therapy on the diaphragm is beneficial in reducing pain and improving shoulder mobility in subjects with rotator cuff injury: A randomized trial
Fernández-López, I., Peña-Otero, D., Eguillor-Mutiloa, M., Bravo-Llatas, C., Atín-Arratibel, M. d. l. Á.
International Journal of Osteopathic Medicine, 2023/12

124

Effects of combined taping of quadriceps and hamstring muscles on pain and disability in patients with knee osteoarthritis: Randomized assessor-blinded controlled study
Mohamed, Y. E., Abd-Alkareem, D. S., Balbaa, A.E. A.A., Samy, M. M., Ashour, R. S.
International Journal of Osteopathic Medicine, 2023/12

125

Dose-response of talus mobilizations in weight bearing ankle dorsiflexion ROM of the older adults with limited ankle mobility: A randomized clinical trial
Tolsada-Velasco, C., Hernández-Guillén, D., Borja-de-Fuentes, I., Costa-Moreno, E., García-Gomáriz, C., Blasco, J.M.
International Journal of Osteopathic Medicine, 2023/12


127

Application of high-velocity low-amplitude technique in cervicothoracic junction produces cardiovascular responses in subjects with C7-T1 dysfunction: Randomized crossover trial
Zago, J., de Souza, B. U. L., Amatuzzi, F., Rondinel, T. Z., Queiroz, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2023/12

128

Evaluation of effectiveness of osteopathic visceral manipulation in patients with chronic mechanical low back pain: A multi-center, single-blind, randomized-controlled study
Altınbilek, T., Murat, S., Yıldırım, E., Filiz, B., Ünlü, S., Terzi, R.
Turkish Journal of Physical Medicine and Rehabilitation, 2023/12



131

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12

132

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12


134

The Effect of Craniosacral Therapy on Blood Levels of Stress Hormones in Male Firefighter Cadets: A Randomized Clinical Trial
Wójcik, M., Bordoni, B., Siatkowski, I., Żekanowska, E.
Behavioral Sciences, 2023/11









143

Osteopathic Manual Therapy for Infant Colic: A Randomised Clinical Trial
Martínez-Lentisco, M. D. M., Martín-González, M., García-Torrecillas, J. M., Antequera-Soler, E., Chillón-Martínez, R.
Healthcare, 2023/09
Free full text

144

Evaluation of the effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in chronic nonspecific low back pain. A protocol for a randomised controlled trial
Armbrust, D., Fonseca, C. L., Lopes Dumont, A. J., Viegas da Trindade, A. M., Neto, H. P., Oliveira, C. S.
International Journal of Osteopathic Medicine, 2023/09

145

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: randomized controlled trial
Boas Fernandes, W. V., Correa, F. I., Fidelis de Paula Gomes, C. A., Blanco, C. R., Lucareli, P. R. G., Politti, F., Correa, J. C. F.
Gait and Posture, 2023/09


147

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study, Part 2
Miranda, E., Feketeova, E., Giza, J.
The AAO Journal, 2023/06
Free full text

148

Quantifying Osteopathic Palpatory Motion
Schock, K., Ciccone, C., Mitkos, M., Redden, D. T., King, H. H., Kozar, A.
The AAO Journal, 2023/06
Free full text





153

Serological Assessment of the Effectiveness of Osteopathic Manipulative to Augment the Covid-19 Vaccine Immune Response
Martinez, E., Loveless, B., Crone, P., Szurmant, H., Fuchs, S., Sanchez, J.
Journal of Investigative Medicine, 2023/05

154

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05

155

Evaluation of Osteopathic Manipulative Treatment in Patients with Chikungunya Fever in the Chronic Phase: A Randomized Controlled Trial
Tenorio, L., Mello, K., Maia, M., Valença, A., Duarte, Â., Marques, C.
Journal of Clinical Rheumatology, 2023/05

156

Effectiveness of the muscle energy technique on postpartum meralgia paresthetica: A randomized controlled trial
El-Din Mahmoud, L. S., El Meligie, M. M., Yehia, R. M.
Journal of Back and Musculoskeletal Rehabilitation, 2023/05

157

Osteopathic Manual Treatment Compared to Kaltenborn-Evjenth Orthopedic Manual Therapy for Chronic Low Back Pain: A Randomized Study
Lizis, P., Kobza, W., Jaszczur-Nowicki, J., Wisniewski, D.
Alternative Therapies in Health and Medicine, 2023/05

158

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: Randomized controlled trial
Boas Fernandes, W. V., Politti, F., Blanco, C. R., Garcia Lucareli, P. R., Gomes, C. A. F. d. P., Corrêa, F. I., Corrêa, J. C. F.
Journal of Bodywork and Movement Therapies, 2023/04

159

Comparative Effects of Positional Release Technique Versus Deep Transverse Friction Massage on Pain and Disability in patients with Acute Mechanical Low Back Pain
Ammara, U., Shahzadi, F., Nazir, S., Fatima, K., Batool, F., Gondal, K. S., Aqeel, M., Shah, S., Maqbool, S.
Pakistan Journal of Medical and Health Sciences, 2023/04

160

Blinding and sham control methods in trials of physical, psychological, and self-management interventions for pain (article I): a systematic review and description of methods
Hohenschurz-Schmidt, D., Draper-Rodi, J., Vase, L., Scott, W., McGregor, A., Soliman, N., MacMillan, A., Olivier, A., Cherian, C. A., Corcoran, D., Abbey, H., Freigang, S., Chan, J., Phalip, J., Nørgaard Sørensen, L., Delafin, M., Baptista, M., Medforth, N. R., Ruffini, N.
Pain, 2023/03

161

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03





166





170

Connecting the dots: alterations in bioelectric activity at acupuncture Ting (Jing-Well) points following CV4 cranial manipulation
Hendryx, J. T., Kannan, A., Prashad, J., Falk, K.
Journal of Osteopathic Medicine, 2023/03
Free full text


172

A randomized controlled trial on pain, grip strength, and functionality in lateral elbow pain: Mulligan vs muscle energy techniques
Bagcaci, S., Unuvar, B. S., Gercek, H., Ugurlu, I., Sert, O. A., Yilmaz, K.
Journal of Back and Musculoskeletal Rehabilitation, 2023/01

173

Concussion-related visual memory and reaction time impairment in college athletes improved after osteopathic manipulative medicine: a randomized clinical trial
Mancini, J. D., Angelo, N., Abu-Sbaih, R., Kooyman, P., Yao, S.
Journal of Osteopathic Medicine, 2023/01
Free full text









182

Acupuncture and Osteopathic Medicine for Atopic Dermatitis – a Three-armed Randomized Controlled Explorative Clinical Trial
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Clinical and Experimental Dermatology, 2022/12
Free full text

183

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic neck pain: A single-blinded randomized controlled trial
Cholewicki, J., Popovich, J. M., Jr., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/12

184

Preliminary Results from a Randomized Controlled Trial on the Efficacy of Osteopathic Manipulative Medicine in Recovery from Concussions
Benedict, A. B., Torretta, C., Cholewicki, J., DeStefano, L. A., Fitton, N., Saffarian, M., Popovich, J. M., Zatkin, M., Lee, A., Sikorskii, A., Leslie, L., Shiver, Z.
Journal of Osteopathic Medicine, 2022/12


186

A Randomized Controlled Trial of Osteopathic Manipulative Therapy to Reduce Cranial Asymmetries in Young Infants with Nonsynostotic Plagiocephaly
Bagagiolo, D., Priolo, C. G., Favre, E. M., Pangallo, A., Didio, A., Sbarbaro, M., Borro, T., Daccò, S., Manzoni, P., Farina, D.
American Journal of Perinatology, 2022/12


188

Optimizing chronic pain management through patient engagement with quality of life measures: a randomized controlled trial
Licciardone, J. C., McDonald, H., Yablon, M., Ngo, W., Cunanan Garza, K. A., Aryal, S.
Journal of Osteopathic Medicine, 2022/11
Free full text

189

Effect of osteopathic techniques on human resting muscle tone in healthy subjects using myotonometry: a factorial randomized trial
Bohlen, L., Schwarze, J., Richter, J., Gietl, B., Lazarov, C., Kopyakova, A., Brandl, A., Schmidt, T.
Scientific Reports, 2022/10
Free full text

190

Effects of osteopathic manipulative treatment of the pivots on lower limb function in young professional football players
Thomas, E., Petrucci, M., Barretti, M., Messina, G., Cavallaro, A. R., Bianco, A.
Journal of Bodywork and Movement Therapies, 2022/10

191

Effect of Visceral Mobilization on Abdomino-Phrenic Dyssynergia in Irritable Bowel Syndrome Patients
Hammam, E. E. E.D., Sayed, A. A., Abdelkader, F., El-Moatasem, A. M.
The Egyptian Journal of Hospital Medicine, 2022/10
Free full text

192

Effectiveness of routine physical therapy with and without muscle energy technique in patients with upper crossed syndrome
Shahzad, H., Fatima, A., Ahmad, A., Khan, Z. A., Gilani, S. A.
Rawal Medical Journal, 2022/09
Free full text




196

The effectiveness of a multimodal approach in the treatment of patients with upper crossed syndrome: A randomized controlled trial
Aneis, Y. M., El-Badrawy, N. M., El-Ganainy, A.E. A., Atta, H. K.
Journal of Bodywork and Movement Therapies, 2022/09


198

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09





203

Treatment of infant colic with craniosacral therapy. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/09
Free full text

204

Thoracic Manual Therapy Improves Pain and Disability in Individuals With Shoulder Impingement Syndrome Compared With Placebo: A Randomized Controlled Trial With 1-Year Follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/08

205

Thoracic manual therapy improves pain and disability in individuals with shoulder impingement syndrome compared to placebo: a randomised controlled trial with one year follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/08


207

Effect of visceral manipulation on menstrual complaints in women with polycystic ovarian syndrome
Yosri, M. M., Hamada, H. A., Yousef, A. M.
Journal of Osteopathic Medicine, 2022/08
Free full text

208

Comparing the Effect of Stretching and Muscle Energy Technique in the Management of Lower Cross Syndrome
Khan, N., Nouman, M., Iqbal, M. A., Anwar, K., Sajjad, A. G., Hussain, S. A.
Pakistan Journal of Medical and Health Sciences, 2022/07
Free full text





213

Comparison of the Effect of Osteopathic Manipulations and Exercises on the Myoelectric Activity of the Pelvic Floor: A Randomized Controlled Trial
Arcanjo, G. N., Pires, Jlvr, Jacinto, M. E. M., Colares, J. M., Belo, L. M. C., Lima, P. O. P., Vilaça-Alves, J.
Journal of Chiropractic Medicine, 2022/06

214

Effects of Muscle Energy Technique with and without Bowen Therapy in Text Neck Syndrome
Seemal, P., Noor, R., Riaz, S., Afzal, H., Anwaar, S., Niaz, M.
Pakistan Journal of Medical and Health Sciences, 2022/06
Free full text



217

A Randomized Pilot Study Comparing Bilirubin Levels of Newborns Treated with Osteopathic Manipulative Treatment (OMT) Versus Routine Newborn Care Alone
Stephenson, C. M., Fremarek, N., Lentz, A., Klene-Bowns, A., Boeve, M., Brinsky, K., Chatterley, L., Yarling, C., Caldwell, G., Grundwaldt, D.
The AAO Journal, 2022/06
Free full text

218

Augmentation of Immune Response to COVID-19 mRNA Vaccination Through Osteopathic Manipulative Treatment
Ahn, B., Martinez, E., Hadiprodjo, H., Jackson, C., Gutierrez, M., Crone, P., Loveless, B., Fuchs, S., Szurmant, H., Sanchez, J.
The AAO Journal, 2022/06
Free full text

219

Comparative Effects of Mulligan's Two Leg Rotation Technique and Muscle Energy Technique on Hamstring Flexibility
Razzaq, M., Bhatti, Z. M., Nawaz, U., Ghani, H. M., Zaib Un, N., Hina, M.
Pakistan Journal of Medical and Health Sciences, 2022/05
Free full text

220

Effect of osteopathic manipulation of the sacroiliac joint vs electrotherapy on pain and functional disability in patients with low back pain: A pilot study
Rodríguez-Pastor, J. A., Caro-Puértolas, B., Caña-Pino, A., Sánchez-Preciado, A. M., Garrido-Ardila, E. M., Apolo-Arenas, M. D.
Journal of Back and Musculoskeletal Rehabilitation, 2022/05


222

Effects of osteopathic manipulative treatment vs. osteopathic cranial manipulative medicine on Parkinsonian gait
Terrell, Z. T., Moudy, S. C., Hensel, K. L., Patterson, R. M.
Journal of Osteopathic Medicine, 2022/05
Free full text


224

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text

225

Retention of tissue texture change after cervical muscle energy and high velocity low amplitude intervention: implications for treatment intervals
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2022/04
Free full text






231

Short- and medium-term effects of manual therapy on the upper cervical spine combined with exercise vs isolated exercise in patients with cervicogenic headache. A randomized controlled trial
Rodríguez-Sanz, J., Malo-Urriés, M., Corral-de-Toro, J., Lucha-López, M. O., López-de-Celis, C., Pérez-Bellmunt, A., Hernández-Secorún, M., Ruiz-de-Escudero-Zapico, A., Krauss, J., Hidalgo-García, C.
International Journal of Osteopathic Medicine, 2022/03


233

Efeitos da abordagem osteopática em neonatos com dificuldade na biomecânica da amamentação: ensaio clínico randomizado
(Effects of the osteopathic approach in neonates with difficulties in the biomechanics of breastfeeding: a randomized clinical trial)
Barros, R. C. T., Vilagra, J. M., Taglietti, M., Tori, F.S., Cagnini, T. L., Camilo, J.M., Grando, F., Abico, R. M., Abico, S. T.
Research, Society and Development, 2022/03
Free full text

234

Efficacy of muscle energy technique on forward head posture and cervical mobility in visually impaired children: A randomized controlled trial
Wagdy, E., Elserty, N., Zaghloul, H. M. S., Fayez, M. M.
Current Pediatric Research, 2022/02
Free full text

235

Pragmatic trials of pain therapies: a systematic review of methods
Hohenschurz-Schmidt, D., Kleykamp, B. A., Draper-Rodi, J., Vollert, J., Chan, J., Ferguson, M., McNicol, E., Phalip, J., Evans, S. R., Turk, D. C., Dworkin, R. H., Rice, A. S. C.
Pain, 2022/01
Free full text


237

The immediate effect of thoracolumbar manipulation and diaphragmatic release on inspiratory muscle strength in healthy smokers: A randomized clinical trial
Albarrati, A., Taher, M., Nazer, R., Alshameri, T.
Journal of Back and Musculoskeletal Rehabilitation, 2022/01

238

Relationship between osteopathic manipulative treatment of the temporomandibular joint, molar shim and the orthostatic position: A randomized, controlled and double blinded study
Detoni, R., Heartz, C. S., Fusatto, E. L., Bicalho, E., Nacimento-Moraes, K. S. G., Rizzatti-Barbosa, C. M., Lopes, F. O. T.
Journal of Bodywork and Movement Therapies, 2022/01
Free full text

239

Osteopathic treatment in addition to standard care in patients with Gastroesophageal Reflux Disease (GERD) – A pragmatic randomized controlled trial
Lynen, A., Schömitz, M., Vahle, M., Jäkel, A., Rütz, M., Schwerla, F.
Journal of Bodywork and Movement Therapies, 2022/01

240

Comparing the effects of muscle energy technique and mulligan mobilization with movements on pain, range of motion, and disability in adhesive capsulitis
Razzaq, A., Nadeem, R. D., Akhtar, M., Ghazanfar, M., Aslam, N., Nawaz, S.
Journal of the Pakistan Medical Association, 2022/01
Free full text

241

Effects of visceral manipulation associated with pelvic floor muscles training in women with urinary incontinence: A randomized controlled trial
De Marco, M., Arbieto, E. R. M., Da Roza, T. H., Resende, A. P. M., Santos, G. M.
Neurourology and Urodynamics, 2022/01
Free full text


243

Osteopathic Manipulation of the Sphenopalatine Ganglia Versus Sham Manipulation, in Obstructive Sleep Apnoea Syndrom: A Randomised Controlled Trial
Attali, V., Jacq, O., Martin, K., Arnulf, I., Similowski, T.
Journal of Clinical Medicine, 2021/12
Free full text





248

The ACAMTO study—impact of add-on osteopathic treatment on adolescent patients with anorexia nervosa: study protocol for a randomized controlled trial
Letranchant, A., Montebello, Y., Dugré-Le bigre, C., Wagner, A., Curt, F., Silva, J., Nicolas, I., Votadoro, P., Kalindjian, N., Korchonnoff, A., Gutierre, A., Novelli, Ana B., Pham-Scottez, A., Corcos, M.
Trials, 2021/11
Free full text







255

Exploring the Utility of Motion Analysis in Osteopathic Clinical Trials; a School-Based Pilot Study on Jaw and Cervical Range of Motion
Bagory, T., Vaucher, P., Mhadhbi, H., Ménard, M.
International Journal of Osteopathic Medicine, 2021/09

256

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study
Miranda, E., Giza, J., Feketeova, E., Castro-Nunez, C., Vieux, U., Huynh, M.D.
The AAO Journal, 2021/09
Free full text

257

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08




261

Effect of Muscle Energy Technique Versus Aerobic Exercise on Chronic Cyclic Pelvic Pain
Aziz, K. S. A., Mowafy, H.M., Hasanin, M. E., M., Ghazal, N. H. H.
The Egyptian Journal of Hospital Medicine, 2021/07
Free full text




265

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text


267

Comparison of effectiveness of muscle energy technique with Mulligan mobilization in patients with non-specific neck pain
Manzoor, A., Anwar, N., Khalid, K., Haider, R., Saghir, M., Javed, M. A.
Journal of the Pakistan Medical Association, 2021/06
Free full text

268

Effect of Osteopathic Manipulative Treatment vs Sham Treatment on Activity Limitations in Patients With Nonspecific Subacute and Chronic Low Back Pain: A Randomized Clinical Trial
Nguyen, C., Boutron, I., Zegarra-Parodi, R., Baron, G., Alami, S., Sanchez, K., Daste, C., Boisson, M., Fabre, L., Krief, P., Krief, G., Lefèvre-Colau, M.M., Rannou, F.
JAMA Internal Medicine, 2021/05

269

A comparative study of Thai massage and muscle energy technique for chronic neck pain: A single-blinded randomized clinical trial
Buttagat, V., Muenpan, K., Wiriyasakunphan, W., Pomsuwan, S., Kluayhomthong, S., Areeudomwong, P.
Journal of Bodywork and Movement Therapies, 2021/05

270

Effect of integrated neuromuscular inhibition technique compared with positional release technique in the management of piriformis syndrome
Danazumi, M. S., Yakasai, A. M., Ibrahim, A. A., Shehu, U. T., Ibrahim, S. U.
Journal of Osteopathic Medicine, 2021/05
Free full text

271

Can the sleep quality of patients with chronic neck pain be improved by muscle energy techniques combined with Swedish massage?
Hadamus, A., Wojda, A., Białoszewski, D.
Complementary Therapies in Clinical Practice, 2021/05

272

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text

273

Effects of Osteopathic T9-T10 Vertebral Manipulation in Tonsillitis: A Randomized Clinical Trial
Luceño-Mardones, A., Luceño-Rodríguez, I., Rodríguez-López, E. S., Oliva-Pascual-Vaca, J., Rosety, I., Oliva-Pascual-Vaca, Á
Healthcare, 2021/04
Free full text

274

The effect of dry needling & muscle energy technique separately and in combination in patients suffering shoulder impingement syndrome and active trigger points of infraspinatus
Jalilipanah, P., Okhovatian, F., Serri, R. A., Bagban, A. A., Zamani, S.
Journal of Bodywork and Movement Therapies, 2021/04


276

Osteopathic manipulative medicine in the management of headaches associated with postconcussion syndrome
Esterov, D., Thomas, A., Weiss, K.
Journal of Osteopathic Medicine, 2021/04
Free full text






282

Osteopathic medicine for fibromyalgia: a sham-controlled randomized clinical trial
Coste, J., Medkour, T., Maigne, J., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/04
Free full text



285

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text

286

Two manual therapy techniques for management of lumbar radiculopathy: a randomized clinical trial
Danazumi, M. S., Bello, B., Yakasai, A. M., Kaka, B.
Journal of Osteopathic Medicine, 2021/04
Free full text

287

Osteopathic manipulative treatment to improve exclusive breast feeding at 1 month
Danielo Jouhier, M., Boscher, C., Roze, J. C., Cailleau, N., Chaligne, F., Legrand, A., Flamant, C., Muller, J. B.
Archives of Disease in Childhood. Fetal and Neonatal Edition, 2021/04

288

Efectos de la osteopatía visceral y de la manipulación torácica en pacientes con dispepsia
(Effects of visceral osteopathy and thoracic manipulation in patients with dyspepsia)
Argüelles Movillo, L., González Iglesias, J., Pérez Fernández, J. A., Puente González, A. S.
European Journal Osteopathy & Related Clinical Research, 2021/03
Free full text


290

Effects of osteopathic manipulative treatment and bio-electromagnetic energy regulation therapy on lower back pain
Auger, K., Shedlock, G., Coutinho, K., Myers, N. E., Lorenzo, S.
Journal of Osteopathic Medicine, 2021/03
Free full text

291

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text



294

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text




298

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01



301

The Effect of Osteopathic Manipulative Treatment (OMT) on Proprioception in Adults: A Pilot Study
Hoevemeyer, K., Teng, K. Y., Mehner, T., McMunn, R., Figueroa, J., Jie, C.
The AAO Journal, 2020/12
Free full text



304

Crying Unsettled and disTressed Infants Effectiveness Study of osteopathic care (CUTIES trial): Pragmatic randomised superiority trial protocol
Carnes, D., Bright, P., Brownhill, K., Carroll, K., Engel, R., Grace, S., Vogel, S., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/12





309

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12

310

The effect of osteopathic medicine on pain in musicians with nonspecific chronic neck pain: a randomized controlled trial
Rotter, G., Fernholz, I., Binting, S., Keller, T., Roll, S., Kass, B., Reinhold, T., Willich, S. N., Schmidt, A., Brinkhaus, B.
Therapeutic Advances in Musculoskeletal Disease, 2020/12
Free full text

311

The Effect of Facial Effleurage on Serum Complement C3 During Acute Rhinosinusitis: A Randomized, Controlled Study
Burke, K. S., Weidman, C., Bradley, J. H.
The Journal of the American Osteopathic Association, 2020/12

312

Burn-out in Osteopathic Medical Students: The Effects of Meditation Before and After the Arrival of the COVID-19 Pandemic
Krishnamachari, B., Morris, A., Chinsky, R., Pendyala, R., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2020/12

313

The Effects of Osteopathic Manipulative Treatment on HbA1c in Type 2 Diabetes and Pre-diabetes: A Randomized-Control Clinical Trial
Sureshbabu, S., Sheflin, K., Li, T. S., Heller, M., Yusupov, E., Krishnamachari, B., Allera, A., Rivera-Martinez, S.
The Journal of the American Osteopathic Association, 2020/12

314

The Efficacy of Facial Effleurage, a Lymphatic Pump Technique, on Immune Response and Symptoms in Acute Rhinosinusitis: A Randomized, Controlled Study
Weidman, C., Boyd, M., Pepper, E., Hsieh, K., Kunda, D. T., Burke, K. S., Carrasco, M., Escamilla, O., Cheng, N., Bradley, J. H.
The Journal of the American Osteopathic Association, 2020/12


316

The effect of tongue and suprahyoid muscles release in the treatment of chronic non-specific neck pain: Study protocol for a randomized controlled trial
Silva, A. C., Godinho, M. M., Biasotto Gonzalez, D. A., Politti, F.
International Journal of Osteopathic Medicine, 2020/12

317

Evaluation of the Combination of Muscle Energy Technique and Trigger Point Therapy in Asymptomatic Individuals with a Latent Trigger Point
Wendt, M., Waszak, M.
International journal of environmental research and public health, 2020/11
Free full text





322

Osteopathic Manipulative Treatment in Individuals With Vertigo and Somatic Dysfunction: A Randomized, Controlled, Comparative Feasibility Study
Fraix, M., Badran, S., Graham, V., Redman-Bentley, D., Hurwitz, E. L., Quan, V. L., Yim, M., Hudson-McKinney, M., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text


324

Cranial osteopathic treatment and stress-related effects on autonomic nervous system measured by salivary markers: A pilot study
Abenavoli, A., Badi, F., Barbieri, M., Bianchi, M., Biglione, G., Dealessi, C., Grandini, M., Lavazza, C., Mapelli, L., Milano, V., Monti, L., Seppia, S., Tresoldi, M., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2020/10




328

Effectiveness of Osteopathic Manipulative Medicine vs Concussion Education in Treating Student Athletes With Acute Concussion Symptoms
Yao, S. C., Zwibel, H., Angelo, N., Leder, A., Mancini, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text


330

Osteopathic Manipulation in the Management of Chronic Pain: Current Perspectives
Licciardone, J. C., Schultz, M. J., Amen, B.
Journal of Pain Research, 2020/07
Free full text


332

Effectiveness of the Muscle Energy Technique versus Osteopathic Manipulation in the Treatment of Sacroiliac Joint Dysfunction in Athletes
García-Peñalver, U. J., Palop-Montoro, M. V., Manzano-Sánchez, D.
International journal of environmental research and public health, 2020/06

333

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text



336

Efficacy of osteopathic manipulative treatment on postural control in Parkinsonian patients with Pisa syndrome: A pilot randomized placebo-controlled trial
Zarucchi, A., Vismara, L., Frazzitta, G., Mauro, A., Priano, L., Maestri, R., Bergna, A., Tarantino, A. G.
NeuroRehabilitation, 2020/06


338

A subjective and objective analysis of the immediate effect of osteopathic manual treatment OMT on the golf swing
Maass, Z, Buffington, A, Miner, M, Hall, M
Clinical journal of sport medicine, 2020/06





343

Evaluation of the stomatognathic system before and after osteopathic manipulative treatment in 120 healthy people by using surface electromyography
Manzotti, A., Viganoni, C., Lauritano, D., Bernasconi, S., Paparo, A., Risso, R., Nanussi, A.
International Journal of Environmental Research and Public Health, 2020/05
Free full text

344

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05


346

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text

347

Osteopathic manipulative treatment combined with exercise improves pain and disability in individuals with non-specific chronic neck pain: A pragmatic randomized controlled trial
Groisman, S, Malysz, T, de Souza da Silva, L., Rocha Ribeiro Sanches, T., Camargo Bragante, K., Locatelli, F., Pontel Vigolo, C., Vaccari, S., Homercher Rosa Francisco, C., Monteiro Steigleder, S., Jotz, G. P.
Journal of Bodywork and Movement Therapies, 2020/04

348

Regular Mindful Yoga Practice as a Method to Improve Androgen Levels in Women With Polycystic Ovary Syndrome: A Randomized, Controlled Trial
Patel, V., Menezes, H., Menezes, C., Bouwer, S., Bostick-Smith, C. A., Speelman, D. L.
The Journal of the American Osteopathic Association, 2020/04
Free full text


350

Assessment and Management of Somatic Dysfunctions in Patients With Patellofemoral Pain Syndrome
Tramontano, M., Pagnotta, S., Lunghi, C., Manzo, C., Manzo, F., Consolo, S., Manzo, V.
The Journal of the American Osteopathic Association, 2020/03
Free full text

351

Efficacy of Combination Therapies on Neck Pain and Muscle Tenderness in Male Patients with Upper Trapezius Active Myofascial Trigger Points
Alghadir, A. H., Iqbal, A., Anwer, S., Iqbal, Z. A., Ahmed, H.
BioMed Research International, 2020/03
Free full text

352

Effects of eccentric muscle energy technique versus static stretching exercises in the management of cervical dysfunction in upper cross syndrome: a randomized control trial
Gillani, S. N., Ain, Q., Rehman, S. U., Masood, T.
Journal of the Pakistan Medical Association, 2020/03
Free full text


354

Short-term effect of muscle energy technique and mechanical diagnosis and therapy in sacroiliac joint dysfunction: - A pilot randomized clinical trial
Srivastava, S., Kumar K U, D., Mittal, H., Dixit, S., Nair, A.
Journal of Bodywork and Movement Therapies, 2020/02

355

Comparative study of muscle energy technique, craniosacral therapy, and sensorimotor training effects on postural control in patients with nonspecific chronic low back pain
Ghasemi, C., Amiri, A., Sarrafzadeh, J., Dadgoo, M., Jafari, H.
Journal of Family Medicine and Primary Care, 2020/02
Free full text

356

Effect of manual approaches with osteopathic modality on brain correlates of interoception: an fMRI study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Perrucci, M. G., Barassi, G., Visciano, C., Bellomo, R. G., Saggini, R., Ferretti, A.
Scientific Reports, 2020/02
Free full text


358

Isometric osteopathic manipulation influences on cervical ranges of motion and correlation with osteopathic palpatory diagnosis: A randomized trial
Niewiadomski, C., Bianco, R. J., Arnoux, P. J., Evin, M.
Complementary Therapies in Medicine, 2020/01

359

Efficacy of Muscle Energy Technique as an adjunct with Mulligans Mobilization in adhesive Capsulitis of Shoulder
Jaiswal, N., Saketa, J., Rajsekhar, H.
International Journal of Physiotherapy, 2019/2
Free full text

360

Efficacy of spinal extension exercise program versus muscle energy technique in treatment of chronic mechanical low back pain
Fahmy, E., Shaker, H., Ragab, W., Helmy, H., Gaber, M.
Egyptian Journal of Neurology, Psychiatry and Neurosurgery, 2019/12
Free full text

361








368

The Effect of Facial Effleurage on Acute Rhinosinusitis
Bradley, J. H., Weidman, C.
The Journal of the American Osteopathic Association, 2019/12



371

The Effect of OMM on Opioid Users with Chronic Low Back Pain
Patel, K. C., Cooley, D. L., Bailey, J. W., Janora, D. M., Fusco, C.
The Journal of the American Osteopathic Association, 2019/12

372

Facial Effleurage Treatment Increases Serum TNFα Levels in Patients with Acute Rhinosinusitis
White, A., Weidman, C., Bradley, J. H.
The Journal of the American Osteopathic Association, 2019/12


374

Osteopathic manipulative medicine to improve balance and quality of life in parkinson disease
Yao, S., Docherty, J., Mancini, J., Leder, A., DiFrancisco-Donoghue, J.
Movement Disorders, 2019/11






380

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10

381

Effects of Osteopathic Visceral Treatment in Patients with Gastroesophageal Reflux: A Randomized Controlled Trial
Eguaras, N., Rodriguez-Lopez, E. S., Lopez-Dicastillo, O., Franco-Sierra, M. A., Ricard, F., Oliva-Pascual-Vaca, A.
Journal of Clinical Medicine, 2019/10

382

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10





387

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09



390

Ergojump evaluation of the explosive strength in volleyball athletes pre- and post-fascial treatment
Buscemi, A., Petralia, M. C., Ramaci, T., Rapisarda, A., Provazza, C., Di Corrado, D., Perciavalle, V., Perciavalle, V., Coco, M.
Experimental and Therapeutic Medicine, 2019/08
Free full text

391

Efficacy of osteopathic treatment in patients with stable moderate-to-severe chronic obstructive pulmonary disease: a randomized controlled pilot study
Buscemi, A., Pennisi, V., Rapisarda, A., Pennisi, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2019/08

392

Osteopathic Manipulative Therapy in Patients With Chronic Tension-Type Headache: A Pilot Study
Deodato, M., Guolo, F., Monticco, A., Fornari, M., Manganotti, P., Granato, A.
The Journal of the American Osteopathic Association, 2019/08

393

Effectiveness of craniosacral therapy in the treatment of infantile colic. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Martínez Gil, J. L., Todri, J., Suárez Rancel, M., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2019/08

394

Effects of Post-Isometric Relaxation on Ankle Plantarflexion and Timed Flutter Kick in Pediatric Competitive Swimmers
Noto-Bell, L., Vogel, B. N., Senn, D. E.
The Journal of the American Osteopathic Association, 2019/08

395

Dynamic touch reduces physiological arousal in preterm infants: A role for c-tactile afferents?
Manzotti, A., Cerritelli, F., Esteves, J. E., Lista, G., Lombardi, E., La Rocca, S., Gallace, A., McGlone, F. P., Walker, S. C.
Developmental Cognitive Neuroscience, 2019/08
Free full text






401

Pilot randomized single-blind clinical trial, craniosacral therapy vs control on physiological reaction to math task in male athletes
Wójcik, M., Dziembowska, I., Izdebski, P., Żekanowska, E.
International Journal of Osteopathic Medicine, 2019/06

402

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06

403

Effects of muscle energy technique on pain, range of motion and function in patients with post-surgical elbow stiffness: A randomized controlled trial
Faqih, A. I., Bedekar, N., Shyam, A., Sancheti, P.
Hong Kong Physiotherapy Journal, 2019/06
Free full text





408

Effects of diaphragmatic myofascial release on gastroesophageal reflux disease: a preliminary randomized controlled trial
Martínez-Hurtado, I., Arguisuelas, M. D., Almela-Notari, P., Cortés, X., Barrasa-Shaw, A., Campos-González, J. C., Lisón, J. F.
Scientific Reports, 2019/05
Free full text




412

Effects of myofascial release in erector spinae myoelectric activity and lumbar spine kinematics in non-specific chronic low back pain: Randomized controlled trial
Arguisuelas, M. D., Lison, J. F., Domenech-Fernandez, J., Martinez-Hurtado, I., Salvador Coloma, P., Sanchez-Zuriaga, D.
Clinical Biomechanics, 2019/03

413

Short-term effectiveness of the flexion-distraction technique in comparison with high-velocity vertebral manipulation in patients suffering from low-back pain
Carrasco-Martínez, F., Ibáñez-Vera, A. J., Martínez-Amat, A., Hita-Contreras, F., Lomas-Vega, R.
Complementary Therapies in Medicine, 2019/03

414

Immediate biomechanical, systemic, and interoceptive effects of myofascial release on the thoracic spine: A randomised controlled trial
Cathcart, E., McSweeney, T., Johnston, R., Young, H., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2019/01


416

Ultrasound Evaluation of Diaphragmatic Mobility and Contractility After Osteopathic Manipulative Techniques in Healthy Volunteers: A Prospective, Randomized, Double-Blinded Clinical Trial
Mancini, D., Cesari, M., Lunghi, C., Benigni, A. M., Antonelli Incalzi, R., Scarlata, S.
Journal of Manipulative and Physiological Therapeutics, 2019/01

417

Acute Effects of Muscle Energy Technique and Joint Mobilization on Shoulder Tightness in Youth Throwing Athletes: A Randomized Controlled Trial
Reed, M. L., Begalle, R. L., Laudner, K. G.
International Journal of Sports Physical Therapy, 2018/12
Free full text

418

Effect of the soft-tissue techniques in the quality of life in patients with Crohn's disease: A randomized controlled trial
Espi-Lopez, G. V., Ingles, M., Soliva-Cazaban, I., Serra-Ano, P.
Medicine (Baltimore), 2018/12
Free full text

419

Fundamental study of a visceral pericardial osteopathic protocol on heart physiology
Fatisson, J., Mullie, Y., Oswald, V., Gauthier, M., Lalonde, F., Comtois, A. S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text





424

Effect of Osteopathic Visceral Manipulation on Pain, Cervical Range of Motion, and Upper Trapezius Muscle Activity in Patients with Chronic Nonspecific Neck Pain and Functional Dyspepsia: A Randomized, Double-Blind, Placebo-Controlled Pilot Study
Silva, A. C. O., Biasotto-Gonzalez, D. A., Oliveira, F. H. M., Andrade, A. O., Gomes, Cafp, Lanza, F. C., Amorim, C. F., Politti, F.
Evidence-based Complementary and Alternative Medicine, 2018/11
Free full text

425

The Effect of Osteopathic Manipulative Medicine on Oxidative Stress Following Mild Traumatic Brain Injury: A Pilot Study
Angelo, N., Mazzeo, S., Oommen, T., Zwibel, H., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

426

The Effect of Osteopathic Manipulative Treatment on Reactive Oxygen Species in Parkinson Disease
Docherty, J., Chu, K., Orshan, D., Kulason, K., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

427

Integration of Pressure Sensors in Lumbar Palpation Education
Panchmatia, J. H., Docherty, J., Kooyman, P., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

428

Using Wearable Technology to Measure the Effectiveness of Osteopathic Manipulative Treatment on Parkinson Disease Motor Symptoms
Poon, J., Docherty, J., Mancini, J., DiFrancisco-Donoghue, J., Cheriyan, G., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11



431

Visceral manipulation to treat functional constipation in stroke survivors: A randomized, controlled, double-blind, clinical trial
Neto, H. P., Borges, R. A., Bicalho, E. S., Oliveira, C. S.
Journal of Bodywork and Movement Therapies, 2018/10

432

Is mulligan’s sustained natural apophyseal glides (Snags) or muscle energy technique is effective in the non-surgical management of cervicogenic headache? a two-group pretest-posttest randomized controlled trial
Veena Kirthika, S., Padmanabhan, K., Sudhakar, Selvaraj, Vijaya Kumar, M.
Asian Journal of Pharmaceutical and Clinical Research, 2018/10
Free full text




436

Osteopathic Manipulative Treatment Including Specific Diaphragm Techniques Improves Pain and Disability in Chronic Nonspecific Low Back Pain: A Randomized Trial
Marti-Salvador, M., Hidalgo-Moreno, L., Domenech-Fernandez, J., Lison, J. F., Arguisuelas, M. D.
Archives of Physical Medicine and Rehabilitation, 2018/09

437

Effect of gong’s mobilisation versus muscle energy technique on pain and functional ability of shoulder in phase II adhesive capsulitis
Gopinath, Y., Seenivasan, S. K., Veeraraghavan, S. N. C., Viswanathan, R., Govindaraj, M. K.
Journal of Clinical and Diagnostic Research, 2018/09

438

Effects of manual therapy on the diaphragm in asthmatic patients: A randomized pilot study
Leonés-Macías, E., Torres-Sánchez, I., Cabrera-Martos, I., Ortiz-Rubio, A., López-López, L., Valenza, Marie C.
International Journal of Osteopathic Medicine, 2018/09

439

Effectiveness of an Osteopathic Abdominal Manual Intervention in Pain Thresholds, Lumbopelvic Mobility, and Posture in Women with Chronic Functional Constipation
Martinez-Ochoa, M. J., Fernandez-Dominguez, J. C., Morales-Asencio, J. M., Gonzalez-Iglesias, J., Ricard, F., Oliva-Pascual-Vaca, A.
The Journal of Alternative and Complementary Medicine, 2018/08

440

Comparative Efficiency of Muscle Energy Technique and Static Stretching in Enhancing Triceps Surae Flexibility
Kumar, G. M., Rajalaxmi, V., Nathan, C. V. S., Ramachandran, S., Kirthika, V., Sudhakar, S., Padmanabhan, K., Yuvarani, G.
Journal of Clinical and Diagnostic Research, 2018/08
Free full text

441

Osteopathic Manipulative Therapy Potentiates Motor Cortical Plasticity
Ponzo, V., Cinnera, A. M., Mommo, F., Caltagirone, C., Koch, G., Tramontano, M.
The Journal of the American Osteopathic Association, 2018/06
Free full text

442


443

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects
Abdelfattah, A., Abdelraoof, N., Nasef, S.
Internal Medicine Journal, 2018/05
Free full text

444

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05

445

Neck-stomach syndrome in the cervical spondylosis: An update on preliminary 2017 data
Ramieri, A., Miscusi, M., Costanzo, G.
European Spine Journal, 2018/04

446

Fibromyalgia with Gabapentin and Osteopathic Manipulative Medicine: A Pilot Study
Marske, C., Bernard, N., Palacios, A., Wheeler, C., Preiss, B., Brown, M., Bhattacharya, S., Klapstein, G.
The Journal of Alternative and Complementary Medicine, 2018/04

447

Effect of muscle energy technique with and without strain-counterstrain technique in acute low back pain - A randomized clinical trial
Patel, V. D., Eapen, C., Ceepee, Z., Kamath, R.
Hong Kong Physiotherapy Journal, 2018/04
Free full text

448

The immediate effect of osteopathic cervical spine mobilization on median nerve mechanosensitivity: A triple-blind, randomized, placebo-controlled trial
Whelan, G., Johnston, R., Millward, C., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2018/04


450

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text

451

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text

452

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text






458

Effect of Ultrasonography on Student Learning of Shoulder Anatomy and Landmarks
de Vries, K. D., Brown, R., Mazzie, J., Jung, M. K., Yao, S. C., Terzella, M. J.
The Journal of the American Osteopathic Association, 2018/01
Free full text


460

Comparing the Effect of Osteopathic Manipulative Medicine Versus Concussion Education for the Acute Treatment of Mild Concussion Symptoms
Angelo, N., Zwibel, H., Leder, A., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11

461

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2017/11

462

Osteopathic Manipulative Treatment Reduces Oxidative Stress Levels and Improves Relative Stiffness and Quality of Life in Parkinson Disease
Moriarty, S. A., Lu, V., Oommen, C., Bellavia, L. M., Lee, J. M., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11

463

Sutherlandtechnik beim Knick-Senkfuß
(Sutherlandtechnik for pes planuvalgus)
Radner, J.
Unpublished MSc thesis, 2017/10
Free full text


465

The effects of three types of piriform muscle stretching on muscle thickness and the medial rotation angle of the coxal articulation
Park, J. C., Shim, J. H., Chung, S. H.
Journal of Physical Therapy Science, 2017/10
Free full text







472

The effects of cervical sustained natural apophyseal glides on neck range of movement and sympathetic nervous system activity
Bowler, N., Browning, P., Lascurain-Aguirrebeña, I.
International Journal of Osteopathic Medicine, 2017/09/01/

473

Randomised controlled pilot trial of high-velocity, low-amplitude manipulation on cervical and upper thoracic spine levels in asymptomatic subjects
Galindez-Ibarbengoetxea, X., Setuain, I., González-Izal, M., Jauregi, A., Ramírez-Velez, R., Andersen, L. L., Izquierdo, M.
International Journal of Osteopathic Medicine, 2017/09/01/

474

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text



477

Effect of Continuous Touch on Brain Functional Connectivity Is Modified by the Operator's Tactile Attention
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Frontiers in Human Neuroscience, 2017/07
Free full text


479

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text

480

Osteopathische Behandlungen nach Karpaltunneloperation – eine randomisierte kontrollierte Studie
(Osteopathic treatments after carpal tunnel surgery - A randomized controlled trial)
Deutschmann, G., Porthun, J., Grabner, O., Leskowschek, H., Graff, W., Sammer, A., Safran, T.
Osteopathische Medizin, 2017/06


482

Effects of Osteopathic Treatment on Postural Equilibrium Evaluated through a Stabilometric Platform: A Randomized and Controlled Study
Buscemi, A., Cannatella, M., Lutrario, P., Rapisarda, A., Di Gregorio, G., Coco, M.
Journal of Functional Morphology and Kinesiology, 2017/05
Free full text

483


484

Use of the Spencer Technique on Collegiate Baseball Players: Effect on Physical Performance and Self-Report Measures
Curcio, J. E., Grana, M. J., England, S., Banyas, P. M., Palmer, B. D., Placke, A. E., Rieck, W. A., Jr., Eade
The Journal of the American Osteopathic Association, 2017/03
Free full text

485

Impact of osteopathic therapy on proprioceptive balance and quality of life in patients with dizziness
Papa, L., Amodio, A., Biffi, F., Mandara, A.
Journal of Bodywork and Movement Therapies, 2017/03


487

Osteopathic manipulation as a complementary approach to Parkinson's disease: A controlled pilot study
Difrancisco-Donoghue, J., Apoznanski, T., De Vries, K., Jung, M. K., Mancini, J., Yao, S.
NeuroRehabilitation, 2017/03




491

Osteopathic Manipulative Treatment of Primary Dysmenorrhea and Related Factors: A Randomized Controlled Trial
Zecchillo, D., Acquati, A., Aquino, A., Pisa, V., Uberti, S., Ratti, S.
International Journal of Medical Research & Health Sciences, 2017
Free full text

492

Efficacy of manual therapy on anxiety and depression in patients with tension-type headache. A randomized controlled clinical trial
Espí-López, G. V., López-Bueno, L., Vicente-Herrero, M. T., Martinez-Arnau, F. M., Monzani, L.
International Journal of Osteopathic Medicine, 2016/12

493

Efficacy of an Osteopathic Treatment Coupled With Lactation Consultations for Infants' Biomechanical Sucking Difficulties
Herzhaft-Le Roy, J., Xhignesse, M., Gaboury, I.
Journal of Human Lactation, 2016/12

494

PROMOTE Study: Safety of Osteopathic Manipulative Treatment During the Third Trimester by Labor and Delivery Outcomes
Hensel, K. L., Roane, B. M., Chaphekar, A. V., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2016/11
Free full text

495

Efficacy of an osteopathic treatment for biomechanical suckling dysfunctions in newborn: A randomised controlled trial
Herzhaft-LeRoy, J., Gaboury, I., Xhignesse, M.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text





500

Effectiveness of neural mobilization with intermittent cervical traction in the management of cervical radiculopathy: A randomized controlled trial
Savva, C., Giakas, G., Efstathiou, M., Karagiannis, C., Mamais, I.
International Journal of Osteopathic Medicine, 2016/09

501

Osteopathic Manual Treatment for Amyotrophic Lateral Sclerosis: A Feasibility Pilot Study
Maggiani, A., Tremolizzo, L., Della Valentina, A., Mapelli, L., Sosio, S., Milano, V., Bianchi, M., Badi, F., Lavazza, C., Grandini, M., Corna, G., Prometti, P., Lunetta, C., Riva, N., Ferri, A., Lanfranconi, F., Me, Study
The Open Neurology Journal, 2016/08
Free full text


503

Osteopatia e lombalgia
(Osteopathy and low back pain)
de Oliveira Meirelles, F.
Unpublished MSc thesis, 2016/06
Free full text

504

Randomised controlled pilot trial on feasibility, safety and effectiveness of osteopathic MANipulative treatment following major abdominal surgery (OMANT pilot trial)
Probst, P., Büchler, E., Doerr-Harim, C., Knebel, P., Thiel, B., Ulrich, A., Diener, M. K.
International Journal of Osteopathic Medicine, 2016/06


506

Craniosacral therapy for the treatment of chronic neck pain: A randomized sham-controlled trial
Haller, H., Lauche, R., Cramer, H., Rampp, T., Saha, F. J., Ostermann, T., Dobos, G.
The Clinical Journal of Pain, 2016/05
Free full text



509

Targeting Patient Subgroups With Chronic Low Back Pain for Osteopathic Manipulative Treatment: Responder Analyses From a Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text


511

Recovery From Chronic Low Back Pain After Osteopathic Manipulative Treatment: A Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text


513

The effect of the combination of dry needling and MET on latent trigger point upper trapezius in females
Yeganeh Lari, A., Okhovatian, F., Naimi, Ss, Baghban, A. A.
Manual Therapy, 2016/02

514

Effects of pressure applied during standardized spinal mobilizations on peripheral skin blood flow: A randomised cross-over study
Zegarra-Parodi, R., Pazdernik, V. K., Roustit, M., Park, P. Y., Degenhardt, B. F.
Manual therapy, 2016/02


516

General Movements in preterm infants undergoing craniosacral therapy: a randomised controlled pilot-trial
Raith, W., Marschik, P. B., Sommer, C., Maurer-Fellbaum, U., Amhofer, C., Avian, A., Lowenstein, E., Soral, S., Muller, W., Einspieler, C., Urlesberger, B.
BMC Complementary and Alternative Medicine, 2016/01
Free full text


518

Multicenter Osteopathic Pneumonia Study in the Elderly: Subgroup Analysis on Hospital Length of Stay, Ventilator-Dependent Respiratory Failure Rate, and In-hospital Mortality Rate
Noll, D. R., Degenhardt, B. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text



521

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text


523

Effects of the Fourth Ventricle Compression in the Regulation of the Autonomic Nervous System: A Randomized Control Trial
Cardoso-de-Mello-e-Mello-Ribeiro, A. P., Rodríguez-Blanco, C., Riquelme-Agulló, I., Heredia-Rizo, A. M., Ricard, F., Oliva-Pascual-Vaca, Á.
Evidence-Based Complementary and Alternative Medicine, 2015/06
Free full text


525

A multicenter, randomized, controlled trial of osteopathic manipulative treatment on preterms
Cerritelli, F., Pizzolorusso, G., Renzetti, C., Cozzolino, V., D'Orazio, M., Lupacchini, M., Marinelli, B., Accorsi, A., Lucci, C., Lancellotti, J., Ballabio, S., Castelli, C., Molteni, D., Besana, R., Tubaldi, L., Perri, F. P., Fusilli, P., D'Incecco, C., Barlafante, G.
PLoS One, 2015/05
Free full text


527

Clinical effectiveness of osteopathic treatment in chronic migraine: 3-Armed randomized controlled trial
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Complementary Therapies in Medicine, 2015/04

528

Effects of a diaphragm stretching technique on pulmonary function in healthy participants: A randomized-controlled trial
González-Álvarez, F. J., Valenza, M. C., Cabrera-Martos, I., Torres-Sánchez, I., Valenza-Demet, G.
International Journal of Osteopathic Medicine, 2015/03


530

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: the PROMOTE study
Hensel, K. L., Buchanan, S., Brown, S. K., Rodriguez, M., Cruser d, A.
American Journal of Obstetrics & Gynecology, 2015/01
Free full text

531

Osteopathy decreases the severity of IBS-like symptoms associated with Crohn's disease in patients in remission
Piche, T., Pishvaie, D., Tirouvaziam, D., Filippi, J., Dainese, R., Tonohouhan, M., DeGalleani, L., Nebot-Vivinus, M. H., Payrouse, J. L., Hebuterne, X.
European Journal of Gastroenterology & Hepatology, 2014/12

532

Credibility of a comparative sham control intervention for craniosacral therapy in patients with chronic neck pain
Haller, H., Ostermann, T., Lauche, R., Cramer, H., Dobos, G.
Complementary Therapies in Medicine, 2014/12

533

Osteopathic treatment in patients with primary dysmenorrhoea: A randomised controlled trial
Schwerla, F., Wirthwein, P., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2014/12

534

Does the addition of visceral manipulation alter outcomes for patients with low back pain? A randomized placebo controlled trial
Panagopoulos, J., Hancock, M. J., Ferreira, P., Hush, J., Petocz, P.
European Journal of Pain, 2014/11

535

Effects of Osteopathic Manipulative Treatment (OMT) in Lowering Perceived Stress in Medical, Dental, and Pharmacy Student Populations
Frye, K. L., Williams, C. J., Johnson, B. N., Quinn, T. A., Fotopoulos, T. J.
The AAO Journal, 2014/11
Free full text



538

The Effect of Optimally Timed Osteopathic Manipulative Treatment on Length of Hospital Stay in Moderate and Late Preterm Infants: Results from a RCT
Pizzolorusso, G., Cerritelli, F., Accorsi, A., Lucci, C., Tubaldi, L., Lancellotti, J., Barlafante, G., Renzetti, C., D', Incecco, C., Perri, F. P.
Evidence-based Complementary and Alternative Medicine, 2014/11
Free full text



541

Changes in rat spinal cord gene expression after inflammatory hyperalgesia of the joint and manual therapy
Ruhlen, R. L., Singh, V. K., Pazdernik, V. K., Towns, L. C., Snider, E. J., Sargentini, N. J., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/10
Free full text


543

Pilot trial of osteopathic manipulative therapy for patients with frequent episodic tension-type headache
Rolle, G., Tremolizzo, L., Somalvico, F., Ferrarese, C., Bressan, L. C.
The Journal of the American Osteopathic Association, 2014/09
Free full text

544

Impact of osteopathic treatment on pain in adult patients with cystic fibrosis--a pilot randomized controlled study
Hubert, D., Soubeiran, L., Gourmelon, F., Grenet, D., Serreau, R., Perrodeau, E., Zegarra-Parodi, R., Boutron, I.
PLoS One, 2014/07
Free full text

545

Osteopathic manipulative treatment for inpatients with pulmonary exacerbations of cystic fibrosis: effects on spirometry findings and patient assessments of breathing, anxiety, and pain
Swender, D. A., Thompson, G., Schneider, K., McCoy, K., Patel, A.
The Journal of the American Osteopathic Association, 2014/06
Free full text

546

Effect of a general osteopathic treatment on body satisfaction, global self perception and anxiety: A randomized trial in asymptomatic female students
Dugailly, P.M., Fassin, S., Maroye, L., Evers, L., Klein, P., Feipel, V.
International Journal of Osteopathic Medicine, 2014/06

547

Effect of osteopathic manipulative treatment on middle ear effusion following acute otitis media in young children: a pilot study
Steele, K. M., Carreiro, J. E., Viola, J. H., Conte, J. A., Ridpath, L. C.
The Journal of the American Osteopathic Association, 2014/06
Free full text

548

Effect of osteopathic manipulative therapy in the attentive performance of children with attention-deficit/hyperactivity disorder
Accorsi, A., Lucci, C., Di Mattia, L., Granchelli, C., Barlafante, G., Fini, F., Pizzolorusso, G., Cerritelli, F., Pincherle, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

549

Do placebo effects associated with sham osteopathic procedure occur in newborns? Results of a randomized controlled trial
Martelli, M., Cardinali, L., Barlafante, G., Pizzolorusso, G., Renzetti, C., Cerritelli, F.
Complementary Therapies in Medicine, 2014/04


551

Changes in Biomechanical Dysfunction With Osteopathic Manual Treatment in Patients With Chronic Low Back Pain According to Diabetes Mellitus Status
Panjwani, R., Kearns, C., Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/01

552

Effect of Osteopathic Manipulative Medicine Thoracic Cage Techniques on Parkinson Disease Patients
Vazzana, K. M., Hart, A., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2014/01

553

Effects of 7-Technique Osteopathic Manipulative Protocol on Patients With COPD
Carter Decker, J., Tylski, E., Stevens Coe, J., McClain, R., Gautam, D., McClain, E. K., Ogden, R., Kolo, G.
The Journal of the American Osteopathic Association, 2014/01

554

Efficacy of Osteopathic Manipulative Treatment on Pulmonary Function in Healthy Adult Male Subjects
Hines, P. J., Heinking, K., Henderson, K.
The Journal of the American Osteopathic Association, 2014/01


556



558

Muscle energy technique versus corticosteroid injection for management of chronic lateral epicondylitis: randomized controlled trial with 1-year follow-up
Kucuksen, S., Yilmaz, H., Salli, A., Ugurlu, H.
Archives of Physical Medicine and Rehabilitation, 2013/11
Free full text



561


562

Traction for low-back pain with or without sciatica
Wegner, I., Widyahening, I. S., van Tulder, M. W., Blomberg, S. E., de Vet, H. C., Bronfort, G., Bouter, L. M., van der Heijden, G. J.
Cochrane Database of Systematic Reviews, 2013/08
Free full text

563

Effects of Osteopathic Manipulative Treatment on Self-Perceived Stress in First-Year Osteopathic Medical Students
Bianchi, W., Cooper, M., Roberts, C., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

564

Reducing Medical Student Fatigue With Osteopathic Manipulative Treatment
Wiegand, S., Jordan, L., Van Tiem, M., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

565

Effects of craniosacral therapy as adjunct to standard treatment for pelvic girdle pain in pregnant women: a multicenter, single blind, randomized controlled trial
Elden, H., Ostgaard, H. C., Glantz, A., Marciniak, P., Linner, A. C., Olsen, M. F.
ACTA Obstetricia et Gynecologica Scandinavica, 2013/07
Free full text


567

Osteopathic manual treatment in patients with diabetes mellitus and comorbid chronic low back pain: subgroup results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2013/06
Free full text

568

The effect of osteopathic manipulative treatment on postoperative medical and functional recovery of coronary artery bypass graft patients
Wieting, J. M., Beal, C., Roth, G. L., Gorbis, S., Dillard, L., Gilliland, D., Rowan, J.
The Journal of the American Osteopathic Association, 2013/05
Free full text

569

Trial designs and exploration of the placebo response
Dieppe, P.
Complementary Therapies in Medicine, 2013/04
Free full text

570

Is osteopathic manipulative treatment effective in migraine?
Cerritelli, F., Caprari, E., Di Vincenzo, M., Ginevri, L. R., Messi, G., Renzetti, C., Cozzolino, V., Frattesi, C., Barlafante, G., Foschi, N.
International Journal of Osteopathic Medicine, 2013/03


572

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Minotti, D. E., Gatchel, R. J., Kearns, C. M., Singh, K. P.
Annals of Family Medicine, 2013/03
Free full text

573



575

Strain-counterstrain to treat restrictions of the mobility of the cervical spine in patients with neck pain: a sham-controlled randomized trial
Klein, R., Bareis, A., Schneider, A., Linde, K.
Complementary Therapies in Medicine, 2013/02
Free full text

576

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text




580

A comparative study of cervical hysteresis characteristics after various osteopathic manipulative treatment (OMT) modalities
Barnes, P. L., Laboy, F., Noto-Bell, L., Ferencz, V., Nelson, J., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2013/01

581

The suitability of sham treatments for use as placebo controls in trials of spinal manipulative therapy: a pilot study
Lougee, H., Johnston, R. G., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2013/01
Free full text

582


583







589

(Osteopathic treatment of patients with shoulder pain. A randomized controlled study)
Hinse, T., Klosterkamp, M.
Unpublished D.O. thesis, 2012/10



592

The immediate effects of sigmoid colon manipulation on pressure pain thresholds in the lumbar spine
McSweeney, T. P., Thomson, O. P., Johnston, R.
Journal of Bodywork and Movement Therapies, 2012/10
Free full text

593

971 Neonatology-Osteopathy (Ne-O) Study: RCT on the Effect of Osteopathic Manipulative Treatment on Los
Accorsi, A., Lucci, C., Pizzolorusso, G., Tubaldi, L., Cerritelli, F., Perri, F. P.
Archives of Disease in Childhood, 2012/10

594

Osteopathic manipulative treatment in obese patients with chronic low back pain: a pilot study
Vismara, L., Cimolin, V., Menegoni, F., Zaina, F., Galli, M., Negrini, S., Villa, V., Capodaglio, P.
Manual Therapy, 2012/10
Free full text


596

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving the quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Gulisano, V., Orfei, S.
Clinical Cases in Mineral and Bone Metabolism, 2012/09
Free full text


598

Associations of cytokine concentrations with key osteopathic lesions and clinical outcomes in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Bergamini, M. V.
The Journal of the American Osteopathic Association, 2012/09
Free full text

599

Preventative Osteopathic Manipulative Treatment and the Elderly Nursing Home Resident: A Pilot Study
Snider, K. T., Snider, E. J., Johnson, J. C., Hagan, C., Schoenwald, C.
The Journal of the American Osteopathic Association, 2012/08
Free full text

600

Neonatology-Osteopathy (NE-O) Study: A Randomized Controlled Trial on the Effect of Osteopathic Manipulative Treatment on Length of Stay
Accorsi, A., Lucci, C., Lancellotti, J., Pizzolorusso, G., Santini, N., Durastanti, C., Barlafante, G., Tubaldi, L., Perri, F. P., Cerritelli, F.
The Journal of the American Osteopathic Association, 2012/08

601

Is the Placebo Effect Revealable in Newborns? Results From a Randomized Controlled Trial in Osteopathy
Cerritelli, F., Barlafante, G., Renzetti, C., Ricci, F., Loprete, N., Pizzolorusso, G., Fusilli, P., D'Incecco, C.
The Journal of the American Osteopathic Association, 2012/08

602

Effect of Counterstrain Treatment on Contralateral Satellite Tender Points
Ochmanek, E. R., Heath, D. M., Bay, R. C.
The Journal of the American Osteopathic Association, 2012/08


604

Efficacy of osteopathic manipulative treatment for low back pain in euhydrated and hypohydrated conditions: a randomized crossover trial
Parker, J., Heinking, K. P., Kappler, R. E.
The Journal of the American Osteopathic Association, 2012/05
Free full text

605

Assessment of Low Back and Pelvic Pain after applying the Pelvis Global Manipulation Technique in Patients with Primary Dysmenorrhea: A Pilot Study
Molins-Cubero, S., Boscá-Gandia, J. J., Rus-Martinez, M. A.
European Journal Osteopathy & Related Clinical Research, 2012/04
Free full text

606

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03

607

A randomized, controlled trial of osteopathic manipulative treatment for acute low back pain in active duty military personnel
Cruser d, A., Maurer, D., Hensel, K., Brown, S., White, K., Stoll, S.
Journal of Manual & Manipulative Therapy, 2012/02



610

Efficacy of Muscle Energy Technique versus Myofascial Release on function outcome measures in patients with chronic low back pain
Ellythy, M A
Bulletin of Faculty of Physical Therapy Cairo University, 2012/01
Free full text


612

A Study on the Efficacy of Muscle Energy Technique as Compared to Conventional Therapy in Chronic Low Back Pain Due to Sacroiliac Joint Dysfunction
Bindra, S, Kumar, M, Singh, P P, Singh, J
Indian Journal of Physiotherapy & Occupational Therapy, 2012


614

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text


616

Fascial release effects on patients with non-specific cervical or lumbar pain
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2011/10


618

The effect of strain counterstrain (SCS) on forearm strength compared to sham positioning
Wong, C. K., Moskovitz, N., Fabillar, R.
International Journal of Osteopathic Medicine, 2011/09


620

Documenting and Comparing Frequencies and Forces Used to Perform Lymphatic Pump OMT Manually and With Use of a Machine
Kuchera, M. L., Irwin, J., Myers, N., Ferencz, V., Nelson, J.
The Journal of the American Osteopathic Association, 2011/08

621

Evaluation of Osteopathic Manipulative Medicine Pretreatment for the Prevention of Acute Mountain Sickness
Li, R.C., Hwang, J., Shultz, L., Burns, J. M., Garcia-Russell, N.
The Journal of the American Osteopathic Association, 2011/08




625

Spinal manipulations for the treatment of migraine: a systematic review of randomized clinical trials
Posadzki, P., Ernst, E.
Cephalalgia: An International Journal of Headache, 2011/06



628

Osteopathic manipulative treatment is effective on pain control associated to spinal cord injury
Arienti, C., Dacco, S., Piccolo, I., Redaelli, T.
Spinal Cord, 2011/04
Free full text

629

Impact of osteopathic manipulative treatment on secretory immunoglobulin a levels in a stressed population
Saggio, G., Docimo, S., Pilc, J., Norton, J., Gilliar, W.
The Journal of the American Osteopathic Association, 2011/03
Free full text

630

Efficacy of osteopathic manipulative treatment of female patients with migraine: results of a randomized controlled trial
Voigt, K., Liebnitzky, J., Burmeister, U., Sihvonen-Riemenschneider, H., Beck, M., Voigt, R., Bergmann, A.
The Journal of Alternative and Complementary Medicine, 2011/03
Free full text

631

Cranial osteopathy for children with cerebral palsy: a randomised controlled trial
Wyatt, K., Edwards, V., Franck, L., Britten, N., Creanor, S., Maddick, A., Logan, S.
Archives of Disease in Childhood, 2011/02
Free full text

632

A randomized controlled trial investigating the effects of craniosacral therapy on pain and heart rate variability in fibromyalgia patients
Castro-Sánchez, A. M., Matarán-Peñarrocha, G. A., Sánchez-Labraca, N., Quesada-Rubio, J. M., Granero-Molina, J., Moreno-Lorenzo, C.
Clinical Rehabilitation, 2011/01






638

Impact of OMT on reducing length of stay in a population of pre-term infants
Cozzolino, V., La Mola, E., Ciardelli, F., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09

639

Osteopathic manipulative treatment for chronic neck pain: A randomized placebo controlled trial on the effect on pain and disability
Mandara, A., Ceriani, A., Guzzetti, G., Gulisano, V., Fusaro, A., Bado, F.
International Journal of Osteopathic Medicine, 2010/09


641

Osteopathic treatment of women with primary dysmenorrhoea: A randomised controlled trial
Pinter-Haas, A., Schach-Hirte, A., Wirthwein, P., Metcalfe, D., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09

642

Osteopathic treatment of women with voiding dysfunction: A randomized controlled trial
Ringkamp, C., Rodriquez, B., Alberts, K., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09

643

Osteopathic treatment of patients with shoulder pain: A randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2010/09

644

No effect of osteopathic treatment on trunk morphology and spine flexibility in young women with adolescent idiopathic scoliosis
Hasler, C., Schmid, C., Enggist, A., Neuhaus, C., Erb, T.
Journal of Children's Orthopaedics, 2010/06
Free full text

645

Comparison of muscle energy technique and positional release therapy in acute low back pain – RCT
Naik, P. P., Heggannavar, A., Khatri, S. M.
Indian Journal of Physiotherapy & Occupational Therapy, 2010/06
Free full text


647

Osteopathic Diagnosis and Treatment of Dorsalgia Caused by Disturbance of Proprioception in the Cervical Spine
Lepin, A. L., Mokhov, D. E., Novoseltsev, S. V.
The AAO Journal, 2010/06
Free full text




651

Brief report of a clinical trial on the duration of middle ear effusion in young children using a standardized osteopathic manipulative medicine protocol
Steele, K. M., Viola, J., Burns, E., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text


653

Osteopathic manual therapy versus conventional conservative therapy in the treatment of temporomandibular disorders: a randomized controlled trial
Cuccia, A. M., Caradonna, C., Annunziata, V., Caradonna, D.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text

654

Effect of osteopathy in the cranial field on visual function--a pilot study
Sandhouse, M. E., Shechtman, D., Sorkin, R., Drowos, J. L., Caban-Martinez III., A. J., Patterson, M. M., Shallo-Hoffmann, J., Hardigan, P., Snyder, A.
The Journal of the American Osteopathic Association, 2010/04
Free full text

655

Efficacy of osteopathic manipulation as an adjunctive treatment for hospitalized patients with pneumonia: a randomized controlled trial
Noll, D. R., Degenhardt, B. F., Morley, T. F., Blais, F. X., Hortos, K. A., Hensel, K., Johnson, J. C., Pasta, D. J., Stoll, S. T.
Osteopathic Medicine and Primary Care, 2010/03
Free full text

656

Effectiveness of muscle energy technique on quadratus lumborum in acute low back pain-randomized controlled trial
Patil, P. N., Chandu, B., Metgud, S., Khatri, S.
Indian Journal of Physiotherapy & Occupational Therapy, 2010/01
Free full text

657

Osteopathic manipulative treatment of back pain and related symptoms during pregnancy: a randomized controlled trial
Licciardone, J. C., Buchanan, S., Hensel, K. L., King, H. H., Fulda, K. G., Stoll, S. T.
American Journal of Obstetrics & Gynecology, 2010/01
Free full text



660

Using Osteopathic Manipulations to Decrease the Incidence of Acute Mountain Sickness
Abo, B. N., Garcia-Russell, N., Hiserote, R. M., Wong, T., Hakopian, D. K., Burns, J. M., Ekholm, R. K.
The Journal of the American Osteopathic Association, 2010/01




664

Reprint of: a preliminary assessment of the impact of cranial osteopathy for the relief of infantile colic
Hayden, C., Mullinger, B.
Complementary Therapies in Clinical Practice, 2009/11





669

The immediate effect of individual manipulation techniques on pulmonary function measures in persons with chronic obstructive pulmonary disease
Noll, D. R., Johnson, J. C., Baer, R. W., Snider, E. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text







676

Hamstring flexibility in young women following passive stretch and muscle energy technique
Shadmehr, A., Hadian, M. R., Naiemi, S. S., Jalaie, S.
Journal of Back and Musculoskeletal Rehabilitation, 2009/09

677

Análisis de la fiabilidad palpatoria del pulso en la arteria radial mediante sonografía Doppler
(Analysis of the reliability of radial artery pulse palpation through Doppler sonography)
Cortés Vega, M. D., Rodríguez Blanco, C., González García, P., Ribelles Mayo, J., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09

678

Fibromyalgia Treatment Trial With Gabapentin and Osteopathic Manipulative Medicine
Bernard, N., Marske, C. S., Palacios, A., Preiss, B., Bhattacharya, S., Brown, M., Wheeler, C., Fatunde, T.
Journal of Osteopathic Medicine, 2009/08

679

The effects of high-velocity low-amplitude thrust manipulation and mobilisation techniques on pressure pain threshold in the lumbar spine
Thomson, O. P., Haig, L., Mansfield, H.
International Journal of Osteopathic Medicine, 2009/06




683




686

Osteopathic Manipulative Treatment as Adjuvant Therapy in Peripheral Arterial Disease.
Lombardini, R., Collebrusco, L.
Manual Therapy, 2009/03
Free full text

687

Cranial palpation pressures used by osteopathy students: effects of standardized protocol training
Zegarra-Parodi, R., de Chauvigny de Blot, P., Rickards, L. D., Renard, E.O.
The Journal of the American Osteopathic Association, 2009/02
Free full text



690

Changes in Salivary a–Amylase After Osteopathic Manipulative Treatment
Fisher, J. F., Henderson, A. T., Li, T. S., Bridges, K. G.
The Journal of the American Osteopathic Association, 2009/01

691

Changes in masseter muscle trigger points following strain-counterstrain or neuro-muscular technique
Ibanez-Garcia, J., Alburquerque-Sendin, F., Rodriguez-Blanco, C., Girao, D., Atienza-Meseguer, A., Planella-Abella, S., Fernandez-de-Las Penas, C.
Journal of Bodywork and Movement Therapies, 2009/01

692

Short-term effect of muscle energy technique on pain in individuals with non-specific lumbopelvic pain: a pilot study
Selkow, N. M., Grindstaff, T. L., Cross, K. M., Pugh, K., Hertel, J., Saliba, S.
Journal of Manual & Manipulative Therapy, 2009/01

693

Salivary IgA Fluctuations in Response to Stress and Osteopathic Manipulative Treatment
Norton, J., Pilc, J., Saggio, G., Gilliar, W.
The Journal of the American Osteopathic Association, 2009/01


695

Influence of a mobilization of the mesentery on the hepatic portal vein capacity measured with doppler echo
van Dun, P. L. S., Dobbelaere, E., Dillies, P., Inghelbrecht, F., Van Eeghem, P., Steyaert, L., Danse, E., Rosseel, Y.
International Journal of Osteopathic Medicine, 2008/12

696

Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with chronic rhino sinusitis (CRS)? A randomized controlled trial
Steinbauer, U., Roos, S., Amann, P., Schwerla, F., Resch, K.L.
International Journal of Osteopathic Medicine, 2008/12

697

Study on the effectiveness of a test-dependent osteopathic treatment for women with persistent post partum back pain: A randomized controlled trial
Recknagel, C., Roß, J., Recknagel, A., Ruetz, M., Schwerla, F.
International Journal of Osteopathic Medicine, 2008/12

698

A randomised controlled trial on the effectiveness of osteopathic manipulative treatment of chronic low back pain
Mandara, A., Fusaro, A., Musicco, M., Bado, F.
International Journal of Osteopathic Medicine, 2008/12




702

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques: a pilot crossover trial
Rivers, W. E., Treffer, K. D., Glaros, A. G., Williams, C. L.
The Journal of the American Osteopathic Association, 2008/11
Free full text








710

A comparison of two muscle energy techniques for increasing flexibility of the hamstring muscle group
Smith, M., Fryer, G.
Journal of Bodywork and Movement Therapies, 2008/10

711

Clinical and research protocol for osteopathic manipulative treatment of elderly patients with pneumonia
Noll, D. R., Degenhardt, B. F., Fossum, C., Hensel, K.
The Journal of the American Osteopathic Association, 2008/09
Free full text

712

CV4 Alters Autonomic Balance During Paced Breathing
Ananyev, D. A., Rodriguez Jr., C., Mercado, R., Bagla, A., Seffinger, M., Wagner, E. J.
Journal of Osteopathic Medicine, 2008/08

713

The Use of Osteopathic Manipulation to Address Pulmonary Distress as Related to Asthma in Southwest Virginia
Latter, M. L.
The Journal of the American Osteopathic Association, 2008/08

714

Efficacy of Manipulative Treatment for Acute Low Back Pain in Active Duty Military Personnel
Stoll, S. T., Maurer, D., Hensel, K., Cruser, D.
The Journal of the American Osteopathic Association, 2008/08

715

Osteopathic Manipulative Medicine in the Treatment of Acute Otitis Media Symptoms
Torres, J. W., Mason, D. C., Kaari, J.
The Journal of the American Osteopathic Association, 2008/08

716

Atopische Dermatitis: (osteopathische) Hand anlegen!
(Atopic dermatitis: (osteopathic) hands on!)
Oezbay, I., Reckwerth, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

717

Osteopathic Manipulative Treatment for Postoperative Nausea and Vomiting
Schrick-Senasac, S. L., King, H. H.
The Journal of the American Osteopathic Association, 2008/08



720

Relationship of Osteopathic Manipulative Treatment During Labor and Delivery on Selected Maternal Morbidity Outcomes: A Randomized Controlled Trial
Keurentjes, A., Showalter, A., James, C., Vawter, A., Cross, B. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text

721

Osteopathic treatment of patients with chronic non-specific neck pain: a randomised controlled trial of efficacy
Schwerla, F., Bischoff, A., Nurnberger, A., Genter, P., Guillaume, J.P., Resch, K.L.
Forschende Komplementärmedizin, 2008/07

722

Immediate effects of osteopathic manipulative treatment in elderly patients with chronic obstructive pulmonary disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text



725

Fascia - key for stability, sensomotor function and symmetry
Geiger, A.
Unpublished MSc thesis, 2008/01
Free full text

726

Psychological response in spinal manipulation (PRISM): a systematic review of psychological outcomes in randomised controlled trials
Williams, N. H., Hendry, M., Lewis, R., Russell, I., Westmoreland, A., Wilkinson, C.
Complementary Therapies in Medicine, 2007/12
Free full text








734

The Effect of Cranial Osteopathic Treatment on Visual Function
Caban-Martinez, A., Timoshkin, E., Sandhouse, M. E., Shechtman, D., Fecho, G., Snyder, A., Patterson, M., Shallo-Hoffmann, J., Hardigan, P.
The Journal of the American Osteopathic Association, 2007/08

735

A Pilot Clinical Trial of Osteopathic Manipulative Treatment During Third Trimester Pregnancy
Licciardone, J. C., Buchanan, S., Fulda, K., Hensel, K., King, H. H., Stoll, S. T.
The Journal of the American Osteopathic Association, 2007/08

736

Teaching Palpatory Force to Osteopathic Medical Students
Marchioni, R. M., Badoolah, A. H., Caban-Martinez, A., Patterson, M. M.
The Journal of the American Osteopathic Association, 2007/08

737

The effects of high-velocity, low-amplitude manipulation and muscle energy technique on suboccipital tenderness
Hamilton, L., Boswell, C., Fryer, G.
International Journal of Osteopathic Medicine, 2007/06

738

Treatment of Primary Raynaud`s Syndrome with Osteopathy
Kalcakosz-Takacs, T.
Unpublished MSc thesis, 2007/03
Free full text

739

Infantile postural asymmetry and osteopathic treatment: A randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2007/03
Free full text


741

The Influence of Osteopathy on ADHD
Hubmann, B.
Unpublished MSc thesis, 2007/03
Free full text

742

Osteopathic Treatment and Stress Incontinence, in Combination with Biofeedback
Brix, S.
Unpublished MSc thesis, 2007/03
Free full text

743

Can Vital Capacity be Improved by Osteopathic Treatment of the Mediastinum?
Wieser, R.
Unpublished MSc thesis, 2007/01
Free full text

744

Teaching critical appraisal: a pilot randomized controlled outcomes trial in undergraduate osteopathic medical education
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/11
Free full text







751

The Effects of OMT on Median Nerve Size and Function in Patients with Carpal Tunnel Syndrome
Feathers, T. A., Foley, W. M., Panzone, J., Lyons, J. B., Stewart, P. E., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/08

752

Effect of OMT on Myofascial Somatic Dysfunction and Objective Parameters of Severity in Patients with Carpal Tunnel Syndrome
Foley, W. M., Kuchera, M. L., Lyons, J. B., Panzone, J., Yahnert, J. L., Stewart, P. E.
The Journal of the American Osteopathic Association, 2006/08

753

The Immediate Effects of the Splenic Pump Technique on Blood Cell Counts in Normal Adults
Harpenau, C. M., Inoue, A., Johnson, J. C., Chamberlain, N. R., Jadoon-Khamash, E., Noll, D. R.
The Journal of the American Osteopathic Association, 2006/08

754

The Immediate Effects of the Splenic Pump on Serum Level of C-reactive Protein in Normal Adults
Inoue, A., Harpenau, C. M., Chamberlain, N. R., Johnson, J. C., Jadoon-Khamash, E., Noll, D. R.
The Journal of the American Osteopathic Association, 2006/08


756

Improving Symptoms, Pain, Functioning, and Strength for Persons with Carpal Tunnel Syndrome
Meyer, P., Stoll, S. T., Cruser, D., White, H. D., Whitesell, R.
The Journal of the American Osteopathic Association, 2006/08

757

Chronic Obstructive Pulmonary Disease (COPD): Immediate Effects of Osteopathic Manipulative Treatment on Exercise Tolerance and Dyspnea
Pickett, C., Stoll, S. T., Cruser, D., Cipher, D. J.
The Journal of the American Osteopathic Association, 2006/08

758

Osteopathic Manipulative Medicine for Carpal Tunnel Syndrome: Changes in Nerve Conduction
White, H. D., Stoll, S. T., Cruser, D., Whitesell, R., King, H. H.
The Journal of the American Osteopathic Association, 2006/08

759

Blinding protocols, treatment credibility, and expectancy: methodologic issues in clinical trials of osteopathic manipulative treatment
Licciardone, J. C., Russo, D. P.
The Journal of the American Osteopathic Association, 2006/08
Free full text

760

Changes in active mouth opening following a single treatment of latent myofascial trigger points in the masseter muscle involving post-isometric relaxation or strain/counterstrain
Blanco, C. R., de las Penas, C. F., Xumet, J. E., Algaba, C. P., Rabadan, M. F., de la Quintana, M. C.
Journal of Bodywork and Movement Therapies, 2006/07

761

The osteopathic approach in the treatment of asymmetric infant
Kollingbaum-Fabian, S.
Unpublished MSc thesis, 2006/07
Free full text

762

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05




766

A preliminary assessment of the impact of cranial osteopathy for the relief of infantile colic
Hayden, C., Mullinger, B.
Complementary Therapies in Clinical Practice, 2006/05
Free full text

767

Gross range of motion in the cervical spine: the effects of osteopathic muscle energy technique in asymptomatic subjects
Burns, D. K., Wells, M. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text



770

The effect of different rates of application of a rib raising technique on cardiovascular and respiratory measures in asymptomatic individuals
Farthing, R., Gosling, C., Williams, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2006/03

771

In vitro biophysical strain model for understanding mechanisms of osteopathic manipulative treatment
Dodd, J. G., Good, M. M., Nguyen, T. L., Grigg, A. I., Batia, L. M., Standley, P. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text


773

Infantile postural asymmetry and osteopathic treatment: a randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2006/01
Free full text











784

The effect of manual pressure release on myofascial trigger points in the upper trapezius muscle
Fryer, G., Hodgson, L.
Journal of Bodywork and Movement Therapies, 2005/10




788

A Pilot Clinical Trial of Osteopathic Manipulative Treatment in Pregnancy
Licciardone, J. C., Buchanan, S., Pim, K. H., Cruser, D., Stoll, S. T.
The Journal of the American Osteopathic Association, 2005/07

789

Intraocular Pressure Correlated with Osteopathic Manipulative Treatment
Nye, Z. B., Nye, D. M., Multack, R. F., Glonek, T.
The Journal of the American Osteopathic Association, 2005/07

790

Preoperative intravenous morphine sulfate with postoperative osteopathic manipulative treatment reduces patient analgesic use after total abdominal hysterectomy
Goldstein, F. J., Jeck, S., Nicholas, A. S., Berman, M. J., Lerario, M.
The Journal of the American Osteopathic Association, 2005/06
Free full text

791

Cannabimimetic effects of osteopathic manipulative treatment
McPartland, J. M., Giuffrida, A., King, J., Skinner, E., Scotter, J., Musty, R. E.
The Journal of the American Osteopathic Association, 2005/06
Free full text

792

The effect of osteopathy in the treatment of chronic low back pain – a feasibility study
Kirk, L., Underwood, M., Chappell, L., Martins-Mendez, M., Thomas, P.
International Journal of Osteopathic Medicine, 2005/03

793

Intramuscular ketorolac versus osteopathic manipulative treatment in the management of acute neck pain in the emergency department: a randomized clinical trial
McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/02
Free full text

794

Cranial manipulation can alter sleep latency and sympathetic nerve activity in humans: a pilot study
Cutler, M. J., Holland, B. S., Stupski, B. A., Gamber, R. G., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2005/02

795

The effect of a muscle energy stretch on suboccipital tenderness
Boswell, C.
Unpublished MSc thesis, 2005/01
Free full text



798

The effect of mobilisation on pressure pain thresholds in the lumbar spine
Medle, M.
Unpublished MSc thesis, 2005/01
Free full text





803

Effects of osteopathic manipulative treatment on pediatric patients with asthma: a randomized controlled trial
Guiney, P. A., Chou, R., Vianna, A., Lovenheim, J.
The Journal of the American Osteopathic Association, 2005/01
Free full text

804

Cost-utility analysis of osteopathy in primary care: results from a pragmatic randomized controlled trial
Williams, N. H., Edwards, R. T., Linck, P., Muntz, R., Hibbs, R., Wilkinson, C., Russell, I., Russell, D., Hounsome, B.
Family Practice, 2004/12
Free full text




808

Effectiveness and efficiency of a primary care based osteopathy clinic for spinal pain
Williams, N. H.
Unpublished PhD thesis, 2004/10
Free full text

809


810

Investigating the effects of OMT on stimulating the adrenal glands for the treatment of asthma. Phase II: asthmatic subjects
Bovet, P. M., White, J., Bailey, J. M., Munkacsy, J. M., Anclam, J. R., Boesler, D., Finnerty, E. P.
Journal of Osteopathic Medicine, 2004/08

811

Effects of Osteopathic Manipulative Treatment on Symptom Severity and Functional Status in Carpal Tunnel Syndrome
Meyer, P. M., Stoll, S. T., Cruser, D., White, H. D., Whitesell, R., Angel, L.
The Journal of the American Osteopathic Association, 2004/08

812

The effect of osteopathic manipulative treatment on immune response to the influenza vaccine in nursing homes residents: a pilot study
Noll, D. R., Degenhardt, B. F., Stuart, M. K., Werden, S., McGovern, R. J., Johnson, J. C.
Alternative Therapies In Health And Medicine, 2004/07


814

A randomized controlled trial of osteopathic manipulative treatment following knee or hip arthroplasty
Licciardone, J. C., Stoll, S. T., Cardarelli, K. M., Gamber, R. G., Swift, J. N., Jr., Winn
The Journal of the American Osteopathic Association, 2004/05
Free full text

815

Dreimonatskolik: Osteopathie klinisch klar überlegen
(Colic children: Osteopathy markedly superior)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05


817

The effect of manipulation and mobilisation on pressure pain thresholds in the thoracic spine
Fryer, G., Carub, J., McIver, S.
Journal of Osteopathic Medicine, 2004/04

818

Effectiveness of a sham protocol and adverse effects in a clinical trial of osteopathic manipulative treatment in nursing home patients
Noll, D. R., Degenhardt, B. F., Stuart, M., McGovern, R., Matteson, M.
The Journal of the American Osteopathic Association, 2004/03
Free full text

819

Interdisciplinary approach to teaching medication adherence to pharmacy and osteopathic medical students
Singla, D. L., MacKinnon, G. E., 3rd, MacKinnon, K. J., Younis, W., Field
The Journal of the American Osteopathic Association, 2004/03
Free full text

820

The short term effects of muscle energy technique on thoracic range of motion
Daly, M.
Unpublished MSc thesis, 2004/01
Free full text







827

Lasting effects of atlanto-axial manipulation on edge light pupil cycle time
Olarenshaw, A.
Unpublished MSc thesis, 2004/01
Free full text

828

Osteopathic treatment to patients with primary dysmenorrhea
Pirritano, R.
Unpublished MSc thesis, 2004/01
Free full text

829

Emu oil for osteoarthritic hand pain
Power, R.
Unpublished MSc thesis, 2004/01
Free full text

830



832

Randomized osteopathic manipulation study (ROMANS): pragmatic trial for spinal pain in primary care
Williams, N. H., Wilkinson, C., Russell, I., Edwards, R. T., Hibbs, R., Linck, P., Muntz, R.
Family Practice, 2003/12
Free full text






838

Muscle energy technique in patients with acute low back pain: a pilot clinical trial
Wilson, E., Payton, O., Donegan-Shoaf, L., Dec, K.
Journal of Orthopaedic & Sports Physical Therapy, 2003/09

839

Osteopathic manipulative treatment in the emergency department for patients with acute ankle injuries
Eisenhart, A. W., Gaeta, T. J., Yens, D. P.
The Journal of the American Osteopathic Association, 2003/09
Free full text

840

The use of osteopathic manipulative treatment as adjuvant therapy in children with recurrent acute otitis media
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F.
Archives of Pediatrics & Adolescent Medicine, 2003/09
Free full text

841

Determining the Impact of Osteopathic Manipulative Therapy in the Management of Irritable Bowel Syndrome
Chiesa, J. C., Pomerantz, S. C., Shinkle, J. W., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08

842

Cranio-Sacral CV-4 Can Decrease Sleep Latency In Healthy Humans
Cutler, M. J., Holland, B. S., Gamber, R. G., Smith, M. L.
The Journal of the American Osteopathic Association, 2003/08

843

Osteopathic Manipulative Therapy (OMT) as a Non-pharmacological Treatment for Stable Patients with Emphysema and Chronic Bronchitis
Morley, T. F., Shinkle, J. W., Pomerantz, S. C., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08

844

Osteopathic manipulative treatment for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Stoll, S. T., Fulda, K. G., Russo, D. P., Siu, J., Winn, W., Swift, J.
Spine (Phila Pa 1976), 2003/07










854

Impact of Osteopathic Manual Medicine in Patients with Knee Osteoarthritis
Degenhardt, B. F., Kenney, R. G., McGovern, R. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/08

855

The Effects of Cranial Manipulation on Visual Function - A Pilot Study
Greenblatt, J., Sandhouse, M. E., Shechtman, D., Sorkin, R., Patterson, M., Hardigan, P., Snyder, A., Shallo-Hoffmann, J.
The Journal of the American Osteopathic Association, 2002/08

856

A Randomized Controlled Trial of Osteopathic Manipulative Treatment in Chronic, Non-Specific Low Back Pain
Licciardone, J. C., Stoll, S. T., Fulda, K., Russo, D. P., Siu, J., Winn, W., Swift Jr., J.
The Journal of the American Osteopathic Association, 2002/08

857

Effect of Osteopathic Manipulative Treatment (OMT) On Recurrent Acute Otitis Media in Children
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F., Worden, K.
The Journal of the American Osteopathic Association, 2002/08

858

The Immediate Effect of OMT on Pulmonary Function Parameters in Obstructive Pulmonary Disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2002/08

859

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text

860

Osteopathic manipulative treatment in conjunction with medication relieves pain associated with fibromyalgia syndrome: results of a randomized clinical pilot project
Gamber, R. G., Shores, J. H., Russo, D. P., Jimenez, C., Rubin, B. R.
The Journal of the American Osteopathic Association, 2002/06
Free full text


862

Comparison of effects of spinal manipulation and massage on motoneuron excitability
Dishman, J. D., Bulbulian, R.
Journal of Osteopathic Medicine, 2001/10

863

Long-term effects of specific stabilizing exercises for first-episode low back pain
Hides, J., Jull, G., Richardson, C.
Journal of Osteopathic Medicine, 2001/10

864


865

Cervical mobilisation: concurrent effects on pain, sympathetic nervous system activity and motor activity
Sterling, M., Jull, G., Wright, A.
Journal of Osteopathic Medicine, 2001/10

866

Specific manipulative therapy treatment for chronic lateral epicondylalgia produces uniquely characteristic hypoalgesia
Vicenzino, B., Paungmali, A., Buratowski, S., Wright, A.
Journal of Osteopathic Medicine, 2001/10

867

A Pilot Study Assessing Effects of OMT on Immune Changes Associated Wth Academic Stress
Joshi, B. P., Plotkin, B. J., Viselli, S. M.
The Journal of the American Osteopathic Association, 2001/09

868

Adjunctive osteopathic manipulative treatment in women with depression: a pilot study
Plotkin, B. J., Rodos, J. J., Kappler, R., Schrage, M., Freydl, K., Hasegawa, S., Hennegan, E., Hilchie-Schmidt, C., Hines, D., Iwata, J., Mok, C., Raffaelli, D.
The Journal of the American Osteopathic Association, 2001/09
Free full text

869

Effect of Pre-Emptive Morphine and Postoperative Osteopathic Manipulative Technique on Pain Following Total Abdominal Hysterectomy: A Pilot Study
Goldstein, F., Jeck, S., Nicholas, A., Berman, M., Lerario, M.
The Journal of the American Osteopathic Association, 2001/08

870

The Effects of OMT on Vital Signs During Headache
Parikh, A. S.
The Journal of the American Osteopathic Association, 2001/08

871

A randomized clinical trial of exercise and spinal manipulation for patients with chronic neck pain
Bronfort, G., Evans, R., Nelson, B., Aker, P. D., Goldsmith, C. H., Vernon, H.
Journal of Osteopathic Medicine, 2001/04


873

Pressure pain threshold and needle acupuncture in chronic tension-type headache- a double-blind placebo-controlled study
Karst, M., Rollnik, J. D., Fink, M., Reinhard, M., Piepenbrock, S.
Journal of Osteopathic Medicine, 2001/04

874

The effect of strength training and reduced training on rotator cuff musculature
McCarrick, M. J., Kemp, J. G.
Journal of Osteopathic Medicine, 2001/04

875

Benefits of osteopathic manipulative treatment for hospitalized elderly patients with pneumonia
Noll, D. R., Shores, J. H., Gamber, R. G., Herron, K. M., Swift, J.
The Journal of the American Osteopathic Association, 2000/12
Free full text

876

A Randomized Controlled Trial of Osteopathic Manipulation Following Knee or Hip Arthroplasty
Licciardone, J. C., Stoll, S. T., Herron, K. M., Gamber, R. G., Swift, J., Winn, W.
The Journal of the American Osteopathic Association, 2000/08

877

Effects of Osteopathic Manipulative Treatment on Knee Osteoarthritis
Pham, C. N., Knebl, J.
The Journal of the American Osteopathic Association, 2000/08

878

Efficacy of a steroid nasal spray compared with an antihistamine nasal spray in the treatment of perennial allergic rhinitis
Berlin, J. M., Golden, S. J., Teets, S., Lehman, E. B., Lucas, T., Craig, T. J.
The Journal of the American Osteopathic Association, 2000/07
Free full text


880

A comparison of osteopathic spinal manipulation with standard care for patients with low back pain
Andersson, G. B., Lucente, T., Davis, A. M., Kappler, R. E., Lipton, J. A., Leurgans, S.
The New England Journal of Medicine, 1999/11
Free full text



883

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain. A randomized controlled trial)
Adorjàn-Schaumann, A., Höhrhan, G., Wille, H., Wolff, A.
Unpublished D.O. thesis, 1999/10

884

The Effectiveness of CV-4 and Resting Position Techniques on Subjects with Tension-Type Headaches
Hanten, William P., Olson, Sharon L., Hodson, Jennifer L., Imler, Vickie L., Knab, Virginia M., Magee, Jennifer L.
Journal of Manual & Manipulative Therapy, 1999/04/01

885

Adjunctive osteopathic manipulative treatment in the elderly hospitalized with pneumonia: a pilot study
Noll, D. R., Shores, J., Bryman, P. N., Masterson, E. V.
Journal of Osteopathic Medicine, 1999/03
Free full text

886

Effect of lymphatic and splenic pump techniques on the antibody response to hepatitis B vaccine: a pilot study
Jackson, K. M., Steele, T. F., Dugan, E. P., Kukulka, G., Blue, W., Roberts, A.
Journal of Osteopathic Medicine, 1998/03

887

The effects of muscle energy technique on lumbar range of motion
Schenk, R. J., MacDiarmid, A., Rousselle, J.
Journal of Manual and Manipulative Therapy, 1997/10

888

A randomized comparison of continuous versus interrupted mass closure of midline incisions in patients with gynecologic cancer
Colombo, M., Maggioni, A., Parma, G., Scalambrino, S., Milani, R.
Obstetrics & Gynecology, 1997/05


 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends