Advanced search



 
 79.6% of the records
 
 20.4 % of the records
 
 57.6 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumablack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3cability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxishair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

2523 results (please see below)  Sort:    
1

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2026/01
2

A.T. Stills „Finding health …“ – Ad fontes!
Dippon, M.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
3

Die Stimme im Einfluss des kraniosakralen Systems
(The voice under the influence of the cranio-sacral system)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
4

Einfluss der osteopathischen Behandlung auf das Verdauungssystem von Säuglingen
(Influence of osteopathic treatment on the digestive system of infants)
Pernikar, N.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
5

Wann kann man ein Ausfallhonorar berechnen?
(When can you charge a cancellation fee?)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
6

Psychosoziale Aspekte chronischer Schmerzen aus interdisziplinärer Perspektive
Zöller, E., Feld, K.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
7

Profiling Osteopathy in New Zealand: Insights into Practitioner Engagement with Accident Compensation Corporation (ACC) and Musculoskeletal (MSK) Care
Sampath, K. K., Berg, N., Paine, J. L., Orrock, P., Standen, C.
International Journal of Osteopathic Medicine, 2025/12
8

Palpation and its learning: A professionalization approach to acquiring a complex skill
Rosenzweig, F., Feruglio, R., Marin, T.
International Journal of Osteopathic Medicine, 2025/12
9

General Osteopathic Treatment: Status quo – Teil 2
(General Osteopathic Treatment: Status Quo – Part 2)
Engel, M.
Osteopathische Medizin, 2025/12
10

Journal Club 2025 – 3
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2025/12
11

Geschichte des osteopathischen Ansatzes für den ganzen Körper
(History of the osteopathic approach to the whole body)
Jarvis, L.
Osteopathische Medizin, 2025/12
12

Novellierung der GOÄ 2025 – Osteopathische Leistungen enthalten
(Amendment to the GOÄ 2025 – including Osteopathic services)
Kramme, P., Rings, V.
Osteopathische Medizin, 2025/12
13

Wie geht Beruf? – Teil 1: Gesetzgebungsverfahren, Heilberufe und Status quo der Osteopathie in Deutschland
(How does the profession work? – Part 1: Legislative process, healthcare professions, and the status quo of osteopathy in Germany)
Newiger, C.
Osteopathische Medizin, 2025/12
14

Aus der digitalen Welt: Das glymphatische System
(From the digital world: The glymphatic system)
Sonntag, M.
Osteopathische Medizin, 2025/12
15

Original Thoughts on Cranial History and Glymphatics
Laughlin, P.
AAO Journal, 2025/12
16

The State of Osteopathic Physicians in Orthopaedic Training and Academic Practice
Cohn, R. M., Bitterman, A. D.
Journal of the American Academy of Orthopaedic Surgeons, 2025/12
17

Cancer Prevention and Therapy With Nutritional Science: Addressing the Gap in Medical Education and Practice
Collignon, T. E., Bishayee, A.
MedComm, 2025/11
Free full text
18

Identifying somatic and social concerns that may suggest an underlying mental health condition in pediatric primary care
Shubrook, C., Breneisen, K., Pottenger, M.
Journal of Osteopathic Medicine, 2025/11
Free full text
19

Artificial intelligence and osteopathic medicine: preserving human-centered care in an era of technological advancement
Newhardt, R., O'Connell, M., Lin, M. S., Bray, N. N.
Journal of Osteopathic Medicine, 2025/10
Free full text
20

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10
21

Dr. William Garner Sutherland (1873-1954): A Pioneer in Cranial Osteopathy
Griswold, S. R., Brask, A. S., Bhakta, K. D., Campbell, A. M., Smith-Gonzalez, A. R.
Cureus, 2025/10
Free full text
22

The Spinal Facilitation Hypothesis and Reflex Arcs in Modern Osteopathic Medicine
Bordoni, B., Simonelli, M., Morabito, B., Escher, A. R.
Cureus, 2025/09
Free full text
23

Das Scoping Review in der osteopathischen Forschung
(The scoping review in osteopathic research)
Bechter, L.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09
24

Funktionelle Suturenbögen
(Functional suture loops)
Kamp, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09
25

Liquorlymphatische Kopplung – eine neue Sicht auf die Entsorgungswege des ZNS
(Glymphatic-lymphatic coupling – A new perspective on the disposal pathways of the CNS)
Peuker, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09
26

Abstracts From the Third Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 13, 2025
Akenami, F. O., Ismail, R., Obando Solano, C. P., Amalfitano, A.
Spartan Medical Research Journal, 2025/09
Free full text
27

Quand l’ostéopathe attire plus que l’hôpital : réflexions sur la centralisation informelle des soins musculosquelettiques autour d’un praticien rare au Cameroun
(When the osteopath attracts more than the hospital: Reflections on the informal centralization of musculoskeletal care around a rare practitioner in Cameroon)
Npochinto Moumeni, I.
Kinesitherapie, 2025/09
28

Understanding specific, contextual and non-specific effects in osteopathy
Tripodi, N., Lawton, A., Corcoran, D., Feehan, J.
International Journal of Osteopathic Medicine, 2025/09
Free full text
29

Development of a research mentorship program for Australian osteopaths
Eaves, S., Steel, A.
International Journal of Osteopathic Medicine, 2025/09
30

General Osteopathic Treatment: Status quo – Teil 1
(General Osteopathic Treatment: Status Quo – Part 1)
Engel, M.
Osteopathische Medizin, 2025/09
31

Journal Club 2025 – 2
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2025/09
32

Der Darm als Schlüssel zur ganzheitlichen Gesundheit
(The gut as key to holistic health)
Herberhold, M.
Osteopathische Medizin, 2025/09
33

Interdisziplinäre Perspektiven auf die Ankyloglossie: Diagnostik, Therapie und Evidenz
(Interdisciplinary perspectives on ankyloglossia: diagnosis, treatment, and evidence)
Moghtader, D., Vogt, R.
Osteopathische Medizin, 2025/09
34

Die geplante berufsgesetzliche Regelung der Osteopathie
(The planned professional regulation of osteopathy)
Newiger, C.
Osteopathische Medizin, 2025/09
35

Praktische Umsetzung der Studienergebnisse zur Osteopathie bei Dysmenorrhö
(Practical implementation of study results on osteopathy for dysmenorrhea)
Plathner, M.
Osteopathische Medizin, 2025/09
36

Предпосылки к формированию личного бренда врача-остеопата
Tregubova, E. S., Kuchina, O. V.
Russian Osteopathic Journal, 2025/09
37

The hospitalist’s paradox: on pay, perception, and the true value of a healer in the valley of the sun
MacDonald, G. P.
Journal of Osteopathic Medicine, 2025/08
Free full text
38

Private equity in healthcare: implications and policy recommendations
Jestin, M.
Journal of Osteopathic Medicine, 2025/07
Free full text
39

Das Karpaltunnelsyndrom in der Schwangerschaft aus osteopathischer Sicht
(Carpal tunnel syndrome in pregnancy from an osteopathic point of view)
Schneider-Milo, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
40

Wurzel mit Riechfunktion
(Root with olfactory function)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
41

Klinisch-funktionelle Anatomie des Lymphsystems für die osteopathische Behandlung
(Clinical-functional anatomy of the lymphatic system for osteopathic treatment)
Peuker, E., Scheuchl, F.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
42

The mechanism of muscle energy for a superiorly subluxed rib one
Teixeira, K., Russell, N., Huzij, T.
Journal of Osteopathic Medicine, 2025/07
Free full text
43

Building Community With Community: Collaborative Reflections on the Rural and Urban Community Orienting Experience (RUCOE)
Casapulla, S., Kropf, K., Kalout, S., Lingerak, S.
Teaching and Learning in Medicine, 2025/07
44

Pioneering the future: incorporating lifestyle medicine tools in osteopathic medical education
Bansal, S., Shubrook, J. H.
Journal of Osteopathic Medicine, 2025/07
Free full text
45

Forschung gewürdigt: 2. Nachwuchs-Wissenschaftspreis der Deutschen Osteopathie-Stiftung
(Research recognized: 2nd Young Scientist Award from the German Osteopathy Foundation)
Wehr, M.
Osteopathische Medizin, 2025/06
46

Technik zur Behandlung des Sonnengeflechts (Ganglia coeliaca)
(Technique for treating the solar plexus (celiac ganglia))
Liem, T.
Osteopathische Medizin, 2025/06
47

Die doppelte Facette der Identität der Osteopathie
(The dual facet of osteopathy's identity)
L'Hermite, P.L.
Osteopathische Medizin, 2025/06
48

Journal Club 2025 – 1
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2025/06
49

A.T. Still und die Viszera: Ein Überblick
(A.T. Still and the viscera: An overview)
Engel, M.
Osteopathische Medizin, 2025/06
50

Osteopathic approach to injuries of the overhead thrower’s shoulder
De Luigi, A. J., Raum, G. M., King, B. W., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/06
Free full text
51

Article Review: Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Daugereaux, S.
The AAO Journal, 2025/06
52

Prone Still Technique for an Upslipped Innominate
Hartwell, L. E., Gustafson, H. C., Rudberg-Post, L. J., Matz, O. C., Woolley, A. L.
The AAO Journal, 2025/06
53

Combined Myofascial Technique for a Second Posterior Sacral Segment Dysfunction
Stellon, A. G., Rudberg-Post, L. J., Gustafson, H. C., Hartwell, L. E., Matz, O. C., Woolley, A. L.
The AAO Journal, 2025/06
54

Osteoevidence: A User-Centric Database for Advancing Osteopathic Manipulative Medicine
Pollesel, A., Pollesel, G., Petrulaityte, A.
Medical Reference Services Quarterly, 2025/06
55

Integrative medicine
(Интегративная медицина)
Shabrov, A. V., Mokhov, D. E., Tregubova, E. S., Korotkov, K. G., Moiseev, V. I., Partsernyak, S. A.
Russian Osteopathic Journal, 2025/06
56

Personal brand of an osteopathic doctor as a promotion strategy in the market of medical services
(Личный бренд врача-остеопата как стратегия продвижения на рынке медицинских услуг)
Tregubova, E. S., Kuchina, O. V.
Russian Osteopathic Journal, 2025/06
57

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/06
58

Leadership and Capacity Building in International Osteopathic Research: introducing Strengthening Osteopathy Leadership and Research (SOLAR) Program
McIntyre, C., McLeod, G. A., Antunes Ferreira, A. P., Cerritelli, F., Draper-Rodi, J., Feehan, J., Fleischmann, M., Sampath, K. K., Morin, C., Muddle, L., Sinderholm Sposato, N., Thomson, O. P., Treffel, L., Tripodi, N., Vaughan, B., Steel, A., Adams, J.
International Journal of Osteopathic Medicine, 2025/06
Free full text
59

Elbow injuries in overhead throwing athletes: clinical evaluation, treatment, and osteopathic considerations
King, B. W., Raum, G. M., De Luigi, A. J., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/05
Free full text
60

Fostering Professionalism in Medical Education: the Common Ground Professionalism Initiative at Michigan State University College of Osteopathic Medicine
Jalaba, S., Ruger, K., Kerver, H.
Medical Science Educator, 2025/04
Free full text
61

Categorizing treatment mechanisms for Complementary and Integrative Musculoskeletal Interventions
Cook, C. E., Abraira, V. E., Burns, J., Degenhardt, B. F., Kawchuk, G., Keter, D., Loghmani, M. T., Reed, W. R., Winkelstein, B. A., McDevitt, A.
International Journal of Osteopathic Medicine, 2025/03
62

Context is complex: Challenges and opportunities addressing contextual factors in manual therapy mechanisms research
Keter, D. L., Esteves, J. E., Loghmani, M. T., Rossettini, G., Cook, C. E.
International Journal of Osteopathic Medicine, 2025/03
63

Advancing Equitable Osteopathic Practice: Integrating Person-Centredness & Addressing Racial Biases Through the Lens of Critical Theory
Mhadhbi, H., MacMillan, A., Draper-Rodi, J., Ménard, M., Sinderholm Sposato, N.
International Journal of Osteopathic Medicine, 2025/03
64

The Seven Drivers of Change in Osteopathic Education
Engel, R.
International Journal of Osteopathic Medicine, 2025/03
65

Die Rolle des Placebo-Effekts in der Osteopathie
(The role of the placebo effect in osteopathy)
Liem, T.
Osteopathische Medizin, 2025/03
66

„Du lebst und stirbst durch mich“: Das Zwerchfell im osteopathischen Kontext
(“You live and die through me“: the diaphragm in an osteopathic context)
Engel, M.
Osteopathische Medizin, 2025/03
67

Embryologie und Wirbelsäule – Teil 2: Entstehung und Entwicklung der Wirbel-, Bandscheiben- und Rippenanlagen
(Embryology and the spine - Part 2: Formation and development of the vertebrae, intervertebral discs and ribs)
Wojtowicz, A., Freeman, B., Dijs, P.
Osteopathische Medizin, 2025/03
68

Historische Denkmodelle der Iliosakralbewegungen – Teil 2: Fryette-Modell, Strachan-Modell und Mitchell-Modell
(Historical thought models of sacroiliac movements - Part 2: Fryette model, Strachan model and Mitchell model)
Koch, D.
Osteopathische Medizin, 2025/03
69

Strain Relief – Teil 5: Technische Ausführung: Behandlung von chronischen Beschwerden im Thorax, oberen Rücken und Nacken
(Strain Relief - Part 5: Technical implementation: Treatment of chronic complaints in the thorax, upper back and neck)
Liedtke, H.
Osteopathische Medizin, 2025/03
70

Wo steckt der Geist in der Osteopathie?: Zur Frage nach dem Menschen im 21. Jahrhundert
Kaiser, A. K.
Osteopathische Medizin, 2025/03
71

A. T. Still's “The Rule of Fluid, Nerve, Fascia, Muscle, and Bone”–An Investigation Beyond “The Rule of the Artery”
Fuller, D. B.
The AAO Journal, 2025/03
72

The Spiritual Component Of Still's Writings
Kimberly, P. E.
The AAO Journal, 2025/03
73

Possibility of using manual therapy and osteopathic correction for delayed speech and motor development in children
(Возможности применения мануальной терапии и остеопатической коррекции при задержке речевого и моторного развития у детей)
Bobko, A. Y., Bobko, Y. N., Adulas, E. I., Mizonova, I. B., Bulina, O. V., Suslova, G. A.
Russian Osteopathic Journal, 2025/03
74

Gaskell, Langley, and the “para-sympathetic“ idea
Brunet, J. F.
Elife, 2025/03
Free full text
75

Gender Health Gap und die Rolle der Osteopathie in der Frauenheilkunde
(Gender Health Gap and the role of osteopathy in gynecology)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
76

Die Milz
(The Spleen)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
77

Altersbedingte Veränderungen des autonomen Nervensystems
(Age-related changes in the autonomic nervous system)
Scheuchl, F., Peuker, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
78

Formen der funktionellen Harninkontinenz bei Kindern
(Forms of functional urinary incontinence in children)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
79

American Osteopathic History Tour 2024: eine Reise zu den Ursprüngen der Osteopathie
Wittchow, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
80

Protecting the profession: lessons from the recent physician scandals
Kelso, R. A., Schmidt, D., McLay, C.
Journal of Osteopathic Medicine, 2025/02
Free full text
81

Dr. William Garner Sutherland (1873-1954): The Founder of Cranial Osteopathy
Childs, B., Hammes, C.
Cureus, 2025/02
Free full text
82

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
83

„Blinded by the Light“: Implikationen der Verblindung in Studien zu Schmerztherapien
(“Blinded by the Light“: Implications of blinding in studies on pain therapies)
Daake, B.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
84

Heilungshindernisse
(Obstacles to healing)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
85

Cochlea-Implantat-Versorgung mit besonderem Blick auf die kindliche Versorgung
Lesinski-Schiedat, A.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
86

Dr. William Garner Sutherland: The Man Who Changed Osteopathy Forever
Sharath, H. V., Phansopkar, P., Qureshi, M. I., Raghuveer, R., Kaur, G.
Cureus, 2025/01
Free full text
87

Wirkungslos und teuer: Warum Osteopathie bei Babys sinnlos ist
Pannen, A.
Tagesspiegel, 2025/01
88

The rise of advanced practice provider independence bills: a misguided attempt to address the physician shortage
Bohler, F., Peters, G., Aggarwal, N., Harvey, K., Bohler, J. D.
Journal of Osteopathic Medicine, 2024/12
Free full text
89

Journal Club 2024 – 1
Franke, H., Rotter, G.
Osteopathische Medizin, 2024/12
90

Historische Denkmodelle der Iliosakralbewegungen – Teil 1: Relevanz der Biomechanik des Beckens
(Historical thought models of sacroiliac movements - Part 1: Relevance of pelvic biomechanics)
Koch, D.
Osteopathische Medizin, 2024/12
91

Bedrohung oder Chance – Das 150-jährige Bestehen der Osteopathie
(Threat or opportunity – Osteopathy's 150-year-existence)
Lewis, J.
Osteopathische Medizin, 2024/12
92

Das General Movement Assessment (GMA) in der osteopathischen Praxis
(The General Movement Assessment (GMA) in osteopathic practice)
Luthin, D.
Osteopathische Medizin, 2024/12
93

Strömungsdynamik in den Faszien
(Fluid dynamics in the fasciae)
Schleip, R.
Osteopathische Medizin, 2024/12
94

Embryologie und Wirbelsäule – Teil 1: Entstehung und Entwicklung der Somiten als Anlage der Wirbelsäule
(Embryology and the spinal column - Part 1: Origin and development of the somites as the anlage of the spinal column)
Wojtowicz, A., Freeman, B., Dijs, P.
Osteopathische Medizin, 2024/12
95

Haltung bewahren. Körperhaltung und OMT
Liem, T.
Naturheilpraxis, 2024/12
96

Prone Counterstrain Technique for a High Ilium Sacroiliac Tenderpoint
Hartwell, L. E., Gustafson, H. C., Rudberg-Post, L. J., Matz, O. C., Woolley, A. L.
The AAO Journal, 2024/12
97

An osteopathic method of history taking and physical examination: Part 1
Sutton, S. E.
The AAO Journal, 2024/12
98

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text
99

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10
100

Paradigmata der (ursprünglichen) Osteopathie
(Paradigms of (original) osteopathy)
Engel, M.
Osteopathische Medizin, 2024/09
101

Strain Relief – Teil 4: Technische Ausführung: Behandlung chronischer Schmerzen im Beckenring, unteren Rücken und Hüftgelenk
(Strain Relief - Part 4: Technical implementation: Treatment of chronic pain in the pelvic girdle, lower back and hip joint)
Liedtke, H.
Osteopathische Medizin, 2024/09
102

Chronic pain, complexity and a suggested role for the osteopathic profession
McDonald, H. N., Lowe, T. J.
International Journal of Osteopathic Medicine, 2024/09
103

ADHS bei Erwachsenen in der osteopathischen Praxis
(ADHD in adults in the osteopathic practice)
Plathner, M.
Osteopathische Medizin, 2024/09
104

Osteopathy: A potential ally against anorexia?
Mattatia, J.
Advances in Integrative Medicine, 2024/09
105

Young Doctors Program-Colorado: An Elective Elementary School Program to Improve Health Literacy, Utilization of the Healthcare System, and Osteopathic Awareness
Sposet, S., Fabich, R., McEchron, M.
Medical Science Educator, 2024/09
Free full text
106

Validität palpationsbasierter Messungen des Beckenschiefstands – eine Sekundäranalyse
(Validity of palpation-based measurements of pelvic obliquity - a secondary analysis)
Brandl, A., Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
107

Das Ellenbogengelenk: ein Multitalent
(The elbow joint: a multi-talent)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
108

Endometriose
(Endometriosis)
Engel-Schulmeyer, A., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
109

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
110

Das respiratorisch-zirkulatorische Modell in der osteopathischen Praxis
Tozzi, P.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
111

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text
112

„Wie der Ast gebogen wird, so wächst der Baum“
Teichmann, P.
Skeptiker, 2024/09
113

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text
114

The legislative position of the Osteopath in Italy after the Decree of the Ministry of Universities and Research of 29 November 2023, in agreement with the Minister of Health: implications in terms of professional responsibility and current shortcomings
D'Antonio, G., Del Prete, S., Naso, I., Berloco, T., Spadazzi, F., Delogu, G., Bolino, G.
La Clinica Terapeutica, 2024/08
Free full text
115

The establishment of conscientious monopolies in rural communities
Bohler, F., Garden, A.
Journal of Osteopathic Medicine, 2024/08
Free full text
116

Medical malpractice liability in large language model artificial intelligence: legal review and policy recommendations
Shumway, D. O., Hartman, H. J.
Journal of Osteopathic Medicine, 2024/07
Free full text
117

Pelvic Palpatory Tests in Manual Therapy and Osteopathy: A Critical Review of the Literature and Suggestions for New Research
Colonna, S., Mazzanti, M.
Cureus, 2024/07
Free full text
118

Использование информационных технологий в системе поддержки принятия решений востеопатии
(The application of information technologies in system of support of decision making in osteopathy)
Korotaevskiy, E. A., Kalinin, A. G., Karyakin, A. A., Martynova, N. A., Karyakina, O. E., Baranov, A. V.
Problemy Sotsialnoi Gigieny, Zdravookhranenniiai i Istor, 2024/07
119

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text
120

Kraft- und Spannungsübertragung in der unteren Extremität
(Transmission of force and tension in the lower extremity)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
121

Leitlinien in der Osteopathie: Pro und Kontra
(Guidelines in osteopathy: Pros and cons)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
122

Osteopathie und evidenzbasierte Medizin, Teil 3: Bedeutung der EBM für die Osteopathie
(Osteopathy and evidence-based medicine, part 3: Relevance of EBM for osteopathy)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
123

Lehre bereichert und verbindet – das Praxissemester
(Teaching enriches and connects – the practical semester)
Sander, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
124

Makroskopische Anatomie der Zähne und des Zahnhalteapparats
(Macroscopic anatomy of teeth and periodontium)
Schumann, S.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
125

Resonanz in der Osteopathie
Sonntag, M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
126

Leitlinien in der Osteopathie: Pro und Kontra
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
127

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06
128

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/06
129

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/06
130

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/06
Free full text
131

Selected issues of quality of medical care in the field of osteopathy
(Отдельные вопросы качества медицинской помощи по профилю «остеопатия»)
Belash, V. O., Tregubova, E. S.
Russian Osteopathic Journal, 2024/06
132

Short leg syndrome in clinical practice
(Синдром короткой ноги в клинической практике)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06
133

Wie es dazu kam, dass Osteopathie unterrichtet wurde
(How osteopathy came to be taught)
Haxton, J.
Osteopathische Medizin, 2024/06
134

Strain Relief – Teil 3: Technische Ausführung: Behandlung chronischer Schmerzen in der oberen Extremität
(Strain Relief - Part 3: Technical implementation: Treatment of chronic pain in the upper extremity)
Liedtke, H.
Osteopathische Medizin, 2024/06
135

Wie ich die Osteopathie begründete: Ein Artikel aus dem Ladies' Home Journal von 1908
(How I founded osteopathy: An article from the Ladies' Home Journal from 1908)
Still, A. T.
Osteopathische Medizin, 2024/06
136

The osteopathic concept after a century
Mackenzie, A. S.
The AAO Journal, 2024/06
Free full text
137

Osteopathic Approach to the Voice
Surve, S.
The AAO Journal, 2024/06
138

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text
139

Waste not, want not: call to action for spinal manipulative therapy researchers
Aspinall, S. L., Nim, C., Hartvigsen, J., Cook, C. E., Skillgate, E., Vogel, S., Hohenschurz-Schmidt, D., Underwood, M., Rubinstein, S. M.
Chiropractic & Manual Therapies, 2024/05
140

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05
141

Telehealth in opioid use disorder treatment: policy considerations for expanding access to care
Niyibizi, A., Haveric, A., Irio, G.
Journal of Osteopathic Medicine, 2024/04
Free full text
142

Augmentation of immune response to vaccinations through osteopathic manipulative treatment: a study of procedure
Sanchez, J., Martinez, E. S., Loveless, B., Sees, J. P., Zammuto, J., Szurmant, H., Fuchs, S., Crone, P., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/04
Free full text
143

A superficial dissection approach to the sphenopalatine (pterygopalatine) ganglion to emphasize osteopathic clinical relevance
Matz, O. C., Rudberg-Post, L. J., Gustafson, H. C., Matz, D. G.
Journal of Osteopathic Medicine, 2024/04
Free full text
144

Lumbar Spinal Stenosis: Diagnosis and Management
Webb, C. W., Aguirre, K., Seidenberg, P. H.
American Family Physician, 2024/04
145

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text
146

Relational clinical practice: A hermeneutic, enactive, intersubjective model of osteopathy
Banton, A., Vogel, S.
International Journal of Osteopathic Medicine, 2024/03
147

Combating Modern DO Stigmatization
Cooney, A., Vega, L., Goodwin, B. J., Adams, J., Mangrola, F., Price, L. M., Powell, L.
International Journal of Osteopathic Medicine, 2024/03
148

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03
149

Introduction to running analysis in the clinical setting: A masterclass
Tripodi, N., Feehan, J., Corcoran, D., Vaughan, B., McLaughlin, P.
International Journal of Osteopathic Medicine, 2024/03
Free full text
150

Werden osteopathische Studien zu Unrecht methodisch abgewertet?: Über die Ergebnisse einer meta-epidemiologischen Studie hinsichtlich der Verblindung von Teilnehmer*innen in randomisiert kontrollierten Studien
(Are osteopathic studies wrongly methodologically downgraded?: On the results of a meta-epidemiological study regarding the blinding of participants in randomized controlled trials)
Franke, H.
Osteopathische Medizin, 2024/03
Free full text
151

Strain Relief – Teil 2: Technische Ausführung: Behandlung chronischer Schmerzen in der unteren Extremität
(Strain Relief - Part 2: Technical performance: Treatment of chronic pain in the lower extremity)
Liedtke, H.
Osteopathische Medizin, 2024/03
152

Das GRADE-System und die Bewertung der Evidenz
(The GRADE system and the evaluation of evidence)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
153

Osteopathie und evidenzbasierte Medizin, Teil 2: Kritik an der EBM
(Osteopathy and evidence-based medicine, part 2: Criticism of EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
154

Funktionelle Anatomie der Interozeption
(Functional anatomy of interoception)
Luthin, D., Neuhuber, W.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
155

Der Schluckakt
(The act of swallowing)
Sergueef, N.
Osteopathische Medizin, 2024/03
156

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
157

Aus der digitalen Welt
(From the digital world)
Sonntag, M.
Osteopathische Medizin, 2024/03
Free full text
158

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
159

Neurofisiologia, interazioni neuro-immunitarie e meccanobiologia nell’osteopatia craniale. Una prospettiva basata sull’evidenza per un razionale scientifico
Casini, A., Barsotti, N., Chiera, M., Lunghi, C., Fornari, M., Lanaro, D.
PNEI REVIEW, 2024/03
160

Abstracts From the First Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 15, 2023
Amalfitano, A., Obando, P., Ismail, R., Akenami, F.
Spartan Medical Research Journal, 2024/03
Free full text
161

The Sentient Cell: Implications for Osteopathic Medicine
Bordoni, B., Escher, A. R., Castellini, F., Vale, J.
Cureus, 2024/02
Free full text
162

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text
163

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text
164

Issues of informed consent for non-specialists conducting colorectal cancer screenings
Bohler, F., Garden, A.
Journal of Osteopathic Medicine, 2024/01
Free full text
165

Supine counterstrain technique for rhomboid tender point
Matz, O. C., Gustafson, H. C., Hartwell, L. E., Rudberg-Post, L. J., Woolley, A. L.
Journal of Osteopathic Medicine, 2024/01
Free full text
166

Wie wirksam ist die osteopathische Behandlung von Kindern?
(How effective is osteopathic treatment for children?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
167

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
168

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
169

Das Mundatmungssyndrom in der osteopathischen Praxis
(Mouth breathing syndrome in the osteopathic practice)
Keller, M., Brümmer, M., Schulz, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
170

Mitleid und Mitgefühl
(Pity and compassion)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
171

Osteopathie und evidenzbasierte Medizin, Teil 1: die EBM
(Osteopathy and evidence-based medicine, part 1: EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
172

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
173

Features of the state of occlusion with partial loss of teeth (literature review
(Особенности состояния окклюзии при частичной потере зубов (обзор литературы)
Zhulev, E. N., Saakyan, M. Y., Vel'makina, I. V., Bragina, O. M., Vokulova, Y. A.
Russian Osteopathic Journal, 2023/12
174

„Alles im Griff” – Osteopathischer Universalgriff für das Kniegelenk
(“Everything under control“ - Osteopathic universal grip for the knee joint)
Engel, M.
Osteopathische Medizin, 2023/12
175

Osteopathie als Beruf: Zur Praxeologie des osteopathischen Handelns
(Osteopathy as a profession: The praxeology of osteopathic practice)
Kaiser, A. K.
Osteopathische Medizin, 2023/12
176

Strain Relief – Teil 1: Grundlagen: Ein neues Verfahren zur Behandlung chronischer Schmerzen im Bewegungsapparat am Beispiel von therapieresistenten, funktionellen Beschwerden in der unteren Extremität
(Strain Relief - Part 1: Basics: A new procedure for the treatment of chronic pain in the musculoskeletal system using the example of therapy-resistant, functional complaints in the lower extremities)
Liedtke, H.
Osteopathische Medizin, 2023/12
177

Psychosomatische Osteopathie
(Psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2023/12
178

Besonderheiten osteopathischer Forschung
(Peculiarities of osteopathic research)
Scheuchl, F., Peuker, E., Kamp, R.
Osteopathische Medizin, 2023/12
179

(Gender competence in medicine and osteopathy)
Wikus, P., Wimpissinger, A.
Osteopathische Medizin, 2023/12
180

Power and capital: In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
181

An Osteopathic Approach to Urinary Incontinence Including Biopsychosocial Aspects and Multiple Modalities for a Holistic Approach to Optimize Ongoing Care
Trivelas, N., Slaughter, K., Zaremski, K., Kirila, C.
Osteopathic Family Physician, 2023/12
182

Pathophysiological aspects of microgravity and gravity therapy in cardiovascular diseases
(Патофизиологические аспекты микрогравитации и гравитационной терапии при сердечно-сосудистых заболеваниях)
Pereshein, A. V., Kuznetsova, S. V., Petrova, D. A., Potemina, T. E.
Russian Osteopathic Journal, 2023/12
Free full text
183

(Features of the state of occlusion with partial loss of teeth (literature review))
Zhulev, E. N., Saakyan, M. Y., Vel'makina, I. V., Bragina, O. M., Vokulova, Y. A.
Russian Osteopathic Journal, 2023/12
184

Simplicity of Osteopathy
Fryette, H. H.
The AAO Journal, 2023/12
Free full text
185

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text
186

Power and capital; In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
187

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12
188

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text
189

L’expertise en ostéopathie, une prérogative médicale?
(Legal expertise in osteopathy, a medical privilege?)
Beaume, S.
Medecine et Droit, 2023/10
190

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text
191

Adductor magnus: Extending the knowledge – A short review of structure and function
Corcoran, D., McNamara, T., Feehan, J., Tripodi, N.
International Journal of Osteopathic Medicine, 2023/09
192

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09
193

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09
194

Klinische Differenzialdiagnostik bei 4–12-jährigen kieferorthopädischen Patienten
(Clinical differential diagnostics in 4-12-year-old orthodontic patients)
Medlitsch, A., Pittschieler, E.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
195

Stomatognathes System: Stellenwert für die Osteopathie
(Stomatognathic system: Significance for osteopathy)
Prätorius, O., Herdick, T.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
196

Die Rolle des Menstruationszyklus bei Sportverletzungen
(The role of the menstrual cycle in sports injuries)
Stierl, J. A., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
197

Mechanische Eigenschaften der Arterien
(Mechanical characteristics of the arteries)
Wyvekens, M., Hirth, T., Wyvekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
198

Models of medical rehabilitation: problems and solutions
(Модели медицинской реабилитации: проблемы и их решения)
Eremushkin, M. A.
Russian Osteopathic Journal, 2023/09
Free full text
199

Osteopathy in the world of modern medicine
(Остеопатия в мире современной медицины)
Konopleva, E. L., Ostapenko, V. M., Tarasov, N. A.
Russian Osteopathic Journal, 2023/09
Free full text
200

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09
201

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09
202

The biomechanical links between pelvic floor dysfunction and testicular pain: A clinical review
Jackson, C., Fawcett, L.
Osteopathic Family Physician, 2023/09
203

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text
204

Gleichgewicht und Propriozeption
(Balance and proprioception)
Barral, J.P.
Osteopathische Medizin, 2023/09
205

Und die Osteopathie wirkt doch!: Eine Entgegnung zu dem Artikel „Dreimonatskoliken: Alternativmedizin ohne nachgewiesenen Effekt“ von Elke Oberhofer
(And osteopathy does work!: A reply to the article “Three-month colic: Alternative medicine without proven effect“ by Elke Oberhofer)
Franke, H., Prediger, G.
Osteopathische Medizin, 2023/09
206

Die Schilddrüse aus der Sicht der Osteopathie: Teil 3: Behandlung
(The thyroid gland from the point of view of osteopathy: Part 3: Treatment)
Frühwein, J.
Osteopathische Medizin, 2023/09
207

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09
208

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text
209

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text
210

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07
211

Peritoneal Adhesions in Osteopathic Medicine: Theory, Part 1
Bordoni, B., Escher, A. R., Girgenti, G. T.
Cureus, 2023/07
Free full text
212

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text
213

Operative Herangehensweise bei und osteopathische Behandlung nach Hüft-TEP-Implantation
(Operative approach to and osteopathic treatment after hip TEP implantation)
Grasmück, J., Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
214

Osteopathy—A philosophical perspective. Reflections on Sutherland’s experience of the tide
Masiello, D. J.
The AAO Journal, 2023/06
Free full text
215

Sprechen wir noch eine Sprache?
(Are we still speaking the same language?)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
216

Die Lebendigkeit des Selbst – das gesunde Immunsystem
(The vitality of the self - the healthy immune system)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
217

Die Schilddrüse aus der Sicht der Osteopathie: Teil 2: Pathologie und Dysfunktion
(The thyroid gland from the point of view of osteopathy: Part 2: Pathology and dysfunction)
Frühwein, J.
Osteopathische Medizin, 2023/06
Free full text
218

Anatomy Trains: die Schienenverkehrsordnung
(Anatomy Trains: the rail transport regulations)
Myers, T. W.
Osteopathische Medizin, 2023/06
Free full text
219

Faszien als sensorisches und emotionales Organ: Emotionen, Faszien und Immunsystem
(Fasciae as sensory and emotional organ: Emotions, fasciae and immune system)
Schleip, R., Bartsch, K.
Osteopathische Medizin, 2023/06
Free full text
220

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06
221

Combating poor mental health in emergency responders: Helping Emergency Responders Overcome (HERO) Act
Derynda, B., Gupta, K. A., Bhattacharya, S., Hollar, T. L.
Osteopathic Family Physician, 2023/06
222

Embryologie und Midline
(Embryology and midline)
Wojtowicz, A., Freeman, B., Dijs, P.
Osteopathische Medizin, 2023/06
Free full text
223

Muskulatur im entwicklungs-dynamischen Kontext
(Muscles in the developmental-dynamic context)
Engel, M.
Osteopathische Medizin, 2023/06
224

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06
225

Somatic Dysfunction. Clinical Guidelines 2023
(Соматическая дисфункция. Клинические рекомендации 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
Free full text
226

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06
227

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
228

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text
229

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text
230

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
231

Abwertung als Ziel
(Devaluation as a goal)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
232

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text
233

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
234

Anatomie der Halswirbelsäule
(Anatomy of the cervical spine)
Mihajlovic, Z., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
235

Schmerz – ein mögliches Erklärungsmodell im Patientengespräch
(Pain - a possible explanatory model in the patient interview)
Serafin, A.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
236

Die Rolle des Nervus phrenicus in der Hirn-Darm-Achse
(The role of the phrenic nerve in the brain-gut axis)
Camirand, N.
Osteopathische Medizin, 2023/03
Free full text
237

Die Schilddrüse aus der Sicht der Osteopathie: Teil 1: Grundlagen
(The thyroid gland from the point of view of osteopathy: Part 1: Fundamentals)
Frühwein, J.
Osteopathische Medizin, 2023/03
Free full text
238

Naturwissenschaftliche Entsprechungen für osteopathische Begriffe: Ausgehend von ursprünglichen Überlegungen des Rollin Becker
(Scientific equivalents of osteopathic terms: Starting from original thoughts of Rollin Becker)
Pelz, H.
Osteopathische Medizin, 2023/03
Free full text
239

Osteopathische Forschung an der Charité Berlin: Aufruf zur Unterstützung von qualitativ hochwertiger Forschung – fördern Sie die Akzeptanz von Osteopathie
(Osteopathic research at the Charité Berlin: Call for support of high-quality research - Promote the acceptance of osteopathy)
Rotter, G.
Osteopathische Medizin, 2023/03
Free full text
240

Faszien als sensorisches und emotionales Organ: Faszien als Sinnesorgan
(Fasciae as sensory and emotional organ: Fasciae as sensory organ)
Schleip, R., Bartsch, K.
Osteopathische Medizin, 2023/03
Free full text
241

Fascia; facts and fantasies
Hoppeler, H.
European Journal of Translational Myology, 2023/03
242

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text
243

Die osteopathische Technik – ein Metakonzept
(The osteopathic technique - a meta concept)
Engel, M.
Osteopathische Medizin, 2023/03
244

Abwertung als Ziel: Über den Artikel „Die Scheinwirkung der Osteopathie” von Edzard Ernst
(Devaluation as a Goal: About the Article “The Sham Effect of Osteopathy“ by Edzard Ernst)
Franke, H.
Osteopathische Medizin, 2023/03
245

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03
246

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text
247

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03
248

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text
249

Prostate Cancer with a Presenting Symptom of Lower Thoracic Back Pain
Malhotra, V., Singh, C., Weening, A., Patel, S., Mayi, B., Migliozzi, J., Malhotra, V.
Osteopathic Family Physician, 2023/03
250

Russian Osteopathic Journal: the main stages of development in 2012–2022
(Российский остеопатический журнал: основные этапы развития в 2012–2022 гг.)
Tregubova, E. S., Plokhov, R. A., Potekhina, Y. P., Belash, V. O.
Russian Osteopathic Journal, 2023/03
Free full text
251

Pathogenetic prerequisites for the use of osteopathic correction in chronic tonsillitis
(Патогенетические предпосылки применения остеопатической коррекции при хроническом тонзиллите)
Vedyashkina, A. S., Potekhina, Y. P., Mokhov, D. E.
Russian Osteopathic Journal, 2023/03
Free full text
252

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03
253

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text
254

Mind, Body and Spirit: What Makes Osteopathic Medicine is Hands on
Williams, B. R.
Osteopathic Family Physician, 2023/03
255

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text
256

An Update on Medical School Accreditation in the United States: Implications for the Single Graduate Medical Education (GME) Era
Ahmed, H., Kortz, M., Carmody, J. B.
Cureus, 2023/02
Free full text
257

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text
258

Reconceptualizing Somatic Dysfunction in the Light of a Neuroaesthetic Enactive Paradigm
Consorti, G., Castagna, C., Tramontano, M., Longobardi, M., Castagna, P., Di Lernia, D., Lunghi, C.
Healthcare, 2023/02
Free full text
259

Bedeutung des differenzierten Säuglingsbefunds
(Importance of the differentiated infant finding)
Ginsberg, I.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
260

Fragen und die Existenz verschiedener Wahrheiten
(Questions and the existence of various truths)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
261

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
262

Die Gewebe des Menschen – mehr als nur Baumaterial des Organismus
(The tissues of a human - more than just building material of the organism)
Spohr, G.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
263

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text
264

The US Residency Selection Process After the United States Medical Licensing Examination Step 1 Pass/Fail Change: Overview for Applicants and Educators
Ozair, A., Bhat, V., Detchou, D. K. E.
JMIR Medical Education, 2023/01
Free full text
265

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text
266

COVID-19 in Patients with Asthma: Review and Implications for Care of Adult Patients with an Osteopathic Component
Frasca, D. J., Wolf, S.
Osteopathic Family Physician, 2022/12
Free full text
267

Die Geschichte der Osteopathie in Deutschland
(The history of osteopathy in Germany)
Engel, M.
Osteopathische Medizin, 2022/12
268

Osteopathie als personenzentrierte und integrierende Behandlungsmethode (Teil 2)
(Osteopathy as a person-centered and integrative treatment method (Part 2))
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/12
269

Osteopathische Geriatrie. Teil 2: Behandlung - Prinzipien und Methoden
(Osteopathic geriatrics. Part 2: Treatment - Principles and methods)
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/12
270

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/12
271

Fascial Distortion Model (FDM) by Stephen Typaldos from the modern research and therapeutic concepts point of view
(Модель фасциальных дисторсий (FDM) Стивена Типальдоса с позиций современных исследований и терапевтических концепций)
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. E., Agasarov, L. G.
Russian Osteopathic Journal, 2022/12
272

Effects of osteopathic correction and the possibility of their study
(Эффекты остеопатической коррекции и возможности их исследования)
Potekhina, Y. P., Tregubova, E. S., Mokhov, D. E.
Russian Osteopathic Journal, 2022/12
273

Reconceptualizing the therapeutic alliance in osteopathic practice: Integrating insights from phenomenology, psychology and enactive inference
Shaw, R., Abbey, H., Casals-Gutiérrez, S., Maretic, S.
International Journal of Osteopathic Medicine, 2022/12
274

The Touch Taboo: Origins for the Prohibition of Touch in Psychiatry and a Rational Osteopathic Approach
Huzij, T.
The AAO Journal, 2022/12
Free full text
275

Thomas L. Northup Lecture: Integrating Osteopathic Principles into Patient Care: An Approach for All Specialties
Snider, K.
The AAO Journal, 2022/12
Free full text
276

Five challenges for manual therapies trials with placebo controls: A proposal
D'Alessandro, G., Ruffini, N., Iacopini, A., Annoni, M., Kossowsky, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/12
277

Le toucher en ostéopathie, une ouverture au dialogue et à la relation.
(Touch in osteopathy, an opening to dialogue and relationship)
Beaulieu, A.
Soins Pédiatrie/Puériculture, 2022/11
278

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11
279

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text
280

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
281

Traumasensible Vorgehensweise in der osteopathischen Praxis
(Trauma-sensitive approach in osteopathic practice)
Heuer, I., Tann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
282

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie – Teil 2
(Positional plagiocephaly: The role of brainstem sensitization in the pathophysiology of positional plagiocephaly - Part 2)
Zweedijk, R.
Osteopathische Medizin, 2022/09
283

Andrew Taylor Still lebt: Ent-wicklungslinien der osteopathischen Forschung und Lehre
(Andrew Taylor Still is alive: Lines of development of osteopathic research and teaching)
Levin, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
284

Zirkumventrikuläre Organe und phänodynamische Osteopathie
(Circumventricular organs and phenodynamic osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
285

Piriformis syndrome
(Синдром грушевидной мышцы)
Belash, V. O., Petrova, E. A.
Russian Osteopathic Journal, 2022/09
286

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match
McCormick, M. E., Seideman, C. A.
The Journal of Urology, 2022/09
287

OSTLIB – Die osteopathische Datenbank
(OSTLIB - The osteopathic database)
Franke, H.
Osteopathische Medizin, 2022/09
288

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09
289

Osteopathische Geriatrie: Teil 1: Grundlagen, Ziele
Osteopathic geriatrics - Part 1: Basics, goals
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/09
290

Osteopathische Medizin – Wo bleibt der Beweis?
(Osteopathic medicine - Where is the evidence?)
Schleusener, R.
Osteopathische Medizin, 2022/09
291

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/09
292

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/09
293

Where do people acquire their beliefs about low back pain?
Suhail, A., Poulter, D. C.
International Journal of Osteopathic Medicine, 2022/09
294

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text
295

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08
296

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/08
Free full text
297

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08
298

Das zerebrospinale venöse System
(The cerebrospinal venous system)
Flenker, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
299

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07
300

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text
301

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text
302

Addressing disparities in medicine through medical curriculum change: a student perspective
Kureshi, A., Landman, S., Ahmed, M., Savinova, O. V., Becker, D.
Journal of Osteopathic Medicine, 2022/07
Free full text
303

Overcoming reward deficiency syndrome by the induction of “dopamine homeostasis” instead of opioids for addiction: illusion or reality?
Blum, K., Soni, D., Badgaiyan, R. D., Baron, D.
Journal of Osteopathic Medicine, 2022/07
Free full text
304

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07
305

Holistic osteopathic approach to the care of veterans with post-traumatic stress disorder: Case report
Lovy, A., Berkowitz, M. R.
The AAO Journal, 2022/06
Free full text
306

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie –Teil 1
(Positional plagiocephaly: the role of brainstem sensitization in the pathophysiology of positional plagiocephaly -Part 1)
Zweedijk, R.
Osteopathische Medizin, 2022/06
307

An Enactive-Ecological Model to Guide Patient-Centered Osteopathic Care
Cerritelli, F., Esteves, J. E.
Healthcare, 2022/06
Free full text
308

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text
309

Deutschsprachige Osteopathieliteratur: Eine Übersicht von der Entdeckung der Osteopathie bis zum Jahr 2000
(German-language osteopathic literature: a survey from the discovery of osteopathy to the year 2000)
Engel, M.
Osteopathische Medizin, 2022/06
310

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06
311

Durch dissipative Strukturierung zu Kohärenzgefühl und Gesundsein?
(Through dissipative structuring to a sense of coherence and being healthy?)
Pelz, H.
Osteopathische Medizin, 2022/06
312

An Osteopathic Manipulative Treatment (OMT) Evaluation and Treatment Protocol to Improve Gastrointestinal Function
Heineman, K.
The AAO Journal, 2022/06
Free full text
313

An Osteopathic Paradigm of Ideal Muscle Function: The Posterior Body Lifts the Skeleton into Gravity
Lewis, J. L.
The AAO Journal, 2022/06
Free full text
314

Transverse colon adenocarcinoma with direct cutaneous extension: complex multidisciplinary surgical management
Snow, Z. A., Marshall, B. N., Dreher, P., Parikh, S. N., Walchak, A., Cahn, D. B.
Journal of Osteopathic Medicine, 2022/06
Free full text
315

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/05
316

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text
317

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text
318

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text
319

Os trigonum identified after trauma to heel
Pargeon, M. E., Tjiattas-Saleski, L. R.
Journal of Osteopathic Medicine, 2022/05
Free full text
320

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text
321

Clinical evaluation and management of calcific tendinopathy: an evidence-based review
Catapano, M., Robinson, D. M., Schowalter, S., McInnis, K. C.
Journal of Osteopathic Medicine, 2022/04
Free full text
322

Bleeding gums due to immune thrombocytopenic purpura
Trydal, L., Liu, T.
Journal of Osteopathic Medicine, 2022/04
Free full text
323

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text
324

Instrumental methods and technical means for assessing the results of osteopathic correction in patients after lower limb amputation
(Инструментальные методы и технические средства для оценки результатов остеопатической коррекции у пациентов после ампутации нижних конечностей)
Kolyshnitsyn, N. Y., Mokhov, D. E.
Russian Osteopathic Journal, 2022/03
Free full text
325

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text
326

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text
327

Impressionen von A.T. Stills Osteopathie
(Impressions of A.T. Stills osteopathy)
Stecker, D.
Osteopathische Medizin, 2022/03
328

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
329

A.T. Still’s Biogen
Masiello, D. J.
The AAO Journal, 2022/03
Free full text
330

Osteopathic Approach to Treatment of Radial Head Dysfunction: The Radial Head Range of Motion Technique
Ellis, M. M., Lewis, D. D.
The AAO Journal, 2022/03
Free full text
331

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text
332

Should person-centredness care be an affordable goal in French osteopathic education?
Salmon, M., Cretal, A., Gonzales-Bandres, M.
International Journal of Osteopathic Medicine, 2022/03
Free full text
333

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
334

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
335

Rechtliches rund um die osteopathische Praxis – Praxisnachfolge
(Legal issues concerning osteopathic practice ... practice succession)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
336

Weibliche Anatomie: Die Harnblase
Female Anatomy: The Urinary Bladder
Bazin, O., Naudin, M.
Osteopathische Medizin, 2022/03
337

Vom Selbsterleben osteopathischer Praxis im Wirk-Bündnis der Tastwelt: Phänomenologisch-anthropologischer Bericht einer tastenden Praxis
(From the self-perception of osteopathic practice in the active alliance of the world of touch: Phenomenological-anthropological report of a practice of touching)
Kaiser, A. K.
Osteopathische Medizin, 2022/03
338

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03
339

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text
340

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02
341

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text
342

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text
343

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02
344

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text
345

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text
346

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
347

Teilleistungsstörung bei visueller Wahrnehmungsstörung
(Partial performance disorder in visual perception disorder)
Engemann, K., Preiss-Leger, B.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
348

Differenzialdiagnostik von Hüft- und Leistenschmerzen
(Differential diagnosis of hip and groin pain)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
349

Temporomandibulargelenk: Diskusverlagerung nach anterior
(Temporomandibular joint: disc displacement anteriorly)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
350

Im Zwischen – eine am Leib orientierte osteopathische Besprechung
(In between - An osteopathic discussion oriented toward the body)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
351

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05
352

Overcoming placebo-related challenges in manual therapy trials: The ‘whats and hows’ and the ‘touch equality assumption’ proposals
D'Alessandro, G., Ruffini, N., Iacopini, A., Annoni, M., Kossowsky, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/12
353

Undergraduate pre-requisite coursework: Six important tips for pre-medical students considering Osteopathic Medical school in the USA
Kadavakollu, S., Moullet, Z., Yoshida, M., Qureshi, M., Graneto, J., Boyanovsky, B.
International Journal of Osteopathic Medicine, 2021/12
354

Kognitive Fähigkeiten und Berufsrollen von Osteopath*innen nach A.T. Still: Teil 2: Die osteopathischen Berufsgruppen
Krause, K. C., Engel, M.
Osteopathische Medizin, 2021/12
355

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text
356

Die Lungen als Hohlorgan zwischen Luftbewegung und Gasaustausch: Ist eine osteopathische Behandlung des Lungengewebes möglich?
(The lungs as hollow organ between air movement and gas exchange: Is an osteopathic treatment of lung tissue possible?)
Levin, P.
Osteopathische Medizin, 2021/12
357

Vagusaktivierung und Stressreaktion aus Sicht der Osteopathie
(Vagus activation and stress reactions from the point of view of osteopathy)
Liem, T.
Osteopathische Medizin, 2021/12
358

Burnout und Stress – Korrelation mit viszeralem und kraniosakralem System
(Burnout and stress - Correlation with the visceral and craniosacral system)
Rössler, M., Kronstorfer, D.
Osteopathische Medizin, 2021/12
359

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12
360

Physical parameters of neutrality in the work of an osteopathic physician
(Физические параметры нейтральности в работе врача-остеопата)
Gurichev, A. A.
Russian Osteopathic Journal, 2021/12
361

Prevalence of endocrine pathology in childhood and adolescence
(Распространенность эндокринной патологии в детском и подростковом возрасте)
Nenashkina, E. N.
Russian Osteopathic Journal, 2021/12
362

Osteopathic ableism: A critical disability view of traditional osteopathic theory in modern practice
MacMillan, A.
International Journal of Osteopathic Medicine, 2021/12
363

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text
364

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11
365

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11
366

Les bienfaits de l’ostéopathie sur la constipation
(The benefits of osteopathy on constipation)
Pitel, C., Rojot, A.
Pratiques en Nutrition, 2021/11
367

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text
368

Application of scales, tests and questionnaires in the practice of an osteopathic physician
(Применение шкал, тестов и опросников в практике врача-остеопата)
Belyaev, A. F.
Russian Osteopathic Journal, 2021/10
Free full text
369

Post-intensive care syndrome (PICS) in children
(Синдром последствий интенсивной терапии (ПИТ-синдром) у детей)
Karimova, L. K., Belash, V. O.
Russian Osteopathic Journal, 2021/10
Free full text
370

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10
371

Palpation of the Respiratory System in Osteopathic Manual Medicine: From the Trachea to the Lungs
Bordoni, B., Escher, A. R.
Cureus, 2021/09
Free full text
372

Geist-Körper-Interdependenz in der osteopathischen Behandlung
(Mind-body interdependence in osteopathic treatment)
Liem, T., Van Den Heede, P.
Osteopathische Medizin, 2021/09
373

Osteopathische Überlegungen zur Begleitung der Therapie des Mammakarzinoms
(Osteopathic considerations to support the therapy of breast carcinoma)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
374

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
375

Behandlung bei posttraumatischer Belastungsstörung
(Treatment for post-traumatic stress disorder)
Treu, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
376

Klassische Osteopathie – ein ganzheitlicher Ansatz
(Classical osteopathy - a holistic approach)
Williams, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
377

General Osteopathic Treatment (GOT) – ein Überblick
(General Osteopathic Treatment (GOT) - an overview)
Schiller, B.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
378

Das Platysma – Anatomie, Entwicklung und Funktion
(The platysma - anatomy, development and function)
Schumann, S.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
379

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, Dr C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09
380

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text
381

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09
382

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09
383

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09
384

Kognitive Fähigkeiten und Berufsrollen von Osteopath*innen nach A.T. Still: Teil 1: Philosophisch-ethischer Hintergrund
(Cognitive skills and professional roles of osteopaths according to A.T. Still - Part 1: Philosophical-ethical background)
Engel, M., Krause, K. C.
Osteopathische Medizin, 2021/09
385

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09
386

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text
387

Osteopathie bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom
(Osteopathy for chronic prostatitis/chronic pelvic pain syndrome)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
388

Ungleichgewicht von Produktion und Resorption des LCS
(Imbalance of production and absorption of the LCS.)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
389

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
390

Der Mensch und seine Mikroben
(Man and its microbes)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
391

Können osteopathische Behandlungen Einfluss auf die Neurogenese nehmen?
(Can osteopathic treatments influence neurogenesis?)
Funke, P., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
392

Osteopathic Principles and Practice: Essential Training for the Primary Care Physician of Today and Tomorrow
Misra, S.
Family medicine, 2021/07
Free full text
393

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text
394

Osteopathy and International classification of functioning, disability and health (part 2
(Остеопатия и Международная классификация функционирования, ограничений жизнедеятельности и здоровья (часть 2)
Belyaev, A. F.
Russian Osteopathic Journal, 2021/07
Free full text
395

Simulation technologies in the modern paradigm of medical education: from general principles to use in teaching osteopathy
(Симуляционные технологии в современной парадигме медицинского образования: от общих принципов к использованию в преподавании остеопатии)
Makhonin, D. A., Lopatin, Z. V., Tregubova, E. S.
Russian Osteopathic Journal, 2021/07
Free full text
396

Adverse childhood experiences and trauma informed care: treating the whole patient with a more complete osteopathic approach
Marcoux, T. B.
Journal of Osteopathic Medicine, 2021/07
Free full text
397

Terminology of injuries in osteopathy and other medical disciplines
(Терминология повреждений в остеопатии и в других медицинских дисциплинах)
Potekhina, Y. P., Gurichev, A. A.
Russian Osteopathic Journal, 2021/07
Free full text
398

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07
399

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07
400

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06
401

Osteopathy: Italian professional profile. A professional commentary by a group of experts of the European community of practice
Cerritelli, F., Lunghi, C., Esteves, J. E., Vaucher, P., van Dun, P. L. S., Alvarez, G., Biberschick, M., Wagner, A., Merdy, O., Menard, M., Tavernier, P., Clouzeau, C., Risch, A., Ruffini, Nuria, Nunes, A., Santiago, R., Marett, P., Grech, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06
402

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 2: Diagnostik und Therapie
(Positional plagiocephaly and its osteopathic intervention. Part 2: Diagnostics and therapy)
Engel, M.
Osteopathische Medizin, 2021/06
403

Spinale Chiropraktische Manipulation (spinale HVLAM): Ein integrativer osteopathischer Ansatz
Spinal chiropractic manipulation (spinal HVLAM): An integrative osteopathic approach
Muntinga, E.
Osteopathische Medizin, 2021/06
404

The Pediatric Workforce: Recent Data Trends, Questions, and Challenges for the Future
Vinci, R. J.
Pediatrics, 2021/06
405

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text
406

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text
407

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05
408

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
409

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05
410

Die Phänomenologie als wissenschaftliche Grundlage der Osteopathie
(Phenomenology as the scientific basis of osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/04
411

Osteopathy and International classification of functionning, disability and health (part 1
(Остеопатия и Международная классификация функционирования, ограничений жизнедеятельности и здоровья (часть 1)
Belyaev, A. F.
Russian Osteopathic Journal, 2021/04
Free full text
412

Formation and development of osteopathy as a scientific discipline
(Становление и развитие остеопатии как научной дисциплины)
Novikov, Y. O., Mokhov, D. E., Tregubova, E. S.
Russian Osteopathic Journal, 2021/04
Free full text
413

Dynamic carpal tunnel syndrome: pathophysiology, features of osteopathic diagnosis and treatment
(Динамический туннельный синдром запястного канала: патофизиология, особенности остеопатической диагностики и лечения)
Stefanidi, A. V., Balabanova, N. V.
Russian Osteopathic Journal, 2021/04
Free full text
414

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04
415

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text
416

Das benigne Prostatasyndrom im Kontext der Osteopathie
(Benign prostate syndrome in the context of osteopathy)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
417

Der Knochen aus osteopathischer Sicht
(The bone from an osteopathic point of view)
Junge, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
418

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 1: Die Grundlagen
(Positional plagiocephaly and its osteopathic intervention. Part 1: Basics)
Engel, M.
Osteopathische Medizin, 2021/03
419

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
420

Randomisierte kontrollierte Studien zur osteopathischen Behandlung des Ganglion pterygopalatinum
(Randomized controlled trials for osteopathic treatment of the pterygopalatine ganglion.)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
421

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
422

Knochen und Immunität: Die leitende Funktion des Knochens in der generellen Immunität des Organismus aus osteopathischer Sicht
(Bone and immunity: The central function of the bone in the general immunity of the organism from osteopathic point of view)
Buekens, Jo
Osteopathische Medizin, 2021/03
423

Osteopathische Prophylaxe und Behandlung bei Infekten im Kindesalter: Möglichkeiten und Grenzen
(Osteopathic prophylaxis and treatment at infections in childhood: possibilities and limits)
Kaiser, F.
Osteopathische Medizin, 2021/03
424

Misshandelt oder unglücklich gestürzt?: Deutscher Kinderverein zeigt die Unterschiede der Verletzungen
(Abused or unfortunate fall?: German Children's Association shows the differences of the injuries)
Rettinger, R.
Osteopathische Medizin, 2021/03
425

Joining forces to administer COVID-19 vaccines
Johnson, K. H.
Journal of Osteopathic Medicine, 2021/03
Free full text
426

The Impact of the ACGME/AOA Single Accreditation System on Osteopathic Surgical Specialties, Residents, and DO Students
Cummings, M.
Journal of Surgical Education, 2021/03
427

Der tiefsitzende Beckenschmerz: Ein osteopathischer Behandlungsalgorithmus in sieben Schritten
(The chronic pelvic pain: An osteopathic treatment algorithm in seven steps)
Liedtke, H.
Osteopathische Medizin, 2021/03
428

Abwehrreaktionen aus Sicht der viszeralen Osteopathie – Teil 2: Diskussion und Implikationen für die viszerale Osteopathie
(Defense reactions from the perspective of visceral osteopathy - Part 2: Discussion and implications for visceral osteopathy)
Wyvekens, J., Wyvekens, M., Hirth, T.
Osteopathische Medizin, 2021/03
429

Effect of Autonomic Nervous System Recovery from Sympathetic Challenge Using Osteopathic Cranial Manipulative Medicine – A Pilot Study
Blumer, J. U.
The AAO Journal, 2021/03
Free full text
430

Proprioceptive Coherence: An Expanded View of the Mechanics Behind the Indirect Method and the Introduction of an Innovative Variation
Lockwood, M. D.
The AAO Journal, 2021/03
Free full text
431

Mindfulness: Principles and Application to Decrease Opiate Use in Primary Care With an Osteopathic Component
Frasca, D. J.
Osteopathic Family Physician, 2021/02
Free full text
432

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
433

Palpation, Interraterreliabilität und Soft Skills
(Palpation, interrater reliability and soft skills)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
434

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
435

Ist kraniale Osteopathie zuverlässig und wirksam?
(Is cranial osteopathy reliable and effective?)
Reißmann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
436

A Class By Themselves: Texas' Newest Med Schools Adjust to COVID-19
Price, S.
Texas Medicine, 2021/01
437

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text
438

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text
439

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text
440

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text
441

Embryologische Wellenreiter
(Embryological surfers)
Keown, D.
Osteopathische Medizin, 2020/12
442

Das osteopathische Labor: Erfahrung ermöglichen
(The osteopathic laboratory: Enabling experience)
Levin, P., Strebel, W.
Osteopathische Medizin, 2020/12
443

Psychosomatische Osteopathie bei Trauma am Beispiel der bifokalen Integration
(Psychosomatic osteopathy in trauma using the example of bifocal integration)
Liem, T., Neuhuber, W.
Osteopathische Medizin, 2020/12
444

Wissenschaftlich fundiert oder fragwürdiger Mythos?: Osteopathische Behandlungserfolge im Vergleich zur Schulmedizin während der Spanischen Grippe in den USA
(Scientifically substantiated or questionable myth?: Comparison between osteopathic treatment successes and conventional medicine during the Spanish flu in the USA)
Schwerla, F., Franke, H.
Osteopathische Medizin, 2020/12
445

Der Milchglasblick oder das Lächeln der Mona Lisa
(The frosted glass look or the smile of Mona Lisa)
Sibbing, D.
Osteopathische Medizin, 2020/12
446

Abwehrreaktionen aus Sicht der viszeralen Osteopathie – Teil 1: Die sechs Abwehrreaktionen Freeze, Flight, Fight, Fright, Flag und Faint
(Defense reactions from the point of view of visceral osteopathy - Part 1. The six defensive reactions: Freeze, Flight, Fight, Fright, Flag and Faint)
Wyvekens, J., Wyvekens, M., Hirth, T.
Osteopathische Medizin, 2020/12
447

Reflexology in the treatment of patients with dorsopathy
(Рефлексотерапия в лечении пациентов с дорсопатией)
Belash, V. O., Agasarov, L. G.
Russian Osteopathic Journal, 2020/12
Free full text
448

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
449

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
450

Possibilities and organizational problems of diagnostics and treatment of patients with the syndrome of temporomandibular joint pain dysfunction
(Возможности и организационные проблемы диагностики и лечения пациентов с синдромом болевой дисфункции височно-нижнечелюстного сустава)
Milutka, Y. A., Fortin, A. E.
Russian Osteopathic Journal, 2020/12
Free full text
451

Pathogenesis of post-stroke periarthropathy of the shoulder joint from the perspective of somatic dysfunctions
(Патогенез постинсультной периартропатии плечевого сустава с позиции развития соматических дисфункций)
Tregubova, E. S., Kozlova, N. S.
Russian Osteopathic Journal, 2020/12
Free full text
452

Die Brustdrüse aus osteopathischer Sicht: Teil 2: Praktische Anwendung
(The mammary gland from an osteopathic point of view - Part 2: Practical application)
Frühwein, J.
Osteopathische Medizin, 2020/12
453

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
454

The Battle Between Politics and Science Is Costing Us a Timely Victory Over the COVID-19 Pandemic
Hahn, M. B.
The Journal of the American Osteopathic Association, 2020/11
Free full text
455

Osteopathic manipulative treatment in a general pediatric setting: An account of reflective practice
Mills, M. V.
Complementary Therapies in Clinical Practice, 2020/11
456

Postoperative peritoneale Adhäsionen
(Postoperative peritoneal adhäsionen)
Liedler, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
457

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text
458

Osteopathie bei umschriebenen Entwicklungsstörungen
(Osteopathy for specific developmental disorder)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
459

Das Fasziensystem von Beckenboden, Bauch und Rücken
(The fascial system of the pelvic floor, abdomen and back)
Halasz, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
460

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht Teil 2: Was wirkt im Wirk-Bündnis der Osteopathie?
(Who and what constitutes connection within osteopathic treatment? A medical-philosophical contribution from the osteopathic point of view. Part 2: What works in the active alliance of osteopathy?)
Kaiser, A. K.
Osteopathische Medizin, 2020/09
461

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text
462

Osteopathische Behandlung des Larynx
(Osteopathic treatment of the larynx)
Liem, T.
Osteopathische Medizin, 2020/09
463

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Experteninterviews – Teil 1: Theorie und Forschungsstand
(The osteopathic treatment of interosseous lesions. A qualitative content analysis of experts' opinion - Part 1: Theory and state of research)
Stecker, D.
Osteopathische Medizin, 2020/09
464

Erweiterung des biopsychosozialen Modells für die muskuloskelettale Praxis: Teil 2: Klinische Bedeutung für die muskuloskelettale Behandlung (German translation)
(Extension of the biopsychosocial model for musculoskeletal practice. Part 2: Clinical significance for musculoskeletal treatment)
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
Osteopathische Medizin, 2020/09
465

Spinal Manipulation and Select Manual Therapies: Current Perspectives
Hinkeldey, N., Okamoto, C., Khan, J.
Physical medicine and rehabilitation clinics of North America, 2020/09
466

“Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research”
Lunghi, C., Liem, T.
International Journal of Osteopathic Medicine, 2020/09
467

Fascial distortion model (FDM-therapy). Principles of diagnosis and treatment (literature review
(Модель фасциальных дисторсий (FDM-терапия). Принципы диагностики и лечения (обзор литературы)
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. I.
Russian Osteopathic Journal, 2020/09
Free full text
468

„Der Dampf des Lebens“: Das Blut im Kontext der (klassischen) Osteopathie
“The steam of life“: The blood in the context of (classical) osteopathy
Engel, M.
Osteopathische Medizin, 2020/09
469

The application of physical therapy and balneology of the patients with non-specific low back pain (literature review
(Применение физио- и бальнеотерапии у пациентов с неспецифической болью в нижней части спины (обзор литературы)
Novikov, A. Y., Shaiakhmetov, A. R., Novikov, Y. O.
Russian Osteopathic Journal, 2020/09
Free full text
470

Die Brustdrüse aus osteopathischer Sicht: Teil 1: Grundlagen
(The mammary gland from an osteopathic point of view. Part 1: Fundamentals)
Frühwein, J.
Osteopathische Medizin, 2020/09
471

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
472

48-Hour Hospice Home Immersion Encourages Osteopathic Medical Students to Broaden Their Views on Dying and Death
Gugliucci, M. R., Padmanabhan, D. L., Silberstein, E. B.
The Journal of the American Osteopathic Association, 2020/08
Free full text
473

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text
474

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text
475

Musculoskeletal Therapies: Osteopathic Manipulative Treatment
Jonas, C.
FP Essentials, 2020/07
476

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text
477

Regulationsstörung bei Säuglingen: neue An- und Aussichten
(Regulation disorder in infants: new approaches and prospects)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
478

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
479

(Corporeality of the heart)
Kozljanič, R. J., Scheuchl, F., Rösing, S.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
480

Die visuelle Vorstellung in der osteopathischen Palpation
(Visual Imagination in Osteopathic Palpation)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
481

A guide to writing a case report of an osteopathic patient
Vaughan, B., Fleischmann, M.
International Journal of Osteopathic Medicine, 2020/06
482

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
483

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text
484

OMT bei der Behandlung von Infektionskrankheiten zu Beginn des 20. Jahrhunderts: Mit Anmerkungen aus aktuellen Forschungen und Behandlungsmodalitäten
(OMT in the treatment of infectious diseases at the beginning of the 20th century: With comments from current research and treatment modalities)
Liem, T.
Osteopathische Medizin, 2020/06
485

Test der Faszienkompartimente
(Test for fascia compartments)
Lunghi, C.
Osteopathische Medizin, 2020/06
486

Das Konzept „Hotelzimmer Uterus” möchte als anschauliche Allegorie dem Osteopathen und der (werdenden) Mutter aufzeigen, dass potenzielle Schockenergien, insbesondere in den Uteruswänden, einen negativen Effekt auf ein Ungeborenes haben oder sogar eine erfolgreiche Schwangerschaft verhindern kann. Es werden insbesondere Themen wie Kindsverlust und sexuelle Übergriffe angesprochen, da sie erfahrungsgemäß am ehesten gespeicherte (potenzielle) Schockenergien im gynäkologischen System hinterlassen. Das Phänomen Schockenergie wie auch die therapeutischen Ansätze zu deren Ausleitung werden kurz erläutert, insbesondere auch eventuelle Risiken bei der Behandlung in der Schwangerschaft.
(Shock in the uterus: The “hotel room“ phenomenon)
Muntinga, E.
Osteopathische Medizin, 2020/06
487

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text
488

Kleine Geburten – und wie wir sie begleiten können
(Miscarriages - and how we can attend to them)
Wikus, P., Ossberger, C.
Osteopathische Medizin, 2020/06
489

Erweiterung des biopsychosozialen Modells für die muskuloskelettale Praxis: Teil 1: Einführung religiöser und spiritueller Dimensionen in das biopsychosoziale Modell
(Extension of the biopsychosocial model for the musculoskeletal practice. Part 1: Introduction of religious and spiritual dimensions into the biopsychosocial model)
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
Osteopathische Medizin, 2020/06
490

Skoliose und Osteopathie: Teil 2: Osteopathische Behandlung
(Scoliosis and osteopathy. Part 2: Osteopathic treatment)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/06
491

Osteopathic medicine: A judicial section for one specific profession
Beaume, S.
Medecine et Droit, 2020/06
492

Intraventricular hemorrhage — modern concepts of pathogenesis, risk factors, diagnostics and treatment (literature review
(Внутрижелудочковое кровоизлияние — современные представления о патогенезе, факторах риска, диагностике и лечении (обзор литературы)
Karimova, L. K.
Russian Osteopathic Journal, 2020/06
Free full text
493

Sudeck syndrome — current understanding of pathogenesis, risk factors, diagnosis and treatment (literature review
(Синдром Зудека — современные представления о патогенезе, факторах риска, диагностике и лечении (обзор литературы)
Mikhnov, G. I., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/06
Free full text
494

Postural role of the foot and its disturbance in case of flat feet (literature review
(Постуральная роль стопы и ее нарушение при плоскостопии (обзор литературы)
Mironov, A. A., Khalili, V. D., Potekhina, Y. P., Pervushkin, E. S.
Russian Osteopathic Journal, 2020/06
Free full text
495

Graves Orbitopathy
Natali, S., Shogan, P.
The Journal of the American Osteopathic Association, 2020/06
Free full text
496

Partnering With Patients to Reduce Firearm-Related Death and Injury
Ozuna, L., Champion, C., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/06
Free full text
497

Manualtherapeutische Behandlung des Zwerchfells bei Asthma bronchiale: Studien geben Hoffnung
(Manual therapy treatment of the diaphragm in bronchial asthma: studies give hope)
Funke, P., Grasmück, J., Merkt, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
498

Behandlung einer stauungsbedingten Trigeminusneuralgie
(Treatment of trigeminal neuralgia as a result of congestion)
Hartmann, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
499

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
500

Antithrombotic Therapy for Patients With Atrial Fibrillation and Acute Coronary Syndrome or Percutaneous Coronary Intervention
Tseng, A. S., Shamoun, F. E., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/05
Free full text
501

Dermatofibrosarcoma Protuberans
Natali, S., Borelli, C., Shogan, P.
The Journal of the American Osteopathic Association, 2020/05
Free full text
502

Medizinischer Notfall in der Praxis: Ich packe meinen Koffer …
(Medical emergency in the practice: I pack my suitcase ...)
Merkt, P., Grasmück, J., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
503

Bindungsunterstützung bei Regulationsstörungen auf Grundlage der Polyvagaltheorie
(Support of human connection in regulation disorders based on the polyvagal theory)
Metcalfe-Wiegand, D.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
504

Der Subarachnoidalraum – ein Zwischenraum mit unterschätzter Bedeutung
(The subarachnoid space - an interspace with underestimated importance)
Muntinga, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
505

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
506

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04
507

Academic Advising Using Theoretical Approaches for Medical Students Who Are Struggling in Preclinical Years
Tewary, S., Jordan, J. A., Rana, A. M., Mayi, B.
The Journal of the American Osteopathic Association, 2020/04
Free full text
508

Approach To Joint Pain In The Elderly For Osteopathic Providers
Daudfar, S., Nakajima, N., Faiss, K., Tegeler, L., Kuo, J., Dreibelbis, R., Goering, E., Katsaros, E., Pham, J. T.
Osteopathic Family Physician, 2020/04
Free full text
509

Osteopathic Primary Care Treatment Options for Ulcerative Colitis
Fernandez, A., Januchowski, R.
Osteopathic Family Physician, 2020/04
Free full text
510

Urticaria: Diagnosis and Treatment with Osteopathic Considerations
Stacey, S.., Burke, D., Brininger, T.
Osteopathic Family Physician, 2020/04
Free full text
511

Gesundheit entsteht?: Die Bedeutung der sensomotorischen und psychischen Stabilität in der Entwicklung von Gesundheit
(Does health develop?: The importance of sensorimotor and psychological stability in the development of health)
Levin, Valbona A., Levin, P.
Osteopathische Medizin, 2020/03
512

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text
513

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text
514

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text
515

Skoliose und Osteopathie: Teil 1: Grundlagen
(Scoliosis and osteopathy. Part 1: Basics)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/03
516

Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research
Esteves, J. E., Zegarra-Parodi, R., van Dun, P., Cerritelli, F., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/03
517

The ICD-11 and opportunities for the osteopathy profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Orchard, D.
International Journal of Osteopathic Medicine, 2020/03
518

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text
519

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text
520

Kinderfußfunktion und spätere Haltungsgesundheit des Erwachsenen: Ursache und Wirkung – zwei Seiten einer Medaille
(Children's foot function and subsequent adult's postural health: Cause and effect - Two sides of a single coin)
Bäumer, C. J.
Osteopathische Medizin, 2020/03
521

Osteopathie zur Therapie bei unspezifischen Rückenschmerzen: Kritische Anmerkungen zu den Ergebnissen des IGeL-Monitors
(Osteopathy for the treatment of non-specific back pain: Critical comments on the results of the IGeL-Monitor)
Franke, H.
Osteopathische Medizin, 2020/03
522

Antidepressant Discontinuation Syndrome: A Common but Underappreciated Clinical Problem
Rizkalla, M., Kowalkowski, B., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2020/02
Free full text
523

Funktionsstörungen der Kopfgelenke – ein wenig bekanntes Untersuchungs- und Behandlungskonzept
(Functional disorders of the craniovertebral joints—a little known examination and treatment concept)
Heidrich, Dr, Buchmann, Joachim
Manuelle Medizin, 2020/02
524

Shift Workers at Risk for Metabolic Syndrome
Kulkarni, K., Schow, M., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2020/02
Free full text
525

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text
526

Value of the Continuing Certification Modules and Challenging the Status Quo
Capoocia, A.
The Journal of the American Osteopathic Association, 2020/02
Free full text
527

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
528

Die akute Sprunggelenksverletzung in der osteopathischen Praxis
(The acute ankle injury in osteopathic practice)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
529

Kriterien zur Qualitätsbewertung von randomisierten kontrollierten Studien (RCTs)
(Criteria for the quality assessment of randomized controlled trials (RCTs))
Sumbauer, H.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
530

Das „Wo“ und „Wie“ der Wissensbeschaffung – die systematische Literaturrecherche
(The “where“ and “how“ of knowledge generation - the systematic literature search)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
531

The Many Facets of Hypermobile Ehlers-Danlos Syndrome
Riley, B.
The Journal of the American Osteopathic Association, 2020/01
Free full text
532

Food Sensitivity Testing and Elimination Diets in the Management of Irritable Bowel Syndrome
Smith, E., Foxx-Orenstein, A., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/01
Free full text
533

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text
534

High-Velocity, Low-Amplitude Management of Posterior Rib Somatic Dysfunction
Kasten, K. M., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/01
Free full text
535

Introducing national osteopathy practice-based research networks in Australia and New Zealand: an overview to inform future osteopathic research
Steel, A., Peng, W., Sibbritt, D., Adams, J.
Scientific Reports, 2020/01
Free full text
536

Preventing Premature Weaning: Management Options for Common Lactation Conditions, Including OMT
Sackett, D. R., Dajani, T., Shoup, D., Ikonne, U., Bombei, B.
Osteopathic Family Physician, 2020/01
537

Taxonomy of the Lateral Strain Patterns at the Sphenobasilar Synchondrosis for Osteopathic Cranial Manipulative Medicine
Capobianco, J. D., Shermon, S.
The Journal of the American Osteopathic Association, 2020/01
Free full text
538

Forschung und Osteopathie – ein Widerspruch? Ein Versuch der Auflösung am Beispiel des DO-Touch.Net
(Research and Osteopathy - a contradiction? An approach to solution using the example of DO-Touch.Net)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
539

Osteopathic Cranial Manipulative Medicine: Frontal and Parietal Lift Techniques
Mardini, D., Peña, N., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/12
Free full text
540

Fluid Drive – angetrieben von äußerer Lebenskraft?
(Fluid Drive - Powered by an external life force?)
Muntinga, E.
Osteopathische Medizin, 2019/12
541

Eine überlebenswichtige Warnung … interessiert?
(A vital warning... interested?)
Schleusener, R.
Osteopathische Medizin, 2019/12
542

The role of the musculoskeletal system in maintaining postural balance: literature review
(Роль опорно-двигательного аппарата в поддержании постурального баланса: обзор литературы)
Kurnikova, A. A., Potekhina, Y. P., Filatov, A. A., Kalinina, E. A., Pervushkin, E. S.
Russian Osteopathic Journal, 2019/12
Free full text
543

Epidemiological and clinical aspects of chronic pyelonephritis in pregnant women and osteopathic follow-up of pregnant women with chronic pyelonephritis
(Эпидемиологические и клинические аспекты хронического пиелонефрита у беременных и остеопатическое сопровождение беременных, страдающих хроническим пиелонефритом)
Nenashkina, E. N., Tregubova, E. S., Belash, V. O.
Russian Osteopathic Journal, 2019/12
Free full text
544

Osteopathische Behandlung der Nebennieren
(Osteopathic treatment of the adrenal glands)
Barral, J-P.
Osteopathische Medizin, 2019/12
545

Modern views on etiology and pathogenesis of cervical pain syndromes: literature rewiew
(Современные представления об этиологии и патогенезе шейного болевого синдрома: обзор литературы)
Novikov, Y. O., Belash, V. O., Novikov, A. Y.
Russian Osteopathic Journal, 2019/12
Free full text
546

Role of Opioid Involved Drug Interactions in Chronic Pain Management
Bain, K. T., Knowlton, C. H.
The Journal of the American Osteopathic Association, 2019/12
Free full text
547

Review of Opioid Prescribing in the Osteopathic and Ambulatory Setting
Hussein, A. I., Bekampis, C. F., Jermyn, R. T.
The Journal of the American Osteopathic Association, 2019/12
Free full text
548

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text
549

An Osteopathic Physician's Approach to the Esports Athlete
Zwibel, H., DiFrancisco-Donoghue, J., DeFeo, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/11
550

The Benefits and Limitations of Evidence-based Practice in Osteopathy
Bordoni, B.
Cureus, 2019/11
Free full text
551

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text
552

Visceral osteopathic manipulative treatment reduces patient reported digestive toxicities induced by adjuvant chemotherapy in breast cancer: A randomized controlled clinical study
Lagrange, A., Decoux, D., Briot, N., Hennequin, A., Coudert, B., Desmoulins, I., Bertaut, A.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2019/10
553

A.T. Still und der Methodismus. Einfluss des Methodismus auf A.T. Stills Entwicklung der osteopathischen Lehre und Praxis im Amerika des 19. Jahrhunderts
(A.T. Still and the Methodism)
Liem, T.
Osteopathische Medizin, 2019/10
554

Commentary: Statistical significance and clinical significance - A call to consider patient reported outcome measures, effect size, confidence interval and minimal clinically important difference (MCID)
Fleischmann, M., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2019/10
555

Rezidivierende Harnwegsinfekte und Reizblase
(Recurrent urinary tract infections and irritable bladder)
Kilian-von Hofe, K.
Osteopathische Medizin, 2019/09
556

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text
557

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09
558

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
559

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
560

Welches Gesundheitsmodell hat die Osteopathische Medizin? Teil 2: Eine osteopathische Sichtweise zur Gesundheit und zum Gesundsein
(What health model does osteopathic medicine have? Part 2)
Mayer, J.
Osteopathische Medizin, 2019/09
561

Entwicklung der unteren Extremität beim Kind aus osteopathischer Sicht
(Development of the lower extremity in the child from an osteopathic point of view)
Möckel, E.
Osteopathische Medizin, 2019/09
562

Balancierte Impakt-Tension – eine erweiterte osteopathische Technik
(Balanced Impact Tension - An advanced osteopathic technique)
Muntinga, E.
Osteopathische Medizin, 2019/09
563

Die Schilddrüse
(The thyroid)
Stöckl, D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
564

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09
565

Fascial Nomenclature: An Update
Bordoni, B., Walkowski, S., Morabito, B., Varacallo, M. A.
Cureus, 2019/09
Free full text
566

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
567

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text
568

Kindlicher Kopfschmerz
(Child headache)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
569

Körperarbeit als Zugang zum ganzen Menschen
(Bodywork as access to the whole person)
Petzold, T. D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
570

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
571

Formation of health saving behavior in patients of osteopathic physicians
(Формирование здоровьесберегающего поведения у пациентов врача-остеопата)
Ivanov, A. A., Yanushanets, O. I.
Russian Osteopathic Journal, 2019/07
572

Verbesserte Neudefinition des Fasziensystems.
Improving the New Definition of Fascial System
Bordoni, B.
Complementary Medicine Research, 2019/07
573

Нормы труда врача остеопата в учетом кодирования заболеваемости
(The labor standards of osteopath with regard to morbidity coding)
Shipova, V. M., Berseneva, E. A., Mikhailov, D. Y.
Problemy sotsial'noi gigieny, zdravookhraneniia i istorii meditsiny, 2019/07
574

Dependence of the joint configuration on the dynamic immobility fulcrum
(Зависимость конфигурации сустава от фулькрума динамичной неподвижности)
Kozlov, A. D., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
575

The concept of biotensegrity and its use in osteopathy
(Le concept de la biotenségrité et son utilisation en ostéopathie)
Tarento, M.
Russian Osteopathic Journal, 2019/07
576

Specific Adjusting Technique
(Specific Adjusting Technique)
Lamb, Gez, Schabel, Kai
Osteopathische Medizin, 2019/06
577

Osteopathic Cranial Manipulative Medicine and the Blood Brain Barrier: A Mechanistic Approach to Alzheimer Prevention
McAree, M., Dunn, A., Furtado, J., Timmerman, C., Winchell, Z., Rani, R., Farah, J., Crispino, L. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
578

Refining the biopsychosocial model for musculoskeletal practice by introducing religion and spirituality dimensions into the clinical scenario
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/06
579

Welches Gesundheitsmodell hat die Osteopathische Medizin?
(What health model does osteopathic medicine have? Part 1: The topic of disease in the biomedical model of standard care)
Mayer, J.
Osteopathische Medizin, 2019/06
580

Osteopathische Medizin: Versuch einer zeitgemäßen Definition
(Osteopathic medicine: Attempt at a contemporary definition)
Mayer, J., Pelz, H., Riedel, M.
Osteopathische Medizin, 2019/06
581

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
582

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text
583

Integrating Osteopathic Philosophy in Cancer Care
Brown, Z. J., Martin, S. P., Carman, R.
The Journal of the American Osteopathic Association, 2019/06
Free full text
584

Cranial Osteopathy: Obscurantism and Enlightenment
Bordoni, B., Morabito, B., Simonelli, M.
Cureus, 2019/05
585

The Other Side of the Fascia: Visceral Fascia, Part 2
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
586

The Other Side of the Fascia: The Smooth Muscle Part 1
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
Free full text
587

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05
588

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text
589

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text
590

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04
591

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text
592

Von der Biomechanik zur Bioinformatik
(From Biomechanic to Bioinformatics)
Eckardt, P.
Osteopathische Medizin, 2019/04
593

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text
594

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text
595

Körperbasierte Empathie in der personzentrierten Psychotherapie
(Body-based empathy in person-centered psychotherapy)
Kern, E.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
596

The River of Life: Flüssigkeiten in der Osteopathie
(The river of life: fluids in osteopathy)
Mayer-Fally, E., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
597

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
598

Osteopathische Aspekte von Interozeption und Emotion
(Osteopathic aspects of interoception and emotion)
Stöckl, D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
599

Ist Asymmetrie Dysfunktion?
(Is asymmetry dysfunction?)
Robert, V.
Osteopathische Medizin, 2019/03
600

Biodynamische Osteopathie – Life
(Biodynamic osteopathy - life: A before - an afterwards - between them a stillpoint)
Schöndorfer, S.
Osteopathische Medizin, 2019/03
601

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03
602

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text
603

Manipulative Therapies: What Works
Smith, M. S., Olives, J., Smith, K.
American Family Physician, 2019/02
Free full text
604

The sacro-iliac joint: A potentially painful enigma. Update on the diagnosis and treatment of pain from micro-trauma
Le Huec, J. C., Tsoupras, A., Leglise, A., Heraudet, P., Celarier, G., Sturresson, B.
Orthopaedics & Traumatology: Surgery & Research, 2019/02
605

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text
606

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text
607

Der zervikothorakale Übergang
(The cervicothoracic junction)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
608

Welche Elemente charakterisieren die Osteopathie?
(Which elements characterize osteopathy?)
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
609

Back to the Roots: Palpation
(Back to the Roots: Palpation)
Eulenberg, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
610

Die Arbeit mit Diaphragmen im Zapchen
(Working with diaphragms through the Zapchen)
Weiß, B.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
611

Ein bisschen Lernen ist eine gefährliche Sache – Selbstüberschätzung bei Berufsanfängern
(A little learning is a dangerous thing - overconfidence among beginners)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
612

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text
613

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text
614

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text
615

Die Zukunft der Osteopathie liegt in der Aktivität
(The future of osteopathy belongs to activity)
Levin, P.
Osteopathische Medizin, 2018/12
616

Der suprachiasmatische Nukleus und seine klinische Bedeutung
(The suprachiasmatic nucleus and its clinical significance)
Liem, T., Havel, M.
Osteopathische Medizin, 2018/12
617

Therapieblockaden durch Zahn- und Kieferstörfelder: Umgang mit Störfeldern aus Sicht der täglichen osteopathischen Praxis
(Therapy blockades due to interference fields of teeth and jawbone: Dealing with interference fields from the point of view of daily osteopathic practice)
Von Gimborn, G.
Osteopathische Medizin, 2018/12
618

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text
619

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text
620

Funktionelle Therapie beim Morbus Sudeck („Complex Regional Pain Syndrome”, CRPS)
Functional therapy in Sudeck's disease (“Complex Regional Pain Syndrome“, CRPS)
Böger, A.
Osteopathische Medizin, 2018/12
621

Die Identität der Osteopathie in Deutschland – Spurensuche nach einem beruflichen Selbstverständnis
(The identity of osteopathy in Germany - Search for traces of a professional self-conception)
Ehmke, B.
Osteopathische Medizin, 2018/12
622

Effektstärke: Ein Parameter für osteopathische Studien?
Effect size: A parameter for osteopathic studies?
Hartwig, B. J., Bock, I. S.
Osteopathische Medizin, 2018/12
623

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text
624

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text
625

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text
626

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text
627

Changes on cervical range of motion in migraine patients after a strain counterstrain treatment
Giustino, V., Contrò, V., Brusa, J., Proia, P., Messina, G., Brighina, F.
The Journal of Headache and Pain, 2018/10
628

Die Kunst des Briefschreibens und der Korrespondenz
(The art of letter writing and correspondence)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
Free full text
629

The One Health Initiative as a Basis for Research Development in the Department of Pharmacology at Midwestern University
Prozialeck, W. C., Edwards, J. R.
The Journal of the American Osteopathic Association, 2018/09
Free full text
630

Hebammenarbeit und Osteopathie – Berührungspunkte
(Midwifery and osteopathy - points of contact)
Göggerle-Locher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
631

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text
632

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
633

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
634

Datenschutzgrundverordnung (DSGVO) – Schreckgespenst oder echte Bedrohung?
(General Data Protection Regulation (GDPR) - spectre or real threat?)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
635

Anatomie am Lebenden
(Anatomy on the living object)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
636

Von A.T. Stills Theorie der osteopathischen Läsion zur somatischen Dysfunktion
(From A.T. Still's theory of the osteopathic lesion based on somatic dysfunction: Historical development and evidence-based models that support the current concept of somatic dysfunction)
Liem, T.
Osteopathische Medizin, 2018/09
637

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09
638

Subokzipitalregion: neurologische und vaskuläre Anatomie und Varianten
(Suboccipital region: neurological and vascular anatomy and variants)
Reinhardt, R.
Osteopathische Medizin, 2018/09
639

Was ist Schmerzpsychotherapie?
(What is pain psychotherapy?)
Butz, M., Braun, C., Böger, A.
Osteopathische Medizin, 2018/09
640

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text
641

Umgangsformen: Respektvolles und offenes Miteinander
(Manners: Respectful and open interaction)
Brandes, M., Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
642

Der Osteopath – lebenslanges Lernen und Entwicklung
(The osteopath - lifelong learning and development)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
643

Östeopathie – ein Bericht aus dem südlichen Nachbarland
(Osteopathy - a report from the southern neighbors)
Engel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
644

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
listed, , No authors
The Journal of the American Osteopathic Association, 2018/08
Free full text
645

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text
646

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text
647

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text
648

Ich kann heilen, glaubt der Mensch – ein kritischer Denkanstoß
(I can heal, man believes - something to think about critically)
Fenske, M.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
649

Mut zur Muße
(Dare to laze)
Lamersdorf, P. J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
650

Die Kunst des Heilens: Wie man „Gesundheit findet“
(The art of healing: How to 'find health')
Lever, R.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
651

Still und das Geheimnis von Gesundheit
(Still and the secret of health)
Lewis, J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
652

Welchen Stellenwert hat Gesundheit in der Schulmedizin?
(What is the significance of health in conventional medicine?)
Wöstmann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
653

The Rule of the Artery Is Supreme. Or, Is It?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2018/07
Free full text
654

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07
655

Effect of HVLA on Chronic Neck Pain and Dysfunction
Cabahug, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text
656

Die Gesundheit in der Osteopathieausbildung
(Health in osteopathic education)
Bock, N.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
657

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text
658

National Institutes of Health and Osteopathic Medicine: Another call for action and equality in a legal struggle won long ago
Peppers, B. P., Blumer, J. U., Hostofer, R. W., Rowane, M. P., Thomas, K. A., Byrnes, T. R.
The AAO Journal, 2018/06
Free full text
659

The challenges and opportunities of using patient reported outcome measures (PROMs) in clinical practice
Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2018/06
660

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text
661

Palpation - Eine Fähigkeit des Gehirns?
(Palpation: An ability of the brain?)
Krause, R.
Osteopathische Medizin, 2018/05
662

Leistenschmerzen aus Sicht des Hernienchirurgen
(Inguinal pain from the point of view of the hernia surgeon)
Kuthe, A.
Osteopathische Medizin, 2018/05
663

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05
664

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
665

Lokale klinische Diagnostik bei Leistenschmerzen
(Local clinical diagnosis of inguinal pain)
Dobler, T. K.
Osteopathische Medizin, 2018/05
666

Knieschmerz und fazilitierte Positionierung in Anlehnung an L.H. Jones
(Knee pain and facilitated positioning in the style of L.H. Jones)
Heidrich, M., Buchmann, J., Röper-Krejza, B.
Osteopathische Medizin, 2018/05
667

Educational avenues to promote fascia dialog in medical curricula
Pratt, R.
FASEB Journal, 2018/04
668

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text
669

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
670

Behandlung der kranialen Abflüsse bei HWS-Problematik
(Treatment of cranial drains in cervical spine problems)
Hanke, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
671

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
672

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03
673

Rethinking Superior and Inferior Sacroiliac Shear: A New Approach to Diagnosis and Treatment
Goldman, S. I., van Buskirk, R. L.
The AAO Journal, 2018/03
Free full text
674

Wann braucht ein Kind Physiotherapie und wann Osteopathie?
(When does a child need physiotherapy and when do they need osteopathy?)
Schwahn, N., Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
675

Die Zusammenarbeit von Hebamme und Osteopath
(The collaboration of midwife and osteopath)
Steinfurth, G., Böhringer, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
676

Interdisziplinäre Zusammenarbeit
(Interdisciplinary collaboration)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
677

Resonanz und Dialog: Zur Methodik eines neuroregulativen Behandlungsmodells
(Resonance and dialogue: On the methodology of a neuroregulative treatment model)
Metcalfe-Wiegand, D.
Osteopathische Medizin, 2018/03
678

Osteopathie im biodynamischen Bereich und Psychotherapie
(Osteopathy in the biodynamic field and psychotherapy)
Pelz, H.
Osteopathische Medizin, 2018/03
679

Clinical versus radiological findings: A paradox in diagnosing minor hamstring injuries
Arumugam, A.
International Journal of Osteopathic Medicine, 2018/03
680

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03
681

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text
682

Mechanical Link – Protokoll für eine individuelle Diagnostik und Therapie
(Mechanical link - Protocol for an individual diagnostics and therapy)
Hafen-Bardella, C.
Osteopathische Medizin, 2018/03
683

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text
684

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text
685

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text
686

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text
687

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text
688

Charlotte Weaver: Forschung zur Schädelwirbeltheorie
(Charlotte Weaver: Research on the cranial vertebra theory)
Engemann, K., Biermann, H.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
689

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
690

Beryl Arbuckle und die kraniale Osteopathie
(Beryl Arbuckle and cranial osteopathy)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
691

„Palpation“ bei A. T. Still, W. G. Sutherland und R. Becker
('Palpation' in A. T. Still, W. G. Sutherland, and R. Becker)
Sibbing, D.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
692

Osteopathische intrauterine Behandlung einer kongenitalen Lungenzyste
(Osteopathic intrauterine treatment of a congenital lung cyst)
Urbanek, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
693

Frauen in der osteopathischen Praxis
(Women in osteopathic practice)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
694

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text
695

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text
696

Anne Wales (1904 – 2005)
Dove, C.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
697

Wer war eigentlich Edna M. Lay?
(Who was Edna M. Lay?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
698

Tools zum Erlernen der Palpation
(Tools for learning palpation)
Krause, R.
Osteopathische Medizin, 2017/12
699

Osteopathische Läsion – Teil 2: Definitionen und Terminologien
(Osteopathic lesion - Part 2: Definitions and terminologies)
Liem, T.
Osteopathische Medizin, 2017/12
700

Advancing the Understanding and Treatment of the Thoracic Inlet and Incorporation of a New Still Technique—Part 1
Lewis, D. D.
The AAO Journal, 2017/12
Free full text
701

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text
702

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text
703

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text
704

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text
705

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text
706

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
707

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text
708

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text
709

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text
710

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10
711

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text
712

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text
713

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09
714

Prozessorientierung in der Osteopathie: ein Ansatz jenseits des Strukturmodells
(Process orientation in osteopathy: An approach beyond the structural model)
Lederman, E.
Osteopathische Medizin, 2017/09
715

Chronologie von Krankheitsgeschehen, Therapie und Forschung in der Osteopathie
(Chronology of pathophysiology, therapy and research in osteopathy)
Levin, P.
Osteopathische Medizin, 2017/09
716

Update zur Drainage des Gehirns und osteopathische Behandlungsansätze
Update on brain drainage and osteopathic treatment approaches
Liem, T.
Osteopathische Medizin, 2017/09
717

Mundmotorik: Empfehlungen für Babys und Kleinkinder mit Störungen der oralen Funktion
(Oral motor function: Recommendations for babies and small children with oral functional disorders)
Limbrock, J.
Osteopathische Medizin, 2017/09
718

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
719

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
720

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
721

Patienteninfo: Loslassen, ruhig werden, Raum schaffen mit Yoga
(Patient information: Let go, calm down, create space through the use of yoga)
Storm, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
722

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text
723

Scheinselbstständigkeit in der osteopathischen Praxis
(False self-employment in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
Free full text
724

Das Nichts zwischen den Dingen – oder was ist Raum?
(The nothingness between things - or what is space?)
Wallbrecht, C., Nehlsen, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
725

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text
726

Raum und Weite im Lernfeld Osteopathie
(Space and width in the learning field of osteopathy)
Brown, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
727

Fuß- und Beinachsenentwicklung vom Säugling bis zum Erwachsenen
(Development of the feet and leg axis from infant to adult)
Halasz, C.
Osteopathische Medizin, 2017/09
Free full text
728

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
729

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text
730

Functional Somatic Syndrome: Assessment and Management
Graver, C. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text
731

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text
732

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text
733

Meeting ACGME Standards Under a Unified Accreditation System: Challenges for Osteopathic Graduate Medical Education Programs
Cummings, M.
Academic Medicine, 2017/07
Free full text
734

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
735

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
736

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text
737

Update zur Liquorforschung und Drainage des Gehirns
Update on cerebrospinal fluid research and cerebral drainage
Liem, T.
Osteopathische Medizin, 2017/06
738

Osteopathie als aktuelle Satzungsleistung gesetzlicher Krankenkassen
(Osteopathy as current optional benefit of statutory health insurance companies)
Newiger, C.
Osteopathische Medizin, 2017/06
739

Balanced Fascial Tension (BFT) am Beispiel der faszialen Hüllen des Herzens
(Balanced Fascial Tension (BFT) using the fascial sheaths of the heart as an example)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
740

Mikrobiom: Worauf Sie bei Ihren Patienten achten sollten
(Microbiome: What you should pay particular attention to in your patients)
Zschocke, A. K.
Osteopathische Medizin, 2017/06
741

Reflexionen über Psyche und Geist in der Osteopathie
(Reflections on psyche and mind in osteopathy)
Turner, S., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text
742

Kraniozervikomandibulär bedingte Gleichgewichtsstörungen
(Vertigo caused by the cranio-cervico-mandibular complex)
Van Gorp, J., Stöcker, D.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
743

Das systemische Naturverständnis als Grundlage der Osteopathie
(The systemic understanding of nature as a foundation of osteopathy)
Wühr, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
744

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06
745

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text
746

Patienteninfo: Schwindel
(Patient information: Vertigo)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
747

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text
748

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06
749

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text
750

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
751

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text
752

An Osteopathic Approach to Chronic Pain Management
Jerome, J. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text
753

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text
754

Regulationsstörung
(Infantile colic)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
755

Autismus-Spektrum-Störung (ASS) und Osteopathie
(Autism spectrum disorder (ASD) and osteopathy)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
756

Behandlungsvertrag nach dem Patientenrechtegesetz
(Treatment contract in accordance with the Patient's Rights Law)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
757

Persistierende frühkindliche Reflexe
(Persistent early childhood reflexes)
Watrin, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
758

Begleitung von Familien mit besonderen Kindern
(Support of families with special needs children)
Beuge, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
759

Eine osteopathische Herangehensweise an reflexives Schreiben
(An osteopathic approach to reflective writing)
Brown, A., Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
760

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text
761

Patienteninfo: Handling und Lagerung von Säuglingen
(Patient information: Handling and positioning of infants)
Fischer, S. J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
762

Das chronische Beckenschmerzsyndrom : Hilfe durch Osteopathie.
(Chronic pelvic pain syndrome : Treatment options using osteopathy)
Marx, S.
Der Urologe, 2017/04
763

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text
764

The importance of pilot studies, how to write them and what they mean
Vogel, S., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2017/03
765

A process approach in osteopathy: beyond the structural model
Lederman, E.
International Journal of Osteopathic Medicine, 2017/03
766

J Martin Littlejohn (1865–1947) and James Buchan Littlejohn (1868–1947): Two distinct directions – Osteopathy and the birth of osteopathic medicine
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2017/03
767

Innovation in graduate medical education – using a competency based medical education curriculum
Riley, B. A., Riley, G.
International Journal of Osteopathic Medicine, 2017/03
768

Burnout: Worauf Sie bei Ihren Patienten achten sollten
(Burnout: What you should pay attention to in your patients)
Krautz, B.
Osteopathische Medizin, 2017/02
769

Osteopathische Läsion – Teil 1: Begriffsentstehung und Konzept
(Osteopathic lesion - Part 1: Emergence of the idea and concept)
Liem, T.
Osteopathische Medizin, 2017/02
770

Vom Aufhängeband zum Organ: neue Forschungsergebnisse zum Mesenterium
From the suspensory ligament to the organ: New findings on the mesentery
Plathner, M.
Osteopathische Medizin, 2017/02
771

Motorische Entwicklung eines Säuglings: Idealbild und Abweichungen
(Motor development of an infant: Ideal and deviations)
Strunk, A.
Osteopathische Medizin, 2017/02
772

Intuition und Bewusstsein in der osteopathischen Praxis
(Intuition and awareness in osteopathic practice)
Von Gimborn, G.
Osteopathische Medizin, 2017/02
773

Pectus Excavatum: A Review of Diagnosis and Current Treatment Options
Abid, I., Ewais, M. M., Marranca, J., Jaroszewski, D. E.
The Journal of the American Osteopathic Association, 2017/02
Free full text
774

Viola Frymanns Erbe – ein Überblick über ihre Forschungsarbeiten
(Viola Frymann's legacy - an overview of her research work)
King, H. H., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
775

Smartphones, Tablets und Co – Tipps zur Reduzierung der Strahlenbelastung
(Smartphones, tablets and the like - tips for reducing radiation exposure)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
776

Die venöse Sinustechnik – Drainage der venösen Blutleiter
(The venous sinus technique - drainage of venous blood vessels)
Percival, H., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
777

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text
778

Die Architektur der extrazellulären Matrix
(The architecture of the extracellular matrix)
Armstrong, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
779

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text
780

Osteopathie, Krankheit und Gesundheit
(Osteopathy, disease and health)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
781

Die therapeutische Potency
(Therapeutic potency)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
782

Der osteopathische Ansatz beim allergischen Patienten
(The osteopathic approach to allergic patients)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
783

Über das Konzept der Stille, den Stillpoint, das Fulkrum und die Potency
(About the concept of stillness, the still point, the fulcrum and the potency)
Frymann, V., Deora, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
784

John Martin Littlejohn: Leben und Werk
(John Martin Littlejohn: life and work)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
785

(Thinking, feeling and wanting as component of a treatment)
Krause, R.
Osteopathische Medizin, 2016/12
786

Utilizing Muscle Energy Technique of the Shoulder Girdle to Correct Somatic Dysfunction of the Thoracic Inlet
Figueroa, J., Summers, G. K.
The AAO Journal, 2016/12
787

A Review of Hypertension and Its Management by Osteopathic Manipulative Therapy
Miller, A. D.
The AAO Journal, 2016/12
788

Schilddrüse und Nebenschilddrüsen: Worauf Sie bei Ihren Patienten achten sollten
(Thyroid gland and parathyroid glands: To what you should pay particular attention in your patients)
Wicke, C., Trupka, A.
Osteopathische Medizin, 2016/12
789

Verbindung von Gehirn und Lymphsystem: neue Erkenntnisse und ihre Bedeutung für die Therapie
(Connection of brain and lymphatic system: New findings and their importance for therapy)
Chikly, B., Chikly, A.
Osteopathische Medizin, 2016/12
790

Entwicklungstests für Säuglinge und Kleinkinder: Hintergründe und praktische Empfehlungen
(Developmental tests for infants and toddlers: Backgrounds and practical recommendations)
Hohendahl, J.
Osteopathische Medizin, 2016/12
791

Alternative Scheduling Models: Improving Continuity of Care, Medical Outcomes, and Graduate Medical Education in Resident Ambulatory Training
Hussain, A. J.
The Journal of the American Osteopathic Association, 2016/12
Free full text
792

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text
793

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text
794

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text
795

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text
796

A model for radiating leg pain of endometriosis
Bove, G. M.
Journal of Bodywork and Movement Therapies, 2016/10
797

Requirements for Certification in Surgery: A Comparison of the American Board of Surgery and the American Osteopathic Board of Surgery
Termuhlen, P. M., AH, O. Yurvati, Stella, J. J.
The Journal of the American Osteopathic Association, 2016/10
Free full text
798

The biomechanical model in manual therapy: Is there an ongoing crisis or just the need to revise the underlying concept and application?
Lunghi, C., Tozzi, P., Fusco, G.
Journal of Bodywork and Movement Therapies, 2016/10
799

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text
800

Osteopathische Imagination – ein Weg zur osteopathischen Selbstbehandlung
(Osteopathic Imagination - A way to osteopathic self-treatment)
Liedtke, H.
Osteopathische Medizin, 2016/09
801

Die Regio inguinalis dextra aus osteopathischer Sicht
(The regio inguinalis dextra from an osteopathic point of view)
Kuschel, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
802

Patienteninfo: Leben ist Bewegung
(Patient information: Life is movement)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
803

Die viszeralen Behandlungen des Andrew Taylor Still
(The visceral treatments of Andrew Taylor Still)
Marx, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
804

Osteopathie in Österreich – rechtliche Grundlage und Ausblick
(Osteopathy in Austria - Legal basis and outlook)
Mitschka, M., Wikus, P.
Osteopathische Medizin, 2016/09
805

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
806

Integrative Behandlung der Nebennieren in der Osteopathie
(Integrative treatment of the adrenal glands in osteopathy)
Namer, V., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
807

Neurovaskuläre Mobilisation des Plexus hypogastricus inferior
(Neurovascular mobilization of the inferior hypogastric plexus)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2016/09
808

Mechanotransduktion: von der zellulären Ebene bis zum ganzen Körper
(Mechanotransduction: From the cellular level up to the entire body)
Schleip, R.
Osteopathische Medizin, 2016/09
809

(Skin cancer: What you should watch out for in your patients)
Schnopp, C., Mempel, M., Baumstark, J.
Osteopathische Medizin, 2016/09
810

Neue Ansätze für die Behandlung viszeraler Strukturen über den Schädel
(New approaches for the treatment of visceral structures via the skull)
Riedel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
811

Nuad Boran – die traditionelle thailändische Massage
(Nuad Boran - the traditional Thai massage)
Rouhani, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
812

Struktur und Funktion der Atlasregion aus Sicht von Humankybernetik und Tensegrity
(Structure and function of the atlas region from the point of view of human cybernetics and tensegrity)
Siemsen, C.H., Koerner, H.
Osteopathische Medizin, 2016/09
813

Haftungsfälle in der osteopathischen Praxis
(Cases of liability in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
814

Behandlung der viszeralen Gefäße aus osteopathischer Sicht
(Treatment of the visceral vessels from an osteopathic point of view)
Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
815

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
816

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text
817

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text
818

Manual evaluation of the diaphragm muscle
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Journal of Chronic Obstructive Pulmonary Disease, 2016/08
Free full text
819

Psychoneuroimmunologie: eine osteopathische Annäherung
(Psychoneuroimmunology: an osteopathic approach)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
820

Naturheilkunde und Komplementarmedizin in medizinischen Leitlinien - konnen europaische Normen Leitlinien fur Naturheilkunde und Komplementarmedizin verdrangen?
(Naturopathy and Complementary Medicine in Medical Guidelines - Can European Standards Replace Guidelines for Naturopathy and Complementary Medicine?)
Jutte, R.
Forschende Komplementärmedizin, 2016/07
821

Patienteninfo: Verhaltensauffällige Kinder – ADHS aktuell
(Patient information: Children with behavioral problems - latest on ADHD)
Rudner, S., Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
822

Dynamik der Gedanken oder wenn das Denken den Rhythmus lähmt
(Dynamics of thinking or when thinking paralyzes rhythm)
Schöndorfer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
823

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text
824

Das Zwerchfell – Atemmuskel oder Sitz der Seele?
(The diaphragm - respiratory muscle or seat of the soul?)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
825

Psyche und Hormonsystem – Dirigenten unseres Lebens
(Psyche and endocrine system - conductors of our life)
Vogt, E. S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
826

Was macht die Psyche somatisch?
(What makes the psyche somatic?)
Vogt, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
827

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text
828

Rechtliches rund um die osteopathische Praxis: Umsatzsteuerpflicht des Osteopathen
(Value added tax liability of the osteopath)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
829

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text
830

Das limbische System aus osteopathischer Sicht
(The limbic system from an osteopathic perspective)
Evans, O.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
831

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06
832

(The polyvagal theory in osteopathy)
Porges, S. W., Liem, T.
Osteopathische Medizin, 2016/06
833

Behandlungsvertrag in der Osteopathie – Warum ist er wichtig?
(Treatment contract in osteopathy - Why is it important?)
Schröder, B.
Osteopathische Medizin, 2016/06
834

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06
835

Beliefs about back pain: The confluence of client, clinician and community
Darlow, B.
International Journal of Osteopathic Medicine, 2016/06
836

Time, space and form: Necessary for causation in health, disease and intervention?
Evans, D. W., Lucas, N., Kerry, R.
Medicine, Health Care and Philosophy, 2016/06
837

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text
838

Sensomotorische Entwicklung und pädiatrische Osteopathie
(Sensorimotor development and pediatric osteopathy)
Ava Levin, V., Levin, P.
Osteopathische Medizin, 2016/06
839

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text
840

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text
841

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text
842

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text
843

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
844

Somatic Dysfunction: A Principled Approach to Diagnosis and the Selection of OMT Modalities
Hruby, R. J.
The AAO Journal, 2016/03
845

Was ist eigentlich … Body-Mind-Centering®?
(What actually is Body-Mind-Centering®?)
Leinweber, D., Rustler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
846

Biologische Rhythmen und ihre Bedeutung für die Osteopathie
(Biological rhythms and their importance for osteopathy)
Liem, T., Moser, M.
Osteopathische Medizin, 2016/03
847

Osteopathie – eine kurze Einführung. Grundlagen und geschichtlicher Überblick
(Osteopathy - A short review. Principles and history)
Luthin, D.
Pädiatrische Praxis, 2016/03
848

Anmerkungen zu Blechschmidt
(Comments on Blechschmidt)
Mildenberger, F. G.
Osteopathische Medizin, 2016/03
849

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text
850

Patienteninfo: Schilddrüsenunterfunktion
(Patient information: Hypothyroidism)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
851

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
852

Groß- und Minderwuchs in der osteopathischen Praxis
(Large and small stature in osteopathic practice)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
853

Assessment of Australian osteopathic learners
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03
854

Auswirkungen von frühkindlichem Stress auf das neuroendokrine System und Immunsystem
(Effects of early childhood stress on the neuroendocrine system and immune system)
Carter, P. V.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
855

Faszien: Verbindungen zwischen Perikard und umgebenden Strukturen
(Fascia: Connections between pericardium and surrounding structures)
Bartmer-Leitl, E.
Osteopathische Medizin, 2016/03
856

Assessment of Australian osteopathic learners' clinical competence during workplace learning
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03
857

Patients' experiences of living with persistent back pain
van Griensven, Hubert
International Journal of Osteopathic Medicine, 2016/03
858

Die Polyvagal-Theorie
(The Polyvagal Theory)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
859

Research Into Osteopathic Manipulative Medicine: Steps on the Evidence Pyramid
Ching, L. M.
The Journal of the American Osteopathic Association, 2016/03
Free full text
860

Funktionelle Aspekte der Dura sacralis und des anokokzygealen „Verspannungsapparates”
(Funktionelle Aspekte der Dura sacralis und des anokokzygealen „Verspannungsapparates”)
Hörmann, R., Brenner, E., Künzel, K.H.
Osteopathische Medizin, 2016/03
861

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text
862

Single Accreditation System for Graduate Medical Education: An Opportunity for Lesbian, Gay, Bisexual, and Transgender Health Education Integration in Osteopathic Medicine
Lapinski, J., Diaz, K. M.
The Journal of the American Osteopathic Association, 2016/02
Free full text
863

As the Twig Is Bent, so Grows the Tree—Part 7: Severe Temporal Bone Restriction in Children Is Risk Factor for Acute Otitis Media
King, H. H.
The Journal of the American Osteopathic Association, 2016/01
Free full text
864

Modern Still Life
Pennekamp, A.
The Journal of the American Osteopathic Association, 2016/01
Free full text
865

Altersbedingte Veränderungen des Herz-Kreislauf-Systems
(Age-related changes in the cardiovascular system)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
866

Patienteninfo: Fünf Übungen für mehr Mobilität
(Patient information: Five exercises for more mobility)
Melcher, L.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
867

Osteopathic Students' Graduate Medical Education Aspirations Versus Realities: The Relationship of Osteopathic Medicine and Primary Care
Cummings, M.
Academic Medicine, 2016/01
Free full text
868

Die Faszien im Alter
(Fascia in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
869

Bluthochdruck im Alter
(Hypertension in old age)
Seidler, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
870

Philosophie der Unsterblichkeit
(Philosophy of immortality)
Still, A. T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
871

Rechtliches rund um die osteopathische Praxis: Heilpraktikergesetz und GKV-Erstattungspraxis
(Non-Medical Practitioners Act and GKV reimbursement practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
872

Der lange Weg bis ins hohe Alter
(The long walk to old age)
Chandler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
873

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
874

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text
875

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text
876

Osteopathie – eine kurze Einführung. Grundlagen und geschichtlicher Überblick
(Osteopathy - A short review. Principles and history)
Luthin, D.
Gynakologische Praxis, 2016
877

Rising to New Challenges: Problems and Proposed Solutions for Osteopathic Program Directors
Goldmann, S. I.
The AAO Journal, 2015/12
878

Das Urteil des Oberlandesgerichts Düsseldorf vom 8. September 2015
(The decision of the Higher Regional Court Düsseldorf dated September 8, 2015)
Newiger, C.
Osteopathische Medizin, 2015/12
879

The Educational Model of Private Colleges of Osteopathic Medicine: Revisited for 2003-2013
Cummings, M.
Academic Medicine, 2015/12
Free full text
880

Kindernöte verstehen – das Bewegungsverhalten von Babys und Kindern
(Understanding children's afflictions - The movement behavior of babies and children)
Ritter, K.
Osteopathische Medizin, 2015/12
881

Vascular Dynamics – ein osteopathischer Behandlungsansatz
(Vascular Dynamics - An osteopathic treatment approach)
Vogt, R.
Osteopathische Medizin, 2015/12
882

Safeguarding children in osteopathic practice part 2: Managing concerns about children
Feld, A., Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2015/12
883

Top 5 largest osteopathic medical schools. Ranked by total active enrollment for the 2014-15 school year
listed, No authors
Modern Healthcare, 2015/12
884

The anatomy, biological plausibility and efficacy of visceral mobilization in the treatment of pelvic floor dysfunction
Horton, R. C.
Journal of Pelvic, Obstetric Gynaecological Physiotherapy, 2015/12
Free full text
885

Geschichte der konservativen Wirbelsaulentherapie.
[History of conservative spinal therapy]
Kladny, B.
Der Unfallchirurg, 2015/12
886

Achilles Tendon Disorders
Saini, S. S., Reb, C. W., Chapter, M., Daniel, J. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text
887

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text
888

2015 Updated Method Guideline for Systematic Reviews in the Cochrane Back and Neck Group
Furlan, A. D., Malmivaara, A., Chou, R., Maher, C. G., Deyo, R. A., Schoene, M., Bronfort, G., van Tulder, M. W.
Spine (Phila Pa 1976), 2015/11
889

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text
890

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text
891

Stills Gedanken über Leben, Tod und Jenseits
(Still's thoughts on life, death and the afterlife)
Haxton, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
892

Osteopathische Universität – ein Entwurf
(Osteopathic University - a concept)
Levin, P.
Osteopathische Medizin, 2015/09
893

Osteopathie in Auroville
(Osteopathy in Auroville)
Kraus, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
894

Understanding Fibroblasts in Order to Comprehend the Osteopathic Treatment of the Fascia
Bordoni, B., Zanier, E.
Evidence-based Complementary and Alternative Medicine, 2015/09
Free full text
895

Das Rätsel der böhmischen Heiler in der Geschichte der manuellen Therapien
(The enigma of the Czech healers in the history of manual therapies)
Mildenberger, F. G.
Osteopathische Medizin, 2015/09
896

Implementing the Single Accreditation System for Graduate Medical Education: Seeking Osteopathic Recognition
Shannon, S. C.
The AAO Journal, 2015/09
897

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09
898

Inhärente Rhythmen – komplexe psychophysische Synergismen durch Synchronisation
(Inherent rhythms - Complex psychophysical synergisms through synchronization.)
Pelz, H.
Osteopathische Medizin, 2015/09
899

Kinesiologisches Taping in der Osteopathie
(Kinesiology taping in osteopathy)
Seifert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
Free full text
900

Rechtliches rund um die osteopathische Praxis: Abrechnung der Behandlung
(Billing of treatment)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
901

L'osteopathie a 1'epreuve de l'Evidence-Based Medicine.
[Osteopathy and Evidence-Based Medicine]
Dugailly, P. M.
Revue Medicale de Bruxelles, 2015/09
902

Die osteopathische Behandlung akuter Atemwegserkrankungen im Krankenhaus von Haifa
(The osteopathic treatment of acute respiratory diseases in a hospital in Haifa, Israel)
Waldman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
903

Patienteninfo: Anzeichen für einen Schlaganfall
(Patient information: Signs of a stroke)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
904

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
905

Im Westen was Neues
(News from the West)
Dick-Wallace, S. F.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
906

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09
907

Der Zehengang
(Toe walking)
Guerassimiouk, D., Goussel, W., Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
908

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text
909

Modeled Osteopathic Manipulative Treatments: A Review of Their in Vitro Effects on Fibroblast Tissue Preparations
Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/08
Free full text
910

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text
911

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text
912

Das Schleimhaut-assoziierte lymphatische Gewebe (MALT)
(Mucosa Associated Lymphatic Tissue (MALT))
Höppner, J.P., Stark, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
913

Osteopathische Behandlung bei Patienten mit essenzieller Hypertonie
(Osteopathic treatment in patients with essential hypertension)
Pfeifer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
914

Entzündungsreaktionen aus Sicht der Osteopathie
(Inflammatory reactions from an osteopathic point of view)
Sarzeaud, R., Thon, N., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
Free full text
915

Die Bedeutung der Flüssigkeitsdynamik innerhalb des primären Atemmechanismus
(The importance of fluid dynamics within the primary respiratory mechanism)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
916

A unifying neuro-fasciagenic model of somatic dysfunction – Underlying mechanisms and treatment – Part II
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2015/07
917

Patienteninfo: Gesundheit Schluck für Schluck
(Patient information: Getting healthy sip by sip)
Dürr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
918

Strömung
(Flow)
Geyer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
919

Das vaskuläre System als Hilfe für eine präzise anatomische Palpation
(The vascular system as an aid for precise anatomical palpation)
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
920

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
921

Zwischen Traditionalisten und Reformern: Littlejohns Konzept der Anpassung
(Between traditionalists and reformers: Little Johns concept of adaptation)
Liem, T.
Osteopathische Medizin, 2015/06/01/
922

Didaktik: Palpation, Wahrnehmung und Persönlichkeitsentwicklung
(Didactics: Palpation, perception and personality development)
Krause, R.
Osteopathische Medizin, 2015/06
923

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text
924

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
925

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
926

Osteopathie aus Sicht der Patienten: „Die Blüte entfaltet sich”
(Osteopathy from the patients' point of view: “The blossom unfolds“)
Weber, K.H.
Osteopathische Medizin, 2015/06
927

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06
928

Neue Strategien zur persönlichen und beruflichen Weiterentwicklung für Osteopathen
(New strategies for the further personal and professional development of osteopaths)
Bradonic, B., Risch, A. J.
Osteopathische Medizin, 2015/06
929

Durchblick trotz Wolke: Verwaltung von osteopathischen Praxen per Software
(Perspective in spite of the cloud: Management of osteopathic practices per software)
Hartlep, M.
Osteopathische Medizin, 2015/06
930

Systematic Review Challenges Efficacy of Pediatric OMT
Martincik, L., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text
931

High-Velocity Thrust to the Atlantoaxial Joint Does Not Increase Mechanical Stress on the Vertebral Artery
Guevarra, C. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text
932

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text
933

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text
934

Wie können wir unsere Wahrnehmung verbessern?
(How can we improve our perception?)
Marris, T., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
935

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
936

Was nimmt mein Osteopath wahr?
(What does my osteopath perceive?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
937

Sutherland
Bordoni, B., Zanier, E.
Advances in Mind-Body Medicine, 2015/04
938

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text
939

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
940

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
941

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text
942

Wahrnehmung und ihre Bedeutung für das Patientengespräch
(Perception and its relevance for the patient interview)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
943

Wahrnehmungsstörungen bei Grundschulkindern durch Störungen des hochzervikalen Bereichs
(Perception disorders in elementary school children due to disorders of the high cervical area)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
944

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text
945

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text
946

Was ist eigentlich … Wahrnehmung?
(What actually is perception?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
947

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text
948

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
949

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
950

Recognizing the Value of Manual Therapy Interventions in Women's Health: An Interim Report
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
951

Dramatic Reduction in Menstrual Pain After Osteopathic Manipulative Therapy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
952

OMT—and Placebo—Shown Effective in Reducing Pain During Pregnancy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
953

Chiropraktik in der Bundesrepublik Deutschland von 1949 bis 1975
(Chiropractic in the Federal Republic of Germany from 1949 to 1975)
Mildenberger, F. G.
Osteopathische Medizin, 2015/03
954

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03
955

Osteopathie: eine Heilmethode auf dem Prüfstand
Snijders, C.
Skeptiker, 2015/03
956

Osteopathic Considerations in the Management of Migraine in Pregnancy
Soshnick, S., Mezzone, C., Yao, S., Abu-Sbaih, R.
Osteopathic Family Physician, 2015/03
Free full text
957

Nervus-axillaris-Läsion als mögliche Ursache für Beschwerden in der Schulterregion
(Axillary nerve lesion as possible cause of symptoms in the shoulder region)
Beck, M.
Osteopathische Medizin, 2015/03
958

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text
959

Sutherlands Herangehensweise an den Körper als Ganzes: Die Schoßtechnik
(Sutherland's approach to the body as a whole: the lap technique)
Chandler, P., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
960

Osteopathic Manipulative Treatment Improves Clinical Response and Lowers Relapse Rates Among Patients With Chronic Low Back Pain
Brohard, J. N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01
Free full text
961

Osteopathic Manipulative Treatment Is Effective for Nonspecific Low Back Pain
O'Donnell Rosendahl, N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01
962

Are We Ready to Lead? ACGME Merger: An Opportunity to Fulfill Osteopathy’s Mission
O'Connell, J. A.
The AAO Journal, 2015/01
963

Osteopathische Sterbebegleitung
(Osteopathic terminal care)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
Free full text
964

Alt geworden oder jung geblieben?
(Grown old or stayed young?)
von Studzinski, I.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
965

Veränderungen im Alter
(Changes in old age)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
966

Patienteninfo: Gute Ernährung für gesundes Altern
(Patient information: Good nutrition for healthy aging)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
967

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01
968

Durch Tanzen anders altern
(Aging differently through dancing)
Gierz, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
969

Kann die Arbeit mit dem Liquor älteren Patienten helfen?
(Can working with cerebrospinal fluid help elderly patients?)
Grundberg, S., Höflehner-Schnürch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
970

A single graduate medical education accreditation system: ensuring quality training for physicians and improved health care for the public
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/4
Free full text
971

Pitfalls and challenges involved in the process of perception and interpretation of palpatory findings
Liem, T.
International Journal of Osteopathic Medicine, 2014/12
972

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text
973

Laser Doppler Flowmetry in Manual Medicine Research
Zegarra-Parodi, R., Snider, E. J., Park, P. Y. S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/12
Free full text
974

The accelerated physician assistant pathway: a three-year medical school curriculum for physician assistants to obtain DO degrees
Kauffman, M., Ferretti, S. M.
Academic Medicine, 2014/12
Free full text
975

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text
976

‘I am afraid to make the damage worse’ – Fear of engaging in physical activity among patients with neck or back pain
Thomson, O.
International Journal of Osteopathic Medicine, 2014/12
977

Osteopathic decapitation: Why do we consider the head differently from the rest of the body? New perspectives for an evidence-informed osteopathic approach to the head
Gabutti, M., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2014/12
978

Safeguarding children in osteopathic practice: Part 1: Identifying children at risk
Maddick, A. F., Feld, A., Laurent, S.
International Journal of Osteopathic Medicine, 2014/12
979

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text
980

Prozess der Wahrnehmung und Interpretation von Palpationsbefunden
(Process of perception and interpretation of palpation findings).
Liem, T.
Osteopathische Medizin, 2014/11
981

Mesenchymale Entwicklung des Gehirn-Herz-Feldes
(Mesenchymal development of the brain-heart field.)
Lischent, M.
Osteopathische Medizin, 2014/11
982

Chiropraktik in Deutschland – die Zeit vor 1945
(Chiropractic in Germany - the time before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2014/11
983

Embryologie nach Blechschmidt – Teil 2: Muskeln und Gelenke
(Embryology according to Blechschmidt - Part 2: Muscles and joints)
Wojtowicz, A.
Osteopathische Medizin, 2014/11
984

Use of beat-to-beat cardiovascular variability data to determine the validity of sham therapy as the placebo control in osteopathic manipulative medicine research
Henley, C. E., Wilson, T. E.
The Journal of the American Osteopathic Association, 2014/11
Free full text
985

Osteopathische Forschungsinstitutionen: eine Übersicht
(Osteopathic research institutions: an overview)
Newiger, C.
Osteopathische Medizin, 2014/11
986

Die Bedeutung der Faszien im Hochleistungssport
(The importance of fascia in high-performance sports)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
987

Das Fasziendistorsionsmodell (nach Typaldos): Die 6 Störungen und deren Behandlung
(The fascial distortion model (according to Typaldos): The 6 disorders and their treatment)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
988

Osteopathic Manipulative Treatment Induces Enhanced Intracellular Immune Response
Blumer, J.
The Journal of the American Osteopathic Association, 2014/10
Free full text
989

Daumengrundgelenk: Taping zur Immobilisation eines Skidaumens
(Metacarpophalangeal joint: taping for immobilization of a ski thumb)
Langendoen, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
990

Dose-Response Research in Chiropractic Care and Possible Comparisons With OMT
King, H. H.
The Journal of the American Osteopathic Association, 2014/10
Free full text
991

OMT Is Efficacious for Patients With High Baseline Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/10
Free full text
992

How to Win the Match Against Tennis Elbow: A Comparison of Different Techniques
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/10
Free full text
993

Als Osteopath bei den Olympischen Sommerspielen
(At the Summer Olympics as an Osteopath)
Maurer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
994

Das Supinationstrauma aus osteopathischer Sicht
(The supination trauma from an osteopathic point of view)
Peramo, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
995

Somatogene Reize bei Sportlern und deren Einfluss auf das Haltungssystem
(Somatogenic stimuli in athletes and their influence on the postural system)
van Caille, P.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
996

Hypnose in Leistungssport und Osteopathie
(Hypnosis in competitive sports and osteopathy)
von Fischern, I.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
997

Achillodynie
(Achillodynia)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
998

Osteothek: Schnelle Hilfe und fundierte Informationen für die osteopathische Praxis
(Osteothek: Quick help and sound information for osteopathic practice)
Dierlmeier, D.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
999

Bewegung – osteopathische Domäne oder ungenutztes Potenzial?
(Movement - osteopathic domain or untapped potential?)
Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
1000

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1001

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1002

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09
1003

Gesetz gegen den unlauteren Wettbewerb und Heilmittelwerbegesetz
(Law against unfair competition and the law on the advertising of medicinal products)
Köber, C.
Osteopathische Medizin, 2014/09
1004

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text
1005

Embryologie nach Blechschmidt – Entwicklung der Gliedmaßen
(Embryology according to Blechschmidt - development of the limbs)
Wojtowicz, A.
Osteopathische Medizin, 2014/09
1006

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text
1007

What about OMT and nutrition for managing the irritable bowel syndrome? An overview and treatment plan
Collebrusco, L., Lombardini, R.
Explore (NY), 2014/09
1008

Osteopathic Primary Care of Patients With Inflammatory Bowel Disease: A Review
Bragg, J. D.
The Journal of the American Osteopathic Association, 2014/09
Free full text
1009

Osteopathie und Naturheilkunde in der Schweiz
(Osteopathy and naturopathy in Switzerland)
Vogel, C.
Osteopathische Medizin, 2014/09
1010

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
1011

Beeinflussung des Herz-Kreislauf-Systems durch die Faszien
(The fasciae's influence on the cardiovascular system)
Bartmer-Leitl, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1012

Das Herz – Eine Druck-Saug-Pumpe mit ausgeklügeltem Energierückgewinnungssystem
(The heart - A pressure-suction pump with a sophisticated energy recovery system)
Kuhmann, O.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1013

Stimmt unsere Vorstellung vom venösen System?
(Is our conception of the venous system accurate?)
Thon, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1014

Osteopathische Annäherung an die Arteriosklerose
(Osteopathic approach to arteriosclerosis)
Elferink, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1015

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1016

Impact of the single accreditation agreement on GME governance and the physician workforce
Kelley, C. S.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1017

Patienteninfo: Herzinfarkt bei Frauen
(Patient information; Heart attack in women)
Gräfin von Pfeil, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1018

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1019

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 2
Hendryx, J. T.
The AAO Journal, 2014/06
Free full text
1020

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06
1021

Osteopath--ein eigenstandiger Heilberuf?
(Osteopath - an independent health profession?)
Ostendorf, G. M.
Versicherungsmedizin, 2014/06
1022

Vibration und Gewebewiederherstellung
(Vibration and tissue repair)
Garoli, A.
Osteopathische Medizin, 2014/06
1023

Osteopathie in Kenia – humanitäre Hilfe und Engagement gegen die weibliche Genitalverstümmelung
(Osteopathy in Kenya - Humanitarian aid and commitment against female genital mutilation)
Gassmaier, H.
Osteopathische Medizin, 2014/06
1024

Behandlung von Säuglingen mit Regulationsstörungen – Anregungen für die Ausbildung gemäß GAIMH
(Treatment of infants with adjustment disorders - Stimuli for the education according to the GAIMH)
Gillemot, B.
Osteopathische Medizin, 2014/06
1025

Bezuschussung osteopathischer Behandlungen: Versicherte und Krankenkassen profitieren
(Subsidization of osteopathic treatments: Insured and health insurance companies benefit)
Ismail-Tsaous, E.
Osteopathische Medizin, 2014/06
1026

Osteopathische Behandlung der Dura mater spinalis in der hochzervikalen Region
(Osteopathic treatment of the dura mater spinalis in the upper cervical region)
Liem, T.
Osteopathische Medizin, 2014/06
1027

Reprint of: Elevating the quality of disability and rehabilitation research: Mandatory use of the reporting guidelines
collective, Authors
International Journal of Osteopathic Medicine, 2014/06
Free full text
1028

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06
1029

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1030

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1031

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text
1032

Manual Therapy Shown to Be Effective for Tension-Type Headache
King, H. H.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1033

OMT Improves Acute Hemodynamic Control in Pregnancy by Means of Improved Venous Return
Seffinger, M. A., Brohard, J. N.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1034

G.I. Joe: Could Visceral Osteopathy Help Fight the War against IBS?
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1035

Two novel nonsurgical treatments of carpal tunnel syndrome
Schreiber, A. L., Sucher, B. M., Nazarian, L. N.
Physical Medicine and Rehabilitation Clinics of North America, 2014/05
1036

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1037

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1038

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1039

Development of a data collection tool to profile osteopathic practice: use of a nominal group technique to enhance clinician involvement
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
1040

Schlafstörungen bei Säuglingen und Kindern
(Sleep disorders in infants and children)
Lim, K. W., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1041

Das fetale Alkoholsyndrom
(Fetal alcohol syndrome)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1042

Patienteninfo: Alkohol in der Schwangerschaft
(Patient information: Alcohol during pregnancy)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1043

Hirnnerven und Dysfunktionen des Schädels
(Cranial nerves and dysfunctions of the skull)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1044

Auffinden von peripheren Nerven am Beispiel des N. radialis
(Locating peripheral nerves using the radial nerve as an example)
Van Loo, B.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1045

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1046

Wissenschaftliche Neubewertung der Liquordynamik
(Scientific reassessment of cerebrospinal fluid dynamics)
Hass-Degg, K.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1047

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1048

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 1
Hendryx, J. T.
The AAO Journal, 2014/03
Free full text
1049

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03
1050

Hydrodynamik des Liquor cerebrospinalis – eine Neubewertung
(Cerebrospinal fluid hydrodynamics - A reassessment)
Chikly, B., Quaghebeur, J.
Osteopathische Medizin, 2014/03
1051

Tonische Immobilität als häufige Ursache für funktionelle Störungen
(Tonic immobility as a common cause of functional disorders)
Fleischhauer, M., Krebs, C.A.
Osteopathische Medizin, 2014/03
1052

Was wir fühlen – Dimensionen der taktilen Wahrnehmungsfähigkeit
(What we feel - Dimensions of the tactile perception ability)
Hartlep, M.
Osteopathische Medizin, 2014/03
1053

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1054

Osteopathic Manipulation in the Treatment of Primary Nocturnal Enuresis: A Retrospective Chart Review
Kanze, D. M., Kanze, K. A.
The AAO Journal, 2014/03
1055

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1056

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03
1057

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03
1058

The self-directed osteopathic medical student: Bringing adult learning into the osteopathic manipulative technique lab
Jons-Cox, L.A. D.
International Journal of Osteopathic Medicine, 2014/03
1059

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03
1060

Manuelle Behandlung des M. supraspinatus
(Manual treatment of the supraspinatus muscle)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03
1061

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text
1062

Osteopathie als “eigenstandiger Heilberuf“. Sollen Bademeister auf eigene Faust Patienten behandeln?
(Osteopathy as an “independent healing profession“. Should balneology specialists treat patients independently? )
Ostendorf, G. M.
MMW - Fortschritte der Medizin, 2014/02
1063

The integration of the “spirituality in medicine“ curriculum into the osteopathic communication curriculum at Kansas City University of Medicine and Biosciences
Talley, J. A., Magie, R.
Academic Medicine, 2014/01
Free full text
1064

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1065

Abdominal Muscles Are the Front Side of the Low Back
King, H. H.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1066

Review of Severe Adverse Events From Spinal Manipulative Therapy of the Lumbopelvic Area
King, H. H.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1067

OMT Relieves Severe Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1068

Systematic Review Paints Incomplete Picture of OMT Research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1069

Manual Therapy or Exercise Effective for Hip or Knee Osteoarthritis
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1070

A Research Primer, Part 2: Guidelines for Developing a Research Project
Yens, D. P., Brannan, G. D, Dumsha, J. Z.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1071

Schuhe und chronische Fußschmerzen im Alter
(Shoes and chronic foot pain in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1072

New frontiers in medical education: simulation technology at Campbell University School of Osteopathic Medicine
Maddox, R. W., Schmid, R. J.
North Carolina Medical Journal, 2014/01
1073

Die Entwicklung des Fußes und die Folgen des Laufens
(The development of the foot and the consequences of walking)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1074

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1075

Der lebendige Fuß des Menschen aus osteopathischer Sicht
(The living human foot from an osteopathic perspective)
Wales, A., Mitha, N., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1076

Der Osteopath am Fuße des Patienten
(The osteopath at the foot of the patient)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1077

Was ist Podo-Postural-Therapie?
(What's Podo-Postural Therapy?)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1078

Die Mechanik des Fußes
(The mechanics of the foot)
Zwierzchowska, Z., Vieten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1079

Die Galea aponeurotica als fasziale Struktur
(The galea aponeurotica as a fascial structure)
Barty, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1080

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1081

Patienteninformation: Gymnastik für gesunde Füße
(Patient information: Gymnastics for healthy feet)
Englisch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1082

Osteopathy and low back pain, acupuncture and in vitro fertilization, Tai Chi and osteoarthritis, Andrographis paniculata and ulcerative colitis, and acupressure and vertigo
Pettit, J., Glickman-Simon, R.
Explore (NY), 2014/01
1083

Assessing impact of not attending lectures on osteopathic medical student performance: Brief survey of the literature and proposed future research
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2013/12
1084

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12
1085

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12
1086

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12
1087

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text
1088

Potential New Dimensions in Dermatology: The Osteopathic Approach to Cutaneous Disease
Michunovich, A. M., Stern, R.
The AAO Journal, 2013/12
Free full text
1089

The Application of the Cranial Concept in the Investigation of Baffling Medical Disorders and Their Treatment: A Synergopathic Medical Disease Model
Pribadi, K. S.
The AAO Journal, 2013/12
Free full text
1090

Das biodynamische Konzept im Rahmen der Osteopathie
(The biodynamic concept in the framework of osteopathy)
Weber, K.H.
Osteopathische Medizin, 2013/11
1091

Therapiekonzepte bei kraniofazialen Dysmorphien
(Treatment concepts in craniofacial dysmorphism)
Prediger, G., von Gernet, S.
Osteopathische Medizin, 2013/11
1092

Zukunft und Qualität der Osteopathie in Deutschland
(Future and quality of osteopathy in Germany)
Osteopathische Medizin, 2013/11
1093

Plagiozephalie – Ursachen und Hintergründe
(Plagiocephaly - Causes and background)
Künzel, K.H., Hoermann, R.
Osteopathische Medizin, 2013/11
1094

Evidenzbasierte Medizin – der Goldstandard auch in der Osteopathie?
(Evidence-based medicine - the golden standard also in osteopathy?)
Hartwig, B.
Osteopathische Medizin, 2013/11
1095

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text
1096

Swedenborgs Einfluss auf die Osteopathie
(Swedenborg's influence on osteopathy)
Fuller, D. B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1097

„Mein Andrew Taylor Still“
(“My Andrew Taylor Still“)
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1098

Don't Throw the Baby Out With the Bath Water
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1099

Systematic Review of OMTh for Lower Urinary Tract Symptoms in Women Shows Benefit
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1100

Systematic Review of CAM Approaches to Otitis Media: The Otolaryngology Perspective
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1101

Quantifying Lack of Interexaminer Reliability
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1102

Die zeitlosen Lehren des Andrew Taylor Still
(The Timeless Teachings of Andrew Taylor Still)
Lewis, J.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1103

Bewegung und Stille in der Arbeit mit Kindern
(Movement and stillness while working with children)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1104

Abseits ausgetretener Pfade: Ein neuer Blick auf die Faszie
(Off the beaten paths: a new look at the fascia)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1105

Natural Bridge: Wo sich Osteopathie und Natur verbinden
(The Natural Bridge: Where osteopathy and nature combine)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1106

Patienteninfo: Die Anfänge der Osteopathie
(Patient information: The beginnings of osteopathy)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1107

A. T. Still und die Wissenschaft
(A. T. Still and science)
Trowbridge, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1108

Osteopathic dermatology residency training through Nova Southeastern University College of Osteopathic Medicine at Largo Medical Center
Walls, B.
Cutis, 2013/10
Free full text
1109

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1110

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1111

Markenstreit beendet
(Brand dispute settled)
Osteopathische Medizin, 2013/09
1112

Emotional Tissue – eine Annäherung
(Emotional tissue - An approach)
Hartwig, B.
Osteopathische Medizin, 2013/09
1113

Osteopathie in Portugal staatlich reguliert
(Osteopathy in Portugal is regulated by the state)
Hartlep, M.
Osteopathische Medizin, 2013/09
1114

Neurologische Betrachtung der Osteopathie
(Neurological consideration of osteopathy)
Eckardt, P.
Osteopathische Medizin, 2013/09
1115

Neurologische Integration nach Allan Phillips
(Neurological integration by Allan Phillips)
Eckardt, P.
Osteopathische Medizin, 2013/09
1116

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text
1117

Further Demonstration of the Benefit of Osteopathic Manipulative Therapy in Pediatric Care
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1118

Visceral Manipulation Is Shown to Reduce Postoperative Ileus in an Animal Model
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1119

Osteopathic Manipulative Therapy Affects the Position of Internal Organs in Humans
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1120

Osteopathic Manipulative Treatment Is Efficacious for Management of Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1121

Multimodal Chest Physiotherapy Is Beneficial for Patients Receiving Ventilation
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1122

Manual Therapy Is Beneficial for Cervical Radiculopathy
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1123

Wer waren eigentlich …
(Who actually were ...)
Lewis, J. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1124

Die osteopathische Behandlung der Geburtserfahrung
(Osteopathic treatment of the birth experience)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1125

Patienteninfo: Warum ist die Bauchlage für Säuglinge so wichtig?
(Patient information: Why is the prone position so important for infants?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1126

Okulomotorik und visuelle Teilleistungsstörungen
(Oculomotor and partial visual impairment)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1127

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1128

Die frühkindliche Bewegungsentwicklung
(Early childhood movement development)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1129

Reassessing cerebrospinal fluid (CSF) hydrodynamics: a literature review presenting a novel hypothesis for CSF physiology
Chikly, B., Quaghebeur, J.
Journal of Bodywork and Movement Therapies, 2013/07
1130

Oxytocingabe während der Geburt und ADHS
(Oxytocin during birth and ADHD)
Fleischer, F.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1131

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07
1132

Osteopathische Diagnostik und Behandlung bei Stillproblemen
(Osteopathic diagnostics and treatment for breastfeeding problems)
Haller, L.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1133

Spiegelneuronen – ein unentbehrliches Werkzeug in der Osteopathie
(Mirror neurons - An indispensable tool in osteopathy)
Von Gimborn, G.
Osteopathische Medizin, 2013/06
1134

Gesundheit durch Ganzheit – ein osteopathisch-salutogenetischer Ansatz
(Health by means of wholeness - An osteopathic-salutogenic approach)
Risch, A. J.
Osteopathische Medizin, 2013/06
1135

Neurolymphatische Bahnen: neue wissenschaftliche Nachweise untermauern die Perrin-Technik
(Neurolymphatic pathways: New scientific evidences corroborate the Perrin technique)
Perrin, R. N.
Osteopathische Medizin, 2013/06
1136

Perrin-Technik am Beispiel des chronischen Müdigkeitssyndroms
(Perrin technique using chronic fatigue syndrome as an example)
Perrin, R. N.
Osteopathische Medizin, 2013/06
1137

Osteopathie als Kunst?
(Osteopathy as art?)
Novy, R., Sommerfeld, P.
Osteopathische Medizin, 2013/06
1138

Osteopathic manipulative treatment and nutrition: An alternative approach to the irritable bowel syndrome
Collebrusco, L., Lombardini, R.
Health, 2013/06
Free full text
1139

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text
1140

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text
1141

Treatment of a posterior rib utilizing a multimodal sequence of osteopathic manipulative treatments
Baker, J. P., Ely, R.
The AAO Journal, 2013/06
Free full text
1142

The liquorodynamic model of the primary respiratory mechanism
Moskalenko, Y. E., Kravchenko, T. I., Weinstein, G. B., Vardy, T. C.
The AAO Journal, 2013/06
Free full text
1143

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
1144

La prise en charge medicale et osteopathique de l'enuresie nocturne primalre isolee.
(The medical and osteopathic management of isolated primary nocturnal enuresis)
Burguete, E., Dubois, T.
Soins Pédiatrie/Puériculture, 2013/05
1145

Manual Therapy May Benefit Women With Primary Dysmenorrhea
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1146

Patienteninfo: Häusliche Versorgung – armer Rücken?
(Patient information: Home care - poor back?)
Janssen, A.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1147

Severity of Irritable Bowel Syndrome Symptoms Is Reduced by Osteopathy
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1148

Manual Therapy May Benefit Women With Interstitial Cystitis and Pelvic Floor Pain
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1149

Patientenrechtegesetz: Was bedeutet es für Behandelnde?
(Patients' Rights Act: What does it mean for practitioners?)
Kämper, S.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1150

Der venolymphatische Pumpmechanismus: Denkmodell oder Wirklichkeit?
(The venolymphatic pump mechanism: concept or reality?)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1151

Vaskularisierung der Lendenwirbelsäule
(Vascularization of the lumbar spine)
Rapprich, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1152

The use of placebo interventions in clinical practice
Linde, K.
Complementary Therapies in Medicine, 2013/04
Free full text
1153

Welches Gewebe ist verantwortlich für Lumbalgien und Ischialgien?
(Which tissue is responsible for lumbagos and sciaticas?)
Barth, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1154

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1155

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1156

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1157

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1158

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1159

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text
1160

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03
1161

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03
1162

From distinct to indistinct, the life cycle of a medical heresy. Is osteopathic distinctiveness an anachronism?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2013/03
1163

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03
1164

The Biopsychosocial model: Redefining osteopathic philosophy?
Penney, J. N.
International Journal of Osteopathic Medicine, 2013/03
1165

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
1166

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03
1167

Osteopathie im Kontext der italienischen Politik
(Osteopathy in the context of Italian politics)
Tozzi, P.
Osteopathische Medizin, 2013/03
1168

Wie sehen die Finger? Unbewusste Wahrnehmung als eine Grundlage der Intuition
(How do the fingers see? Unconscious perception as a basis of intuition)
Sidler, S.
Osteopathische Medizin, 2013/03
1169

Osteopathische Aspekte der Haltungsasymmetrie des Säuglings – eine funktionelle Betrachtung
(Osteopathic aspects of infantile postural asymmetry – A functional examination)
Riedel, M.
Osteopathische Medizin, 2013/03
1170

Druckerhöhungen in den Kavitäten und ihr Einfluss auf den Organismus
(Increases in pressure in the cavities and their influence on the organism)
Maassen, A.
Osteopathische Medizin, 2013/03
1171

Evaluating teaching methods and assessment tools of high velocity low amplitude techniques for undergraduate osteopathic manipulative treatment of the spine
Channell, M. K.
The AAO Journal, 2013/03
Free full text
1172

Exercise Shown Effective for Management of Neck Pain—Who Needs OMT?
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1173

Visceral Manipulation May Affect Pain Perception
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1174

Frozen Shoulder Treatment—Different Strokes for Different Folks
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1175

Trauma: Betrachtung aus osteopathischer Sicht
(Trauma: Viewed from an osteopathic perspective)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1176

Osteopathic Fascial Manipulation Reduces Low Back Pain and Increases Kidney Mobility
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1177

Patienteninfo: Unterstützung eines Kindes nach einem Trauma
(Patient information: support of a child after trauma)
Korittko, A.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1178

Abdominal Visceral Manipulation Prevents and Reduces Peritoneal Adhesions
Seffinger, M. A., Martin, A. J.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1179

Patienten mit Demenz: Das sollten Sie im Umgang mit ihnen beachten
(Patients with dementia: What you should bear in mind when dealing with them)
Maier, R., Mayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1180

Die Rolle des Diaphragmas bei der lymphatischen Absorption aus der Peritonealhöhle
(The role of the diaphragm in lymphatic absorption from the peritoneal cavity)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1181

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1182

Die Rolle der Osteopathie im Umgang mit Trauma – ein persönlicher Bericht
(The role of osteopathy in dealing with trauma - a personal account)
Brown, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1183

Physiologie seelischer Traumata und posttraumatischer Belastungsstörungen (PTBS)
(Physiology of mental trauma and post-traumatic stress disorder (PTSD))
Dietrich, B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1184

Biotensegrity: a unifying theory of biological architecture with applications to osteopathic practice, education, and research--a review and analysis
Swanson, R. L.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1185

Die Gesundheit im Trauma entdecken
(Discovering health within trauma)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1186

A logical approach to complicated sacral and innominate dysfunction
Klock, G. B.
The AAO Journal, 2012/12
Free full text
1187

The stabilometric platform as a measuring instrument
Huard, Y.
The AAO Journal, 2012/12
Free full text
1188

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12
1189

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12
1190

Osteopathische manuelle Behandlung von Scharlach bei Kindern im 19. und 20. Jahrhundert
(Osteopathic manual treatment of scarlet fever in children in the 19th and 20th centuries)
Liem, T., Ciranna-Raab, C.
Osteopathische Medizin, 2012/12
1191

Forscher entdecken ein neues Drainagesystem des Gehirns
(Researchers discover a new drainage system of the brain)
Risch, A. J.
Osteopathische Medizin, 2012/12
1192

Techniken der kardiovaskulären Osteopathie
(Techniques of cardiovascular osteopathy)
Van Den Heede, P., Danjon, J.L.
Osteopathische Medizin, 2012/12
1193

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12
1194

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1195

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1196

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1197

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1198

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1199

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1200

Wie viel Anatomie braucht die Osteopathie oder was haben Sie sich nur dabei gedacht, lieber Dr. Still?
(How much anatomy does osteopathy need, or what were you thinking, dear Dr. Still?)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1201

Form-Funktion und die Sache mit der Embryologie
(Form-Function and the matter of embryology)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1202

Patienteninfo: Wie viel raffinierter Zucker ist gesund?
(Patient information: How much refined sugar is healthy?)
Jongschaap, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1203

Die hilflosen Helfer
(Helplessly helping)
Textor, R.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1204

Posture and chronic gonalgia in the elderly: contribution of osteopathic treatment
Huard, Y.
Computer Methods in Biomechanics and Biomedical Engineering, 2012/10
1205

Osteopathic manipulative treatment: novel application to dermatological disease
Campbell, S. M., Winkelmann, R. R., Walkowski, S.
Journal of Clinical and Aesthetic Dermatology, 2012/10
1206

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text
1207

Heterotaxien in der menschlichen Entwicklung
(Heterotaxies in human development)
Doll, S.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1208

Die physiologische Entwicklung in den ersten Lebensjahren
(The physiological development in the first years of life)
Guerassimiouk, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1209

An open letter to those in purely osteopathic manipulative medicine practices on reimbursement strategies
Jorgensen, D. J.
The AAO Journal, 2012/09
1210

Somatic dissatisfaction - Somatic dysfunction and the role of intention in treatment
Comeaux, Z. J.
The AAO Journal, 2012/09
Free full text
1211

Osteopathie und Wissenschaft: Körperwahrnehmung durch innere und äußere Afferenzen
(Osteopathy and science: Body awareness through interoceptive and exteroceptive afferences)
Hartmann, C.
Osteopathische Medizin, 2012/09
1212

Funktionsstörungen des Ösophagus und des gastro-ösophagealen Übergangs: Anatomie und Pathomechanismus
(Functional disorders of the esophagus and esophagogastric junction: Anatomy and pathomechanism)
Raab, M., Scheuerer, L. M.
Osteopathische Medizin, 2012/09
1213

Metaphern für Gesundheit – Gesundheit als Metapher
(Metaphors for health - Health as metaphor)
Risch, A. J.
Osteopathische Medizin, 2012/09
1214

Funktionsstörungen des Ösophagus und des gastro-ösophagealen Übergangs: Techniken zur Behandlung
(Functional disorders of the esophagus and esophagogastric junction: Techniques for the treatment)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2012/09
1215

Wie denken die Finger? Unbewusstes Denken als eine Grundlage der Intuition
(How do the fingers think? Unconscious thinking as a basis of intuition)
Sidler, S.
Osteopathische Medizin, 2012/09
1216

The eccentricities of osteopathy
Moore, W.
The BMJ, 2012/09
1217

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text
1218

Consent, competence and confidentiality for children and young people: Case problems from osteopathic practice
Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2012/09
1219

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1220

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1221

Topografie des weiblichen Beckens
(Topography of the female pelvis)
Lütjen-Drecoll, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1222

Stressinkontinenz nach einer Geburt
(Stress incontinence after childbirth)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1223

„Sacral Sag“ und mögliche klinische Folgen
(“Sacral Sag“ and possible clinical consequences)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1224

Packende Fachartikel – So geht es
(Writing gripping professional articles - Here's how)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1225

Kaiserschnittgeburt: erhöhtes Risiko für Typ-1-Diabetes
(Caesarean delivery: increased risk for type 1 diabetes)
Schubert, A.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1226

Patienteninfo: Beckenbodenübungen
(Patient information: pelvic floor exercises)
Vleminckx, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1227

From clinical experience to a model for the human fascial system
Day, J. A., Copetti, L., Rucli, G.
Journal of Bodywork and Movement Therapies, 2012/07
1228

Trauma: Sexuelle Gewalt und ihre Folgen
(Trauma: Sexual Violence and its aftermath)
Dietrich, B.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1229

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1230

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1231

The safety and efficacy of osteopathic manipulation in the treatment of mTBI (mild traumatic brain injury) in U.S. service members as validated by SPECT scan: A report of planned research
Nevins, N. A., Fraix, M.
The AAO Journal, 2012/06
Free full text
1232

A consideration of the elbow as a tensegrity structure
Scarr, G.
International Journal of Osteopathic Medicine, 2012/06
1233

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06
1234

Anatomie des Neugeborenen unter besonderer Berücksichtigung des Schädels und der oberen Halswirbelsäule
(Anatomy of the newborn with special consideration of the cranium and the upper cervical spine)
Beck, M.
Osteopathische Medizin, 2012/06
1235

Differenzierung myofaszialer Schmerzpunkte in Genese und Therapie
(Differentiation of myofascial pain points in genesis and treatment)
Eisenreich, U.
Osteopathische Medizin, 2012/06
1236

Was ist Gesundheit? Was ist Krankheit? Überlegungen zu einem Problemkomplex
(What is health? What is disease? Deliberations about a complex of problems)
Flatscher, M., Liem, T.
Osteopathische Medizin, 2012/06
1237

Geburtstraumatisch bedingte Blockierungen an Schädel, Wirbelsäule und Becken des Säuglings
(Blockades on cranium, spine and pelvis of the infant induced by birth trauma)
Wildgruber, H.
Osteopathische Medizin, 2012/06
1238

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text
1239

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text
1240

ACGME tightens postgraduate training entry requirements: doctors of osteopathic medicine, international medical graduates most affected
Cearnal, L.
Annals of Emergency Medicine, 2012/05
1241

The effect of muscle energy techniques on disability and pain scores in individuals with low back pain
Day, J. M., Nitz, A. J.
Journal of Sport Rehabilitation, 2012/05
1242

Differenzialdiagnostik von Kopfschmerzen bei Erwachsenen
(Differential diagnostics of headache in adults)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1243

Kopfschmerzforschung – ein Update
(Headache research - an update)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1244

Perikranielle Anatomie der chirurgischen Migränetherapie
(Pericranial anatomy of surgical migraine therapy)
Muehlberger, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1245

Kopfschmerzen: Behandlung nach dem Fasziendistorsionsmodell
(Headache: treatment according to the fascial distortion model)
Nagel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1246

Zeitmanagement – Entschleunigen Sie Ihr Leben!
(Time management - slow down your life!)
Schopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1247

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1248

Wie Vorstellungen die Beschwerden der Patienten beeinflussen
(How beliefs influence patient discomforts)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1249

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1250

What’s in a Name? A Brief Look at the History of Board Certification in Neuromusculoskeletal Medicine and Osteopathic Manipulative Medicine
Hruby, R. J.
The AAO Journal, 2012/03
Free full text
1251

Fasziendistorsionsmodell (FDM) nach Typaldos
(Fascial distortion model (FDM) according to Typaldos)
Harrer, G.
Osteopathische Medizin, 2012/03
1252

Osteopathie und Wissenschaft
(Osteopathy and science)
Liem, T., Hilbrecht, H., Schmidt, T.
Osteopathische Medizin, 2012/03
1253

Osteopathiestudium in Deutschland und Österreich
(Osteopathy studies in Germany and Austria)
Newiger, C.
Osteopathische Medizin, 2012/03
1254

Kopfschmerzbehandlung – Gedanken aus dem Praxisalltag
(Practice and technique: Treatment of headache - Thoughts from the practical daily routine)
Unverricht, R.
Osteopathische Medizin, 2012/03
1255

Osteopathie in Belgien
(Osteopathy in Belgium)
van Dun, P. L. S.
Osteopathische Medizin, 2012/03
1256

Selected fascial aspects of osteopathic practice
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2012/03
Free full text
1257

Reflex Relationships of Paravertebral Muscles
Elbe, J. N.
The AAO Journal, 2012/03
Free full text
1258

The Ram of Reason Seal: Musings on its Origin and Meaning
Hruby, R. J.
The AAO Journal, 2012/03
Free full text
1259

Spontaneous Release by Positioning
Jones, L. H.
The AAO Journal, 2012/03
Free full text
1260

The Neural Basis of the Osteopathic Lesion
Korr, I. M.
The AAO Journal, 2012/03
Free full text
1261

Structural Pelvic Function
Mitchell, F. L.
The AAO Journal, 2012/03
Free full text
1262

The Role of the Fascae in the Maintenance of Structural Integrity
Page, L. E.
The AAO Journal, 2012/03
Free full text
1263

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text
1264

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text
1265

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03
1266

Strain counterstrain: current concepts and clinical evidence
Wong, C. K.
Manual Therapy, 2012/02
1267

„Was Sie machen, ist doch keine Osteopathie!“ – Ansätze zu einem konsensfähigen Selbstverständnis
(“What you are doing is not osteopathy after all!“ - Approaches to a consensual self-image)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1268

Vom Dialog mit dem Gewebe zur Gestaltung der therapeutischen Beziehung
(From the dialogue with the tissue to the shaping of the therapeutic relationship)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1269

Wie viel Differenzialdiagnostik braucht die Osteopathie?
(How much differential diagnostics does osteopathy need?)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1270

Osteopathie studieren – wieso, weshalb, warum?
(Why study osteopathy?)
Meyer, B., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1271

Die ersten Tage der DO … Aus dem Nähkästchen geplaudert
(The first days of the DO - telling it all)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1272

Ankommen in der Gegenwart oder ist die Osteopathie noch zu retten?
(Arriving in the present or can osteopathy still be saved?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1273

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text
1274

Keep it simple!
(Keep it simple!)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1275

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1276

Fasziendistorsionsmodell nach Typaldos im Routinebetrieb eines Ambulatoriums
(Fascial distortion model according to Typaldos in routine operation of an outpatient clinic)
Gallei, L.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1277

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1278

Osteopathische Berührung im Spiegel der Supervision
(Osteopathic touch in the mirror of supervision)
Hähn-Jakobs, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1279

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text
1280

Ligamentous Articular Strain Technique – a manual treatment approach for ligamentous articular injuries and the whole body
Libbey, R.
Journal of Prolotherapy, 2012
Free full text
1281

A hypothesis to explain the palpatory experience and therapeutic claims in the practice of osteopathy in the cranial field
Hamm, D.
International Journal of Osteopathic Medicine, 2011/12
1282

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12
1283

Manipulative Methods of Dr. A.T. Still
Archer, J.
The AAO Journal, 2011/12
Free full text
1284

What is health? What is disease? Thoughts on a complex issue
Flatscher, M., Liem, T.
The AAO Journal, 2011/12
Free full text
1285

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text
1286

Palpation des kraniosakralen Rhythmus
(Palpation of the craniosacral rhythm)
Liem, T.
Osteopathische Medizin, 2011/12
1287

From The Archives: From: Still AT. The Autobiography of A.T. Still. Kirksville, MO: Published by the author; 1908: 324-328.
Still, A. T.
The AAO Journal, 2011/12
Free full text
1288

Osteopathie in Österreich
(Osteopathy in Austria)
Schulmeyer, A.
Osteopathische Medizin, 2011/12
1289

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text
1290

Innenstrukturen des Thorax
(Internal structures of the thorax)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1291

Steuerungsorgan Zwerchfell
(Control organ diaphragm)
Büsser, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1292

Wie zufrieden sind meine Patienten? – Patientenbefragungen in der Osteopathiepraxis richtig durchführen
(How satisfied are my patients? - Conducting patient surveys correctly in the osteopathic practice)
Ebersberger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1293

Atmung und obere Thoraxöffnung
(Breathing and upper thoracic opening)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1294

Lungen: Form und Funktion in der osteopathischen Praxis
(Lungs: Form and function in osteopathic practice)
Kuhlmann, C., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1295

Patienteninfo: Obstruktive Bronchitis im Kindesalter
(Patient information: Obstructive bronchitis in childhood)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1296

Osteopathische Behandlung der Lungenentzündung: schneller gesund, weniger Komplikationen
(Osteopathic treatment of pneumonia: faster recovery, fewer complications)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1297

Lymphatic pump treatment enhances the lymphatic and immune systems
Hodge, L. M., Downey, H. F.
Experimental Biology and Medicine (Maywood, N.J.), 2011/10
1298

Patterns of chronic pain in the population
Carnes, D.
International Journal of Osteopathic Medicine, 2011/09
1299

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text
1300

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09
1301

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text
1302

The role of spinal manipulation, soft-tissue therapy, and exercise in chronic obstructive pulmonary disease: a review of the literature and proposal of an anatomical explanation
Engel, R., Vemulpad, S.
The Journal of Alternative and Complementary Medicine, 2011/09
Free full text
1303

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text
1304

Das autonome Nervensystem in der Osteopathie: Überblick über die therapeutischen Optionen
(The autonomic nervous system in osteopathy: Overview of therapeutic options)
Beck, A.K.
Osteopathische Medizin, 2011/09
1305

Das autonome Nervensystem und seine neuroanatomischen und neurobiologischen Komponenten
(The autonomic nervous system and its neuroanatomical and neurobiological components)
Beck, M.
Osteopathische Medizin, 2011/09
1306

Neubewertung der klassischen osteopathischen Feldtheorie am Beispiel von Perzeption und Wahrnehmung
(Reevaluation of the classic osteopathic field theory using perception and cognition as example)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/09
1307

Situation der Osteopathie in Frankreich
(Situation of osteopathy in France)
Steringot, P.
Osteopathische Medizin, 2011/09
1308

Sutherland’s Signature
Stark, J.
The AAO Journal, 2011/09
Free full text
1309

Técnica articular para disfunción de malar en eversión
(Articular technique for zygoma in eversion dysfunction)
Antolinos Campillo, P. J., Baño Alcaraz, A., Pascual-Vaca, J. O.
Osteopatía Científica, 2011/09
1310

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09
1311

Sprache und Kommunikation in der Osteopathie: Glossare im Internet
(Language and communication in osteopathy: glossaries on the Internet)
Risch, A. J.
Osteopathische Medizin, 2011/09
1312

Der Wille des Patienten steht über allem
(The patient's will is above all else)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1313

Bauelemente des Lymphgefäßsystems und deren Funktion
(Structural elements of the lymphatic system and their function)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1314

Lymphofaszialer Release (LFR) – Faszie und Fluida in einem
(Lympho-fascia release (LFR) - fascia and fluids in one)
Chikly, B., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1315

Morphodynamik der Lymphe und Fluida im Körper
(Morphodynamics of lymph and fluids in the body)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1316

Lymphsystem und osteopathische Forschung
(Lymphatic system and osteopathic research)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1317

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text
1318

Patienteninfo: Lastenschiffer und Polizei – Lymphe und Lymphsystem
(Patient information: Cargo shippers and police - lymph and lymphatic system)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1319

Wie Wasser in Wasser: Metaphorik des Eingebettet-Seins in der Osteopathie
(Like water in water: metaphorics of being embedded in osteopathy)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1320

Den Fluch der somatischen Dysfunktion überwinden
(Overcoming the curse of somatic dysfunction)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1321

The Hawthorne effect: stronger than the placebo effect?
Berthelot, J. M., Le Goff, B., Maugars, Y.
Joint Bone Spine, 2011/07
Free full text
1322

Re: The Fall of the postural-structural-biomechanical model in manual therapy: exemplified by lower back pain. A response to reviewers and further thoughts
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/07
1323

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06
1324

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06
1325

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text
1326

Klassische Osteopathie: eine Feldtheorie als Vorbild und Grundlage
(Classic osteopathy: A field theory as a model and basis)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/06
1327

The use of videos in teaching psychomotor skills: A look at a new way of teaching osteopathic manipulative treatment to a remote campus
Ferronato, M., Hruby, R. J.
The AAO Journal, 2011/06
Free full text
1328

From The Archives: History of Osteopathy and Twentieth-Century Medical Practice. Cincinnati: Press of Jennings and Graham; 1906: 23-24.
Booth, E.R.
The AAO Journal, 2011/06
Free full text
1329

Jenette “Nettie” Bolles: First woman to pioneer osteopathy
Blumer, J.
The AAO Journal, 2011/06
Free full text
1330

Die Folgen der Armut lindern - osteopathische Behandlung in Kenia
(Alleviating the effects of poverty - osteopathic treatment in Kenya)
Abb, B.
Osteopathische Medizin, 2011/06
1331

Wechselseitige Beziehungsdynamiken und subjektive Ansätze in der Osteopathie
(Dynamics of reciprocal correlations and subjective approaches in osteopathy)
Liem, T.
Osteopathische Medizin, 2011/06
1332

Der Einfluss von Rudolf Virchow auf Andrew Taylor Still – eine kulturwissenschaftliche Untersuchung
(The influence of Rudolf Virchow on Andrew Taylor Still - A cultural scientific investigation)
Nagel, M., Bahr, C., Ciranna-Raab, C.
Osteopathische Medizin, 2011/06
1333

Überlegungen zur Untersuchung und Behandlung der Pleura parietalis über periphere Faszienanheftungen
(Deliberations about the examination and treatment of the parietal pleura over peripheral fascial fixations)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2011/06
1334

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1335

Osteopathie - Teil der Schulmedizin oder paramedizinisches Verfahren?
(Osteopathy - part of scientific medicine or paramedical method?)
Weiss, J.
Deutsche Medizinische Wochenschrift, 2011/05
1336

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1337

Tug technique de escafoides para escafoides en rotación externa
(The Tug navicular technique for externally rotated navicular bones)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
1338

Mecanismo de acción del tratamiento manipulativo vertebral
(Mechanism of action of spinal manipulative therapy)
Maigne, J.Y., Vautravers, P.
Osteopatía Científica, 2011/05
1339

Técnica de thrust para disfunción posterior unilateral del cóndilo occipital
(Thrust technique for unilateral posterior dysfunction of the occipital condyle)
Pérez Cátedra, P., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
1340

Kieferbeschwerden aus Sicht des Fasziendistorsionsmodells (FDM)
(Jaw complaints from the point of view of the fascial distortion model (FDM))
Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1341

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1342

Anatomie des Kiefergelenks als Teil des kraniomandibulären Systems
(Anatomy of the temporomandibular joint as part of the craniomandibular system)
Breul, R., Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1343

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1344

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1345

Was ist eigentlich …
(What actually is ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1346

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1347

CMD: Ein falscher Biss, der fatale Folgen haben kann
(TMD: A wrong bite that can have fatal consequences)
Sayfadini, A. A.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1348

Patienteninfo: Kiefergelenke – mehr als nur Mund auf und zu
(Patient information: Temporomandibular joint - more than just opening and closing the mouth)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1349

Zahnärztliche Schienentherapie bei CMD: Bewertung myogener Effekte in der Literatur
(Dental splint therapy for CMD: evaluation of myogenic effects in the literature)
Strate, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1350

Das Urheberrecht (UrhG)
(Copyright law (UrhG))
Ulusal, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1351

Schmerzverursachende Belastungen des Kausystems
(Pain-causing strains of the masticatory system)
Wühr, E.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1352

Is a postural-structural-biomechanical model, within manual therapies, viable?: A JBMT debate
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04
1353

Invited response: (without science, there must be art)
Hannon, J. C.
Journal of Bodywork and Movement Therapies, 2011/04
1354

Invited response (the postural structural model, with boundary conditions)
Irvin, R. E.
Journal of Bodywork and Movement Therapies, 2011/04
1355

The fall of the postural-structural-biomechanical model in manual and physical therapies: exemplified by lower back pain
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/04
1356

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04
1357

Invited response
McGill, S.
Journal of Bodywork and Movement Therapies, 2011/04
1358

Helical tensegrity as a structural mechanism in human anatomy
Scarr, G.
International Journal of Osteopathic Medicine, 2011/03
1359

A “System” of Cranial Manipulation: An Original Contribution on Osteopathic Technique
Miller, D. S.
The AAO Journal, 2011/03
Free full text
1360

From The Archives: From: Fryette, HH. Principles of Osteopathic Technique. Carmel, CA: American Academy of Osteopathy, 1954. 61-64.
Fryette, H.H.
The AAO Journal, 2011/03
Free full text
1361

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text
1362

Prinzipien der osteopathischen Notfalltechniken nach Robert Rousse
(Principles of osteopathic emergency techniques according to Robert Rouse)
Prediger, G.
Osteopathische Medizin, 2011/03
1363

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03
1364

Großbänder des hinteren Beckenrings: Sakrotuberal- und Sakrospinalband
(Major ligaments of the posterior pelvic girdle: sacrotuberous and sacrospinal ligaments)
Hammer, N., Bechmann, I., Steinke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1365

Morphologische und funktionelle Aspekte der Harnblase
(Morphological and functional aspects of the urinary bladder)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1366

Patienteninfo: Nein – eine Klingelhose möcht' ich nicht
(Patient information: No - I don't want diapers)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1367

Osteopathische Interventionen bei Erkrankungen der Prostata
(Osteopathic interventions in diseases of the prostate gland)
Marx, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1368

Von Littlejohn lernen: Osteopathie als angewandte biologische Wissenschaft (Teil 2)
(Learning from Littlejohn: Osteopathy as an Applied Biological Science (Part 2))
Pöttner, M., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1369

Chronische Prostatitis: Gemeinsam geht's besser! 
(Chronic prostatitis: Let's work together!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1370

Einschränkungen der Therapierfreiheit des Heilpraktikers im Urogenitalbereich
(Restrictions on the freedom of therapy of the alternative practitioner in the urogenital area)
Ulusal, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1371

Psychodynamik und Psychomorphologie am Beispiel der Nieren und des Dünndarms
(Psychodynamics and psychomorphology exemplified by the kidneys and the small intestine)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1372

Wer war eigentlich …
(Who actually was ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1373

Osteopathy and (hatha) yoga
Liem, T.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text
1374

Ist der Rumpf stabil, bessern sich die Beschwerden: Behandlungskonzept bei lumbalen Rückenschmerzen
(Concept of treatment of low back pain)
Müller, R., Linz, W., Buchmann, J.
MMW - Fortschritte der Medizin, 2011/01
1375

Manualtherapie bei Insertionstendinosen: Fersensporn, Patellaspitzensyndrom, Tennisellenbogen, Schultersteife
(Manual therapy for insertional tendinosis)
Müller, R., Linz, W., Buchmann, J.
MMW - Fortschritte der Medizin, 2011/01
1376

Técnica semidirecta de thrust para una disfunción somática no neutra en ERS izquierda de la tercera vértebra cervical
(Thrust technique for left ERS somatic dysfunction of the third cervical vertebra)
Guerrero, A. M., Rodríguez, R. P.
Osteopatía Científica, 2011/01
1377

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011
1378

An Osteopathic Approach to Hypothyroidism
Burns, D. K.
The AAO Journal, 2010/12
Free full text
1379

Restoration of a McManis Treatment Stool
Clark, R. C.
The AAO Journal, 2010/12
Free full text
1380

Biomechanische Regulatoren – Modellkonzept zur Verbesserung der Gelenkbeweglichkeit
(Biomechanic regulators - Model concept for the improvement of joint mobility)
Föhrweiser-Wesolek, U.
Osteopathische Medizin, 2010/12
1381

Local and Systemic Mechanisms in Disturbance of Functions of the Vegetative Nervous System
Erofeev, N. P.
The AAO Journal, 2010/12
Free full text
1382

Atypical Pathologic Somatic Dysfunctions: Techniques Revisited
Miller, D. S.
The AAO Journal, 2010/12
Free full text
1383

EROP-Richtlinien: Kernkompetenzen und Praxisstandards in der osteopathischen Medizin
(EROP guidelines: Core competencies and practice standards in osteopathic medicine)
Mayer, J.
Osteopathische Medizin, 2010/12
1384

Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways
Watson, L. A., Pizzari, T.
International Journal of Osteopathic Medicine, 2010/12
1385

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text
1386

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11
1387

Das Schädeldach als Tensegrity-Struktur
(The cranial roof as a tensegrity structure)
Scarr, G., Hinz, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1388

Hinweise auf eine fasziale Rhythmizität?
(Evidence of fascial rhythmicity?)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1389

Knochen wie Kontinentalschollen
(Bones like continental floes)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1390

Anatomische Gesichtspunkte zur harten Hirnhaut
(Anatomical viewpoints on the hard meninges)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1391

Volumen- und Elastizitätsdiagnostik des Kraniums
(Cranial volume and elasticity diagnostics)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1392

Multiple Midliner: Ein osteopathisches Sommermärchen
(Multiple Midliners: An Osteopathic Summer's Tale)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1393

Hirnschädel und Menschsein
(Neurocranium and being human)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1394

Auf der Suche nach der Mittellinie
(Searching for the midline)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1395

Suturen des Hirnschädels
(Sutures of the cranium)
Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1396

Von Littlejohn lernen: Osteopathie – angewandte Wissenschaft (Teil 1)
(Learning from Littlejohn: Osteopathy as an Applied Science (Part 1))
Pöttner, M., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1397

Placebo: Missverständnisse und Vorurteile
(Placebo: Misconceptions and prejudices)
Breidert, M., Hofbauer, K.
Osteopathische Medizin, 2010/09
1398

Alexander-Technik – Grundlagen und Parallelen zur Osteopathie
(The Alexander Technique Principles and parallels to osteopathy)
Eisenreich, U.
Osteopathische Medizin, 2010/09
1399

Übertragener Muskelschmerz ist primär peripheren Ursprungs: die Barrier-Dam-Hypothese
(Referred muscle pain is primarily of peripheral origin: The barrier-dam theory)
Farasyn, A.
Osteopathische Medizin, 2010/09
1400

Baby-Shiatsu – eine energetische Ergänzung zur osteopathischen Behandlung
(Baby Shiatsu: An energetic supplement to osteopathic treatment)
Kalbantner-Wernicke, K., Wernicke, T.
Osteopathische Medizin, 2010/09
1401

Various methods of CRI palpation of body parts, their diagnostic values and interpretation of the findings
Pribadi, K. S.
The AAO Journal, 2010/09
Free full text
1402

Tensegrity in der Osteopathie
(Tensegrity in osteopathy)
Pflüger, C.
Osteopathische Medizin, 2010/09
1403

Manuelle Behandlung des Kniegelenks - veraltetes Verfahren oder alternative Option?
(Manual treatment of the knee joint – an outdated procedure or an alternative option?)
Franke, H.
Naturheilpraxis, 2010/09
Free full text
1404

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text
1405

Técnica de lift-off para dorsales medias (T4-T10)
(Lift off technique in medium dorsal vertebrae (T4-T10))
Iglesias, J. G., del Cerro, L. P., Rodríguez Blanco, C.
Osteopatía Científica, 2010/09
1406

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text
1407

A ‘system based’ approach to risk assessment of the cervical spine prior to manual therapy
Taylor, Alan J., Kerry, R.
International Journal of Osteopathic Medicine, 2010/09
1408

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07
1409

Physiotherapie et osteopathie: une prise en charge reellement holistique des sportifs.
(Physiotherapy and osteopathy: a real holistic supervision of athletes)
Larequi, Y.
Revue Medicale Suisse, 2010/08
1410

Notes on visceral adhesions as fascial pathology
Hedley, G.
Journal of Bodywork and Movement Therapies, 2010/07
1411

Der Gesichtsschädel
(Patient information: The viscerocranium)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1412

The Fickle finger of quackery in otology: the saga of Curtis H. Muncie, Osteopath
Swamy, R. S., Jackler, R. K.
Otology & Neurotology, 2010/07
1413

Nasen- und Darmschleimhaut in der osteopathischen Behandlung
(Nasal and intestinal mucosa in osteopathic treatment)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1414

Was sind eigentlich... Viszera?
(What actually are viscera?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
Free full text
1415

Der osteopathisch ganzheitliche Ansatz zur Homöostase (Teil 2)
(The osteopathic holistic approach to homeostasis, part 2)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1416

Zum Aufbau des Gesichts
(Regarding the facial structure)
Fanghänel, J., Eigenwillig, P., Proff, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1417

Osteopathische Techniken bei Nasennebenhöhlenentzündung
(Osteopathic techniques in sinusitis)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1418

CRPS und Osteopathie – Möglichkeiten und Grenzen
(CRPS and osteopathy - possibilities and limits)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1419

Entwicklung des Viszerokraniums
(Development of the viscerocranium)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1420

What is 'manipulation'? A reappraisal
Evans, D. W., Lucas, N.
Manual Therapy, 2010/06
Free full text
1421

Médecine manuelle – ostéopathie en France organisation – enseignement – champs de compétences
Manual medicine - osteopathy in France organization - education - fields of expertise
Vautravers, P., Isner, M. E., Blaes, C.
Annals of Physical and Rehabilitation Medicine, 2010/06
Free full text
1422

Einführung in die Methode der Fascial Manipulation®
(Introduction in the fascial manipulation method®)
Day, J. A., Stecco, C.
Osteopathische Medizin, 2010/06
1423

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text
1424

Principles of Osteopathy in the Battlefield
Kozminski, M.
The AAO Journal, 2010/06
Free full text
1425

Body Adjustment in der Frauenheilkunde
(Body adjustment in gynecology)
Masters, P.
Osteopathische Medizin, 2010/06
1426

Fließende Kunst an Körper und Seele: die traditionelle Thai-Massage
(Flowing art on body and soul: The traditional Thai massage)
Möller, H.
Osteopathische Medizin, 2010/06
1427

Median Arcuate Ligament Syndrome – Literature Study and Osteopathic Considerations
Peeters, L.
The AAO Journal, 2010/06
Free full text
1428

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06
1429

Why do spinal manipulation techniques take the form they do? Towards a general model of spinal manipulation
Evans, D. W.
Manual Therapy, 2010/06
Free full text
1430

Diagnostyka fizjoterapeutyczna i osteopatyczna w zawodowych zaburzeniach glosu.
(The application of physiotherapeutic and ostheopatic diagnostics in occupational voice disorders)
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Kowalska, M. S.
Medycyna Pracy, 2010/06
1431

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05
1432

L'osteopathie pour soulager certaines douleurs.
(Osteopathy for relieving certain pain)
Gnaho, S.
Revue de l'infirmiere, 2010/05
1433

The challenges of primary care and innovative responses in osteopathic education
Shannon, S. C., Ferretti, S. M., Wood, D., Levitan, T.
Health Affairs, 2010/05
1434

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text
1435

Klinische Relevanz statt Placebo-Kontrolle
(Clinical relevance instead of placebo control)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1436

Morbus Sudeck und Osteopathie?
(Complex Regional Pain Syndrome and Osteopathy?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1437

Formbarkeit von Faszien und Membranen: Behandlung innerer Brücken im Kontext der Forschung
(Plasticity of Fascias and Membranes: Treatment of Inner Bridges in the Context of Research)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1438

Störungsketten im Bindegewebe
(Patient information: Disruptive chains in the fascia)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1439

Ursprung, Raum und Wirklichkeit faszialer Motilität
(Origin, Space and Reality of Fascial Motility)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1440

Was ist eigentlich... intrinsische Bewegung?
(What actually is intrinsic movement?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1441

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1442

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text
1443

Kontraktilität von Faszien
(Contractility of Fascias – How is This Behavior Possible?)
Brand, E.M.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1444

Wasser und seine Bedeutung für Zellen und Bindegewebe
(Water as the Basis for Our Life and its Distribution in Our Body)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1445

Mikro- und makroskopische Betrachtung der Faszienfunktionen
(Microscopic and Macroscopic Reflections on the Functions of Fascias)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1446

DOs vs. Dos: proposed medical school creates rift between osteopathic physicians, UNT
Ortolon, K.
Texas Medicine, 2010/03
1447

Relevanz der Intuition in der Osteopathie – Überlegungen und ein Literaturüberblick
(Relevance of intuition in osteopathy - Considerations and a literature overview)
Sidler, S.
Osteopathische Medizin, 2010/03
1448

Die Fascia thoracolumbalis als potenzielle Ursache für Rückenschmerzen: anatomische Grundlagen und klinische Aspekte
(The thoracolumbar fascia as potential cause of back pain: Anatomical bases and clinical aspects)
Tesarz, J.
Osteopathische Medizin, 2010/03
1449

Composite sacroiliac joint pain provocation tests: A question of clinical significance
McGrath, M. C.
International Journal of Osteopathic Medicine, 2010/03
1450

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1451

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1452

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1453

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1454

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text
1455

Performing arts medicine--instrumentalist musicians, Part II--examination
Dommerholt, J.
Journal of Bodywork and Movement Therapies, 2010/01
1456

Osteopathie: Die Sicht der Bundesärztekammer
(Osteopathy: The view of the German Medical Association)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1457

Fascia: A missing link in our understanding of the pathology of fibromyalgia
Liptan, G. L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text
1458

Ist das Bindegewebe ein Organ?
(Patient information: Is fascia an organ?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1459

DO • Korrespondenten berichten - Die Entwicklung der Osteopathie in der Schweiz
(DO • Correspondents reporting - The development of osteopathy in Switzerland)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
Free full text
1460

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01
1461

Eine Faszienreise vom Musculus longissimus über den lumbosakralen Übergang bis zum Hyoid und dem Pharynx
(A Fascial Voyage from the Longissimus Muscle via the Lumbosacral Transition to the Hyoid and the Pharynx)
Bartmer–Leitl, E.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1462

Das Fasziendistorsionsmodell nach Stephen Typaldos
(The Fascial Distortion Model According to Stephen Typaldos)
Fischer, T., Rossmy, C., Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1463

Gary Fryer –”...there is not much that we can say without any doubt.”
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1464

Das viszerale Faszienskelett des Bauchraums
(The Visceral Fascial Skeleton of the Abdominal Cavity)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1465

Erkenntnisfindung in der Osteopathie des 20. Jahrhunderts – J. M. Littlejohn versus Sutherland Cranial Teaching Foundation
(Gaining Knowledge in the Osteopathy of the 20th Century)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1466

Osteopathische Betrachtung der Narbenbehandlung
(Osteopathic Reflection on the Treatment of Scars)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1467

Contribution of the osteopathy on the flexibility of the lumbar column and intensity of pain in young adult patients with acute low back pain
Rocha, R., Pereira, J. S.
Revista Terapia Manual, 2010
1468

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12
1469

Die Rolle der Osteopathie in der Korrektur von Schädeldeformierungen bei Neugeborenen und Kleinstkindern
(The role of osteopathy in correcting cranial deformations in neonates and young infants)
Amiel-Tison, C., Soyez-Papiernik, E.
Osteopathische Medizin, 2009/12
1470

Beziehung und Bindung in der osteopathischen Kinderbehandlung
(Relationship and attachment in osteopathic treatment of children)
Dräger, K., Dräger, C.
Osteopathische Medizin, 2009/12
1471

Dr. A. T. Still’s Treating Chair
Archer, J.
The AAO Journal, 2009/12
Free full text
1472

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text
1473

There Are More Things in Heaven and Earth…
Ching, L. M.G.
The AAO Journal, 2009/12
Free full text
1474

Analyse critique de l’enseignement de techniques manipulatives rachidiennes basées sur les « lois de Fryette »
(Critical analysis of teaching spinal manipulation techniques based on the “Fryette laws“)
Zegarra-Parodi, R., Fabre, L.
Kinésithérapie, la Revue, 2009/12
1475

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text
1476

Die Bedeutung des Rückfußes für Stand, Gang und Körperhaltung
(The Significance of the Calcaneal Part of the Foot for Standing, Gait and Posture in Functional Orthopedics)
Pfaff, G., Kaune, M.
DO - Deutsche Zeitschrift für Osteopathie, 2009/11
1477

Leben ist Bewegung
(Life is movement)
Gillemot, B., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1478

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1479

Osteopathie für Pferd und Reiter
(Osteopathy for Horse and Rider)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1480

Erfahrungsbericht aus dem Basketball–Trainingslager
(Report on the Experiences Gained During the Basketball Training Camp of the Men's National Team)
Kaufmann, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1481

Manipulation vor dem Wettkampf?
(Manipulative treatment before the competition?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1482

Osteopathie im Sport
(Osteopathy in sports)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1483

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1484

Leistung optimieren: Osteopathie und Sport
(Optimizing performance: Osteopathy and sports)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1485

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
1486

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09
1487

The functions of breathing and its dysfunctions and their relationship to breathing therapy
Courtney, R.
International Journal of Osteopathic Medicine, 2009/09
1488

Trager® Psychophysische Integration
(Trager® Psychophysical Integration)
Heigl, M.
Osteopathische Medizin, 2009/09
1489

Kräfteverteilungen im Körper des Menschen am Beispiel von Gewichthebern – Tensegrity als Erklärungsmodell
(The distribution of forces in the human body using the example of a weightlifter - Tensegrity as explanatory model)
Siemsen, C.H., Dittrich, H.
Osteopathische Medizin, 2009/09
1490

Ligamente als Entstehungsort berufsbedingter Störungen
(The ligaments as points of origin of occupational diseases)
Solomonow, M.
Osteopathische Medizin, 2009/09
1491

Osteopathie nach HWS-Schleudertrauma
(Osteopathy after whiplash injury)
Tempelhof, S.
Osteopathische Medizin, 2009/09
1492

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
1493

Understanding the Process of Fascial Unwinding
Minasny, B.
International Journal of Therapeutic Massage and Bodywork, 2009/09
Free full text
1494

La langue : déglutition, fonctions oro-faciales, croissance crânio-faciale
(The tongue: deglutition, orofacial functions and craniofacial growth)
Landouzy, J.M., Sergent Delattre, A., Fenart, R., Delattre, B., Claire, J., Biecq, M.
International Orthodontics, 2009/09
1495

Human Volume Tissue Investigation Method
Mokhov, D. E., Chashchin, A. V., Erofeev, N. P., Vcherashny, D. B.
The AAO Journal, 2009/09
Free full text
1496

Swedenborg's influence on Sutherland's ‘Primary Respiratory Mechanism’ model in cranial osteopathy
Jordan, T.
International Journal of Osteopathic Medicine, 2009/09
1497

Influencias de la relación maxilomandibular en el tratamiento postural mediante inhibición muscular
(Influence of maxillomandibular relationship in postural treatment involving muscle inhibition)
Rodríguez Blanco, C., Torres-Lagares, D., Munuera-Martínez, P. V., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09
1498

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text
1499

Time for the osteopathic profession to take the lead in musculoskeletal research
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/07
Free full text
1500

Towards evidence based medicine for paediatricians. Is cranio-sacral therapy useful in the management of crying babies?
Bradley, E., Finlay, F.
Archives of Disease in Childhood, 2009/07
1501

Osteopathische Behandlung akuter Erkrankungen
(Osteopathic Treatment of Acute Diseases)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1502

Magenulkus
(Gastric ulcer)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1503

Vincent Benedetto – Die Basis der Osteopathie
(Vincent Benedetto - The basis of osteopathy)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1504

Akute Krankheitsbilder – Möglichkeiten und Grenzen der klinischen Osteopathie heute
(Acute Clinical Pictures – Chances and Limits of Today's Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1505

Aufruf Arbeitskreis klinische Osteopathie
(Appeal for a Working Group Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1506

Osteopathie bei akuten Erkrankungen
(Osteopathy for acute diseases)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1507

Grundlagen der Entzündungspathologie
(Basics of the Pathology of Inflammation)
Siegert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1508

WPO–Osteo – Bedeutung und Rechtsfolgen
(WPO-Osteo - Significance and legal consequences)
Tamm, B.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1509

Akute Halswirbelsäulenerkrankungen – Grenzbereiche
(Frontiers – Acute Diseases of the Cervical Spine)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1510

Die gewollte Spaltung
(Deliberate division)
Gröbmüller, J.
Osteopathische Medizin, 2009/06
1511

Muskeln als Verbundmaterial: Ein Überblick über die Kraftübertragung in Muskeln und Gliedmaßen
(Muscles as composite material: A review of force transmission in muscles and limbs)
Huijing, P. A.
Osteopathische Medizin, 2009/06
1512

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text
1513

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text
1514

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text
1515

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text
1516

Osteopathic postdoctoral training institutions: a decentralized model for facilitating accreditation and program quality
Peska, D. N., Opipari, M. I., Watson, D. K.
Academic Medicine, 2009/06
Free full text
1517

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text
1518

Strukturelle Integration durch Rolfing® und Normal Function
(Structural integration with Rolfing® and normal function)
Specka, I.
Osteopathische Medizin, 2009/06
1519

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
1520

Schwindel in der osteopathischen Praxis
(Dizziness in osteopathy practice)
Thomas, D.
Osteopathische Medizin, 2009/06
1521

Osteopathic medical graduates in ACGME residencies: a threat to the core philosophy and distinctiveness of osteopathic medicine.
Veit, K. J.
Academic Medicine, 2009/06
Free full text
1522

Accreditation standards of osteopathic and allopathic medical schools: could they affect educational quality?
Wood, D. L., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
1523

Staatliche Anerkennung: Hessische Osteopathie-Verordnung im Fokus von Standesinteressen
(State accreditation: Hessian osteopathy law focuses on the interests of the profession)
Wehr, M.
Osteopathische Medizin, 2009/06
1524

The separate osteopathic medical education pathway: isn't it time we got our acts together? Counterpoint
Cohen, J. J.
Academic Medicine, 2009/06
Free full text
1525

The impact of osteopathic physicians' participation in ACGME-accredited postdoctoral programs, 1985-2006
Cummings, M., Sefcik, D. J.
Academic Medicine, 2009/06
Free full text
1526

Scapular Glide: Functional relationships, dysfunction and treatment
Kary, D. J.
The AAO Journal, 2009/06
Free full text
1527

Osteopathic approach to the spleen
Peeters, L., Lason, G.
The AAO Journal, 2009/06
Free full text
1528

Técnica semidirecta de thrust con kick para lesión de ilíaco anterior izquierdo
(Semidirect thrust kick technique in left anterior iliac dysfunction)
Mancha, J. A. D., Martín, C. O.
Osteopatía Científica, 2009/05
1529

Pruebas para la detección de hipersensibilidad sensorial o hiperexcitabilidad central asociada al dolor cervical
(Testing for sensory hypersensitivity or central hyperexcitability associated with cervical spine pain)
Sterling, M.
Osteopatía Científica, 2009/04
1530

Classroom lectures - where are the students and don't they care?
Reed, K.
Iowa Medicine: Journal of the Iowa Medical Society, 2009/03-04
1531

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text
1532

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03
1533

Therapeutic needling in osteopathic practice: An evidence-informed perspective
Rickards, L. D.
International Journal of Osteopathic Medicine, 2009/03
1534

The Integration of Undergraduate Osteopathic Manipulative Medicine Fellows into Medical Education: The KCUMB-COM Model
Cox, W. J., Boyajian-O'Neill, L. A., Roach, M. D., Ridgley, J. A.
The AAO Journal, 2009/03
Free full text
1535

Fred Mitchell Jr. und die Entwicklung der Muskel–Energie–Techniken
(Fred Mitchell Jr. and the Development of the Muscle Energy Techniques)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1536

WPO: Ein Meilenstein näher betrachtet
(WPO: A closer look at a milestone)
Fuhrmann, M., Weynen, R., von Tümpling, U.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1537

Geteilte Aufmerksamkeit
(Divided Attention)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1538

Das Handgelenk, eine Betrachtung
(The Wrist, a Reflection)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1539

Palpatorische Wahrnehmungen: Die fünf Sinne und darüber hinaus
(Palpation Perception: Five Senses And Beyond)
Psutka, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1540

Osteopathische Informationsquellen
(Osteopathic sources of information)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1541

Palpation und das Dilemma der osteopathischen Hände
(Palpation and the Dilemma of Osteopathic Hands)
Sommerfeld, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1542

Anatomie der Wahrnehmung – Somatoviszerosensorik: Wie man fühlt, was man spürt
(Anatomy of Perception – Somatovisceral Sensory System: How One Feels, What One Senses)
Storr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1543

Palpation zwischen Struktur und Energie
(Palpation between Structure and Energy)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
Free full text
1544

Brachial plexus injuries in neonates: an osteopathic approach
Mason, D. C., Ciervo, C. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text
1545

Grenzen des Konzepts der Symmetrie in der osteopathischen Beurteilung: Eine Erweiterung des Konzepts in Hinblick auf Proportionalität führt zu besseren klinischen Ergebnissen
(The limits of the concept of symmetry in osteopathic diagnostics: Expanding the concept in regards to proportionality leads to improved clinical results)
Brooks, W.
Osteopathische Medizin, 2009/02
1546

Osteopathie und (Hatha-)Yoga
(Osteopathy and (Hatha) yoga)
Liem, T.
Osteopathische Medizin, 2009/02
1547

Die Leber – mehr als GOT und GPT?
(The liver – more than GOT and GPT?)
Preuße, U., Giebel, J.
Osteopathische Medizin, 2009/02
1548

Spracherwerb und osteopathische Gedanken zur Dyslalie
(Language acquisition and osteopathic thought in regards to dyslalia)
Riedel, M.
Osteopathische Medizin, 2009/02
1549

Abenteuer Osteopathie: Die Arbeit des Vereins Internationale Osteopathie e.V. (INO)
(The adventure of osteopathy: The work of the INO (Verein Internationale Osteopathie e.V.))
Ries, M., Bauer, C.
Osteopathische Medizin, 2009/02
1550

DO • Korrespondenten berichten
(DO • Correspondents reporting)
Jevbratt, M.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
Free full text
1551

Osteopathische Früherkennung
(Osteopathic early detection)
Bayer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1552

Prä– und postnatale Entwicklung des Hüftgelenks
(Prenatal and Postnatal Development of the Hip Joint)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1553

Wie lassen sich osteopathische Techniken für die Behandlung von Kindern adaptieren? – Die Herangehensweise des Osteopathischen Zentrums für Kinder in Wien
(How Can Osteopathic Techniques Be Adapted for the Treatment of Children?)
Burian–Lang, E., Mückler, A., Urbanek, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1554

Auf ein Wort: Zum Umgang mit Kindern in Sprache und Gestus
(A Word About Dealing with Children in Speech and Gestures by the Example of Enuresis)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1555

Osteopathie bei Frühgeborenen
(Osteopathy with Premature Infants)
Lamberts, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1556

Auswirkungen persistierender Reflexe auf die auditorische und visuelle Wahrnehmung
(Effects of Persisting Reflexes on the Auditory and Visual Perception)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1557

Neurobiologische Prinzipien und klinische Aspekte der Säuglingsentwicklung – Teil 2: Umgebungsfaktoren
(Neurobiological principles and clinical aspects of infant development - Part 2: Environmental factors)
Philippi, H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1558

Hilfe – mein Kind ist schief!
(Help - my child is crooked!)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1559

Muscle Impulse, A Muscle Energy Variant
van Buskirk, R. L.
The AAO Journal, 2008/12
Free full text
1560

La prueba de la movilidad cervical: metodología e implicaciones clínicas
(Cervical motion testing: methodology and clinical implications)
Prushansky, T., Dvir, Z.
Osteopatía Científica, 2008/12
1561

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12
1562

Neurobiologische Aspekte eines Knackgeräusches im Rahmen einer HVLA Technik
(Neurobiological aspects of a cracking noise within the framework of an HVLA technique)
Beck, M.
Osteopathische Medizin, 2008/11
1563

Tensegrity und Mechanoregulation: Vom Skelett zum Zytoskelett
(Tensegrity and mechanoregulation: From skeleton to cytoskeleton)
Chen, C. S., Ingber, D. E.
Osteopathische Medizin, 2008/11
1564

Osteopathie in der Pädiatrie, Teil 4: Sakrum und Os sphenoidale
(Osteopathy in Pediatrics Part 4: Sacrum and Os Sphenoidale)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1565

Kinder!
(Children!)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1566

Unsere Haut – Bau und Leistungen, Teil 2
(Our Skin – Structure and Performance, Part 2)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1567

Diagnosis and management of piriformis syndrome: an osteopathic approach
Boyajian-O'Neill, L. A., McClain, R. L., Coleman, M. K., Thomas, P. P.
The Journal of the American Osteopathic Association, 2008/11
Free full text
1568

Neurobiologische Prinzipien und klinische Aspekte der Säuglingsentwicklung, Teil 1
(Neurobiological principles and clinical aspects of infant development - Part 1)
Philippi, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1569

Die drei Säulen der Y–Fuge der Säuglingshüfte
(The Three Pillars of the Hypsiloid Cartilage of the Hip of Infants)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1570

Säuglinge sind Viszera
(Infants are Viscera)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1571

„Tensegrity” – ursprünglich ein Begriff aus der Architektur
('Tensegrity' – originally an architectonic term)
Eichhorn, V.
Osteopathische Medizin, 2008/11
1572

Manuelle Medizin an der Halswirbelsäule: Atraumatische Weichtechnik der Chirotherapie und HVLA-Technik der Osteopathie im Synergismus
(Manuel medicine targeting the cervical spine: Synergies between atraumatic chiropractic techniques and osteopathy's HLVA-technique)
Stahlhofer, H.
Osteopathische Medizin, 2008/11
1573

Legg reduction maneuver for patients with anterior shoulder dislocation
Dyck Jr., D. D., Porter, N. W., Dunbar, B. D.
The Journal of the American Osteopathic Association, 2008/10
Free full text
1574

Prevention, diagnosis, and management of osteoporosis-related fracture: a multifactoral osteopathic approach
Gronholz, M. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text
1575

The endocannabinoid system: an osteopathic perspective
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
1576

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text
1577

Osteopathic Medicine and the Geriatric Patient
Hruby, R. J.
The AAO Journal, 2008/09
Free full text
1578

Valuing osteopathy: What are (our) professional values and how do we teach them?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09
1579

Whose values are we teaching? Deconstructing responsibilities and duties of teachers of osteopathy
Sommerfeld, P.
International Journal of Osteopathic Medicine, 2008/09
1580

A model of the cranial vault as a tensegrity structure, and its significance to normal and abnormal cranial development
Scarr, G.
International Journal of Osteopathic Medicine, 2008/09
1581

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1582

Unsere Haut – Bau und Leistungen Teil 1
(Our Skin – Structure and Performance, Part 1)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1583

Einschneidende Rituale
(Drastic Rituals)
Knöppler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1584

Querschnitt– und Längsschnittstudien
(Cross-sectional and longitudinal studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1585

Bedeutung der Haut im Umgang mit Säuglingen
(Significance of the Skin when Dealing with Infants)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1586

Zwischen innen und außen: die Haut
(Between inside and outside: the skin)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1587

Therapie über die Körperoberfläche – Anatomische und physiologische Aspekte der neurolymphatischen Reflexpunkte am Beispiel der Augen– und Ohrzonen
(Therapy via the Body Surface – Anatomical and Physiological Aspects of the Neurolymphatic Reflex Points by the Example of Eye and Ear Zones)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
Free full text
1588

Erste Ansätze in der osteopathischen Behandlung der Haut
(First Approaches in the Osteopathic Treatment of the Skin)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1589

Técnica combinada de articulación y thrust para disfunción de cóndilo posterior
(The combined articular thrust technique for posterior condyle dysfunction)
Guirao Cano, D.
Osteopatía Científica, 2008/08
1590

Manuelle Medizin in der Pädiatrie: ein osteopathischer Ansatz: Auszüge aus dem neuen Buch: Pediatric Manual Medicine: an osteopathic approach
(Pediatric manual medicine: An osteopathic approach)
Carreiro, J. E.
Osteopathische Medizin, 2008/07
1591

Sind Habits, Tics, Bruxismus, Sprechfehler und orofaziale Dyskinesien eine Expression notwendiger kraniosakraler und posturaler Autoregulation des Menschen?: Das Balance-Behandlungskonzept
(Are habits, tics, bruxism, speech disorder and orofacial dyskinesia an expression of necessary craniosacral and postural autoregulation in humans?)
Entrup, W.
Osteopathische Medizin, 2008/07
1592

Behandlung der Enuresis nocturna in der Osteopathie
(Treatment of noctural enuresis in osteopathy)
Liem, T.
Osteopathische Medizin, 2008/07
1593

Rediscovering the classic osteopathic literature to advance contemporary patient-oriented research: A new look at diabetes mellitus
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2008/07
1594

Kindliche Regulationsstörungen: Schrei-, Ess- und Schlafstörungen: Betrachtung der psychosozialen Zusammenhänge im Hinblick auf die osteopathische Behandlung
(Infantile regulatory disorders: Crying, eating and sleep disorders)
Gillemot, B.
Osteopathische Medizin, 2008/07
1595

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text
1596

Use of inappropriate titles by New Zealand practitioners of acupuncture, chiropractic, and osteopathy
Gilbey, A.
The New Zealand Medical Journal, 2008/07
1597

Teaching critical thinking in osteopathy – Integrating craft knowledge and evidence-informed approaches
Fryer, G.
International Journal of Osteopathic Medicine, 2008/06/01/
1598

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06
1599

The Cranial Plunger Theory
Burns, D. K.
The AAO Journal, 2008/06
Free full text
1600

Criticality, research, scholarship and teaching: Osteopaths as educators – what makes a good teacher?
Wallace, S. S.
International Journal of Osteopathic Medicine, 2008/06
1601

“Poiseuille’s Panacea”: a New Direction in Osteopathic Manipulation of the Thorax
McCombs, T. M., Towne, S., Treece, M.
The AAO Journal, 2008/06
Free full text
1602

The Osteopath Should Find Health
Höppner, J.P.
Osteopathische Medizin, 2008/05
1603

Osteopathische Medizin und ihre Anpassung an das Älterwerden
(Osteopathic medicine and its adjustment to aging patients)
Hruby, R.
Osteopathische Medizin, 2008/05
1604

Spanien - eine neue wissenschaftliche Zeitschrift für die Osteopathie
(A new scientific journal for osteopathy in Spain)
Ricard, F.
Osteopathische Medizin, 2008/05
1605

Die Hand des Menschen, Teil 1: Funktionelle Anatomie und Biomechanik des Carpus
(The Human Hand - Part 1: Functional Anatomy and Biomechanics of the Carpus)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1606

Das Herz - mehr als nur eine Pumpe
(The Heart - More Than Just a Pump)
Fraval, M., Norrie, A., del Pilar Munoz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1607

Osteopathie in der Pädiatrie, Teil 3: Das Os temporale
(Osteopathy in Pediatrics, Part 3: The Temporal Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1608

Retrospektive und prospektive Studien
(Retrospective and prospective studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1609

Das komplexe regionale Schmerzsyndrom
(The complex regional pain syndrome)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1610

Osteopathische Diagnostikmöglichkeiten an der Hand
(Osteopathic Diagnostic Possibilities in the Hand)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1611

Wunderwerkzeug Hand
(Miracle tool hand)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1612

Form und Formlosigkeit. Morphologie in der Osteopathie heute
(Form and Formlessness. Morphology in Osteopathy Today)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1613

Técnica semidirecta de thrust para torsión anterior derecha del sacro: TDD
(Indirect thrust manipulation for right anterior torsion of the sacrum on a right oblique axis)
Rodríguez Blanco, C.
Osteopatía Científica, 2008/04
1614

Autistic Spectrum Disorder
Sorrell, M. A.
The AAO Journal, 2008/03
Free full text
1615

“Even though you’re choking on it, it’s all in your mind” – an osteopathic perspective on Globus Hystericus
Comeaux, Z. J.
The AAO Journal, 2008/03
Free full text
1616

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text
1617

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03
1618

Die osteopathische Dysfunktion der Arterie
(Osteopathic Dysfunction of the Arteries)
Chauffour, P., Prat, E., Michaud, J.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1619

Osteopathie in der Pädiatrie, Teil 2: Intraossäre Läsionen des Os occipitale
(Osteopathy in Pediatrics, Part 2: Intraosseus Lesions of the Occipital Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1620

Entwicklung von Blut- und Lymphgefäßen
(The Development of Blood and Lymph Vessels)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1621

Die visuelle Analogskala
(The visual analog scale)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1622

Eigenrhythmizität von Blutgefäßen
(The Innate Rhythmicity of Blood Vessels)
Schmid-Schönbein, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1623

Für Durchblutung sorgen - Die Behandlung von Arterien
(Providing blood circulation - The treatment of arteries)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1624

Behandlung der intramuralen Gefäße der Viszera am Beispiel des Magens
(Treatment of the Intramural Vessels of the Viscera Using the Stomach as an Example)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1625

Der Rhythmus des Blutflusses
(The Rhythm Of Perfusion)
Wyvekens, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1626

Spirit(ualität) in der Osteopathie heute: Entwicklung des SpREUK-Fragebogens zur Analyse der unterschiedlichen Phänomene und Perspektiven der Spiritualität bei chronisch Kranken
(Spirit(uality) in osteopathy today)
Büssing, A.
Osteopathische Medizin, 2008/01
1627

Slow-Thrust Technik
(Slow thrust technique)
Dräger, K.
Osteopathische Medizin, 2008/01
1628

Die Gleitfähigkeit subkutaner Strukturen beim Menschen – eine Einführung
(Introduction to the knowledge of subcutaneous sliding system in humans)
Guimberteau, J. C., Sentucy-Rigall, J., Panconi, B., Bouleau, R., Mouton, P., Bakhach, J.
Osteopathische Medizin, 2008/01
1629

Methoden der Erkenntnisgewinnung in der Osteopathie
(Methods of obtaining knowledge in osteopathy. Part 1: The founders - A.T. Still and W.G. Sutherland)
Kaiser, F.
Osteopathische Medizin, 2008/01
1630

Sinnsuche: Krankheit, Spiritualität und Heilung
(The search for meaning: Illness, spirituality and healing)
Kalitzkus, V.
Osteopathische Medizin, 2008/01
1631

Manuelle Thermodiagnose nach Jean-Pierre Barral – Grundlagen
(Manual thermodiagnosis according to Jean-Pierre Barral - Basis principles)
Lossing, M. K., Lossing, K.
Osteopathische Medizin, 2008/01
1632

Spiritualität und Manuelle Medizin: Perspektiven für ein wiederentdecktes Forschungsthema
(Spirituality and manual medicine: Perspectives for a rediscovered topic of research)
Ostermann, T.
Osteopathische Medizin, 2008/01
1633

Vom Aschenputtel ins Rampenlicht: Das Bindegewebe im Mittelpunkt neu erwachten Forscher-Interesses
(From Cinderella in the limelight: Connective tissue in the focus of attention of eager researchers)
Schleip, R., Lambacher, M.
Osteopathische Medizin, 2008/01
1634

„Attentionality”: Osteosophische Basisschritte zur sensorischen Körper-Spiritualität in der osteopathischen Medizin
('Attentionality': Basic osteosophic steps towards a sensory spirituality of the body in osteopathic medicine)
Beuckels, J. M.
Osteopathische Medizin, 2008/01
1635

Osteopathie und Musikermedizin
(Osteopathy in musician's medicine)
Ridder, P.H.
Osteopathische Medizin, 2008/01
1636

OMT Homework
Clark, R. C.
The AAO Journal, 2007/12
Free full text
1637

Schmerzsyndrome in der Regio Inguinalis
(Pain syndroms of the inguinal region)
Beck, M.
Osteopathische Medizin, 2007/10
1638

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 3
(The craniomandibular system and its effects on the posture - Part III: Etiology, diagnosis and treatment of disorders of the CMS)
Honikel, M.
Osteopathische Medizin, 2007/10
1639

Manuelle Medizin wirkt auf schmerzhemmende Systeme!
(Manual medicine acts on pain inhibitory systems)
Locher, H., Sell, K.
Osteopathische Medizin, 2007/10
1640

Biomechanische Annäherung an die Dysfunktion - Teil 3: Die helikoidale Achse
(Biomechanical approach to dysfunction - Part 3: The helical axis)
Sommerfeld, P., Klein, P.
Osteopathische Medizin, 2007/10
1641

Frühkindliche Hinweise auf Lernstörungen und osteopathische Behandlungsansätze
(Signs of Learning Disorders in Early Childhood and Osteopathic Treatment Approaches)
Bierent-Vass, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1642

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1643

Spina bifida - Entstehung und Folgen
(Spina bifida - Development and Consequences)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1644

Masterkurs in Kirksville - ein Stimmungsbild
(Master course in Kirksville - an impression)
Kaiser, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1645

Lebensqualität
(Quality of Life)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1646

Osteopathische Begleitung bei frühkindlichen Fehlbildungen
(Osteopathic treatment for infantile malformations)
Mückler, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1647

Müsli gegen Spina bifida
(Muesli against spina bifida)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1648

Rauchen schadet Embryo
(Smoking harms the embryo)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1649

Kurze Entwicklungsgeschichte des enterischen Nervensystems (ENS)
(Brief evolutionary history of the enteric nervous system (ENS))
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
Free full text
1650

Zum Verständnis grundlegender Konzepte bei A.T. Still: form, function, generation, degeneration
(Understanding basic concepts in A.T. Still: form, function, generation, degeneration)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1651

Occipital Compression and its Potential Uses in Obstetrics
McAfee, S. N., Chila, A. G.
The AAO Journal, 2007/09
Free full text
1652

Independence and Interdependence
Paulus, S. F.
The AAO Journal, 2007/09
Free full text
1653

The Establishment of a Neuromusculoskeletal-Osteopathic Manipulative Medicine Service in a 700 Allopathic Physician Practice
Richards, T. M.
The AAO Journal, 2007/09
Free full text
1654

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 2
(The craniomandibular system and its effect on the posture - Part II)
Honikel, M.
Osteopathische Medizin, 2007/08
1655

Die Entwicklung der Wirbelsäule (Teil 2)
(The Development of the Spinal Column (Part 2))
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1656

Emotionale Diagnose und Behandlung nach J.P. Barral
(Diagnosis and Treatment of Emotional Problems according to Barral)
Klein Lossing, M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1657

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1658

SEE - Die SomatoEmotionale Entspannung nach Upledger
(SER - SomatoEmotional Release according to Upledger)
Landeweer, G. G., Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1659

Bundesarbeitsgemeinschaft Osteopathie e.V. (BAO) informiert
(Federal working group Osteopathy e.V. (BAO) informs)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1660

Das Aufbaumittel der Natur - „Nature's Tonic”-Auszug aus dem Osteopathic Magazine „Nature's Way to Health” von 1925
(Nature's Tonic - Excerpt from the 1925 Osteopathic Magazine 'Nature's Way to Health')
Radel, V.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1661

Speisen hält Leib und Seele zusammen
(Dining holds body and soul together)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1662

Medizin und Kreativität
(Medicine and creativity)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1663

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1664

Eine kurze Geschichte der Seele
(A Short History of the Soul)
Sommerfeld, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1665

Anforderungen an eine osteopathische Psychosomatik
(What to expect from a psychosomatic approach in osteopathy)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1666

Neuromusculoskeletal Causes of Back Pain in Competitive Figure Skaters
Goldman, S. I., Moyer, M.
The AAO Journal, 2007/06
Free full text
1667

Alleviating Atypical Tender Points Through the Use of Myofascial Release of Scar Tissue
Thomas, B. P.
The AAO Journal, 2007/06
Free full text
1668

Manuscript preparation and publication for would-be writers: An aid to disseminating osteopathic research
Mullinger, B.
International Journal of Osteopathic Medicine, 2007/06
1669

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 1
(The craniomandibular system (cms). Part 1: The cms and its effects on the body posture)
Honikel, M., Bruderhofer, A.
Osteopathische Medizin, 2007/05
1670

Biomechanische Annäherung an die Dysfunktion - Teil 2
(Biomechanical approach to dysfunction - Part 2: The movement index)
Klein, P., Sommerfeld, P.
Osteopathische Medizin, 2007/05
1671

Eine Einführung in die Harmonischen Techniken
(An introduction to Harmonic Technique)
Lederman, E.
Osteopathische Medizin, 2007/05
1672

Harmonische Techniken - Ausgewählte Beispiele
(Harmonic technique - Selected examples of Eyal Lederman)
Lederman, E.
Osteopathische Medizin, 2007/05
1673

Bau und Funktion des Ellbogengelenks
(Construction and Function of the Elbow)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1674

Die Motrizität
(Motricity)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1675

Studienarten
(Types of studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1676

Embryologie des Ellbogens
(Embryology of the Elbow)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1677

Tennisellbogen: Osteopathie statt Kortison!
(Tennis elbow: Osteopathy instead of cortisone!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1678

Tennisellbogen: Was hilft? Was hilft wirklich?
(Tennis elbow: What helps? What really helps?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1679

Der verletzte Ellbogen - Überlegungen aus orthopädischer und osteopathischer Sicht
(Elbow Trauma - Considerations from an orthopedic and osteopathic point of view)
Schleusener, R., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1680

Der Ellbogen
(The elbow)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1681

Is Osteopathy research relevant? A challenge has been made
Lucas, N. P., Moran, R. W.
The AAO Journal, 2007/03
Free full text
1682

Counterstrain Tender Points as Indicators of Sustained Abnormal Metabolism: Advancing the Counterstrain Mechanism of Action Theory
Rennie, P. R.
The AAO Journal, 2007/03
Free full text
1683

Back pain and the homoeostatic requirements of the spinal system
Brownhill, K.
International Journal of Osteopathic Medicine, 2007/03
1684

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03
1685

Biomechanische Annäherung an die Dysfunktion - Teil 1
(Biomechanical approach to dysfunction - Part 1)
Klein, P., Sommerfeld, P.
Osteopathische Medizin, 2007/02
1686

Biomechanik - Versuch einer Darstellung
(Biomechanics: Study of a description)
Sommerfeld, P.
Osteopathische Medizin, 2007/02
1687

Mechanical Link. Ein osteopathisches Diagnose- und Behandlungskonzept
(The mechanical link: An osteopathic diagnosis and treatment concept)
Somody-Neplaz, I., Chauffour, P., Prat, E.
Osteopathische Medizin, 2007/02
1688

Osteopathie in Kenia: Ein Projekt von Care Highway International
(Osteopathy in Kenya: A project of Care Highway International)
Soriano, L. C.
Osteopathische Medizin, 2007/02
1689

Die Anhaftungen des Perikards zu seinen Nachbarstrukturen und seine Funktion im Mediastinum
(Connections between the pericardium and its neighbouring structures and its function in the mediastinum)
Bartmer-Leitl, E., Kaufer, C. R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1690

Das Mediastinum und Intrathorakales Fasziales Release
(The mediastinum and intrathoracal fascial release)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1691

Die Bewegungen der Viszera: Die Mobilität, Teil 2
(Visceral Movements: Mobility, Part 2)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1692

Für eine streitbare und lebendige Osteopathie
(For a contentious and lively osteopathy)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1693

Verleihung des D.O. honoris causa an Karl-Ludwig Resch
(Award of the D.O. honoris causa to Karl-Ludwig Resch)
Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1694

Das Mediastinum - der Raum zwischen den Lungenflügeln
(The mediastinum - the space between the lungs)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1695

Das Herz: Allgemeine osteopathische Überlegungen und spezielle Ansätze in der Kinderosteopathie
(The Heart: General osteopathic reflections and special applications in pediatric osteopathy)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1696

Osteopathie, Quantenphysik, Offenbarung, Teil 2
(Osteopathy, Quantum Physics, Revelation, Part 2)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1697

Dr. A. T. Still’s Treating Chair
Jordan, T. R.
The AAO Journal, 2006/12
Free full text
1698

Cranial osteopathy: its fate seems clear
Hartman, S. E.
Chiropractic & Manual Therapies, 2006/12
Free full text
1699

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text
1700

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11
1701

Unser Fuß, ein komplexes Organ
(The Foot - A Complex Organ)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1702

Osteopathie, Quantenphysik, Offenbarung, Teil 1
(Osteopathy, Quantum Physics, Revelation, Part 1)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1703

Berührung - Wahrnehmung des Fernen im Nahen?
(Touching - Perception of the distant in closeness?)
Sommerfeld, P.
Osteopathische Medizin, 2006/10
1704

Folgen des intrauterinen Gefängnis: Fußdeformitäten
(Consequences of intrauterine imprisonment: Deformities of the Foot)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1705

Das Fulkrum - Auszug aus dem Journal of the Osteopathic Cranial Association,Jahrbuch von 1953
(The Fulcrum - Excerpt from the Journal of the Osteopathic Cranial Association,Yearbook of 1953)
Schooley, T. F.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1706

Osteopathische Diagnostik des oberen und unteren Sprunggelenks
(Osteopathic diagnostics of the upper and lower ankle joint)
Schallier, F.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1707

Osteopathic reasoning for the treatment of low back pain
Rennie, P. R.
Manuelle Medizin, 2006/10
1708

Brauchen Kinderfüße Einlagen?
(Do children's feet need insoles?)
Luthin, D., Rossi, S.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1709

Evidence based-Medizin (EBM)
(Evidence-based medicine (EBM))
Krause, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1710

Aspekte der traditionellen chinesischen Medizin bei der osteopathischen Behandlung des Fußes
(Aspects of traditional Chinese medicine in osteopathic treatment of the foot)
Kaufmann, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1711

Die Bewegungen der Viszera: Die Mobilität - Teil 1
(Visceral Movements: Mobility - Part 1)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1712

Bewusstheit für Bewegung - Die minimale Hebeltechnik und das Behandlungskonzept von Laurie Hartman
(Awareness for movement)
Franke, H.
Osteopathische Medizin, 2006/10
1713

Was bringt die Ganganalyse? - Pro und Contra
(What are the benefits of gait analysis? - Pros and cons)
Fink, M., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1714

One Heritage, Two Traditions; A Look to the Future
Steele, K. M.
The AAO Journal, 2006/09
Free full text
1715

Palpation of the sacroiliac joint: An anatomical and sensory challenge
McGrath, M. C.
International Journal of Osteopathic Medicine, 2006/09
1716

Infantile colic: A critical appraisal of the literature from an osteopathic perspective
Lim, K. W.
International Journal of Osteopathic Medicine, 2006/09
1717

Osteopathic medicine in transition: postmortem of the Osteopathic Medical Center of Texas
Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2006/09
Free full text
1718

Palpatory Evidence for Viscero-somatic Influence upon the Musculoskeletal System
Eland, D. C.
The AAO Journal, 2006/09
Free full text
1719

The Effects of Manipulation on Ligaments and Fascia from a Fluids Model Perspective
Crow, W. T.
The AAO Journal, 2006/09
Free full text
1720

Zen-Bewusstsein bei der Lehre der Palpation: Ein osteopathischer Ansatz
(Zen awareness in the teaching of palpation: An osteopathic perspective)
Comeaux, Z.
Osteopathische Medizin, 2006/08
1721

Merilyn Johnston Brooks über ihren Vater William L. Johnston: “Er engagierte bis zu seinem Tode für das Leben“
(Merilyn Johnston Brooks about her father William L. Johnston: “He committed himself to life until his death“)
Brooks, M. J.
Osteopathische Medizin, 2006/08
1722

Bewegung ist das primäre Kennzeichen von Leben
(Motion is the primary feature of life)
Vorro, J.
Osteopathische Medizin, 2006/08
1723

Das Mitchell-Johnston-Experiment: Funktioneller versus strukturellem Ansatz)
(The Mitchell-Johnston experiment: Functional versus structural approach)
Mitchell Jr., F. L.
Osteopathische Medizin, 2006/08
1724

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08
1725

Forschungen zur Somatischen Dysfunktion
(Research on somatic dysfunction)
Heath, D. M., Gevitz, N.
Osteopathische Medizin, 2006/08
1726

(Local versus passive regional motion input: Indication for viscero-somatic input)
Eland, D.
Osteopathische Medizin, 2006/08
Free full text
1727

Zur Übersetzung grundlegender Konzepte von A.T. Still: Soul
(Regarding the translation of A.T. Still's basic concepts: Soul)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1728

Benötige ich ein Kunstgelenk?
(Do I need an artificial joint?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1729

Das Ohr, Anatomie und Physiologie
(The Ear, Anatomy and Physiology)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1730

Behandlung eines temporomandibulären Problems bessert langfristig Tinnitus-Symptome
(Treatment of a temporomandibular problem improves tinnitus symptoms in the long term)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1731

Akuter Tinnitus: Selbstheilungskräfte dominieren
(Acute tinnitus: self-healing powers dominate)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1732

Osteopathische Therapie des chronischen Schwindels: Nutzen offen
(Osteopathic therapy of chronic vertigo: benefit unknown)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1733

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1734

Konfidenzintervall
(Confidence interval)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1735

Tinnitus aurium - Wenn das Ohr pfeift
(Tinnitus - When the ear whistles)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1736

Das Os temporale und seine Beziehungen
(The Temporal Bone and its Relations)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1737

What is the best treatment for infants with colic?
Crotteau, C. A., Wright, S. T.
The Journal of Family Practice, 2006/07
1738

Post Operative Osteopathic Manipulative Protocol for Delivery by Students in an Allopathic Environment
Clark, R. C., McCombs, T. M.
The AAO Journal, 2006/06
Free full text
1739

Psychology and low back pain
Bogduk, N.
International Journal of Osteopathic Medicine, 2006/06
1740

Was ist der „kraniosakrale Rhythmus“?
(What is the craniosacral rhythm? An article on employing craniosacral osteopathy (CSO))
von Heymann, W., Kohrs, C.
Manuelle Medizin, 2006/06
1741

Sacroiliac Mechanics Revisited
Jordan, T. R.
The AAO Journal, 2006/06
Free full text
1742

Understanding comorbidity with depression and anxiety disorders
Aina, Y., Susman, J. L.
The Journal of the American Osteopathic Association, 2006/05
1743

Nonobstetric lacerations of the vagina
Sloin, M. M., Karimian, M., Ilbeigi, P.
The Journal of the American Osteopathic Association, 2006/05
Free full text
1744

Mechanism-of-injury approach to evaluating patients with blast-related polytrauma
Scott, S. G., Belanger, H. G., Vanderploeg, R. D., Massengale, J., Scholten, J.
The Journal of the American Osteopathic Association, 2006/05
Free full text
1745

Treating patients for comorbid depression, anxiety disorders, and somatic illnesses
Dolnak, D. R.
The Journal of the American Osteopathic Association, 2006/05
1746

Morphologische Veränderungen des passiven Bewegungsapparates im Alter
(Morphologic Alterations in the Passive Musculoskeletal System in the Elderly)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1747

The Drive for Legitimation by Osteopathy and Chiropractic in Australia: Between Heterodoxy and Orthodoxy
Baer, H. A.
Complementary Health Practice Review, 2006/04
Free full text
1748

Zur Übersetzung grundlegender Konzepte von A.T. Still: Spiritual Being
(Regarding the translation of A.T. Still's basic concepts: Spiritual Being)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1749

Was die Osteopathie „Golden Girls” zu bieten hat
(What osteopathy has to offer „Golden Girls”)
Tettambel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1750

Kontinenzorgan Beckenboden - Biomechanische Leistungen des Bindegewebes für die Kontinenz sowie therapeutische Anmerkungen
(The pelvis as a continence organ - biomechanical tissue continence function and therapeutic notes)
Tanzberger, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1751

Sind strukturelle Veränderungen behandelbar? - Pro und Contra
(Are structural changes treatable? - Pros and cons)
Seider, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1752

Alles Schrott?
(All scrap?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1753

Altern und Osteopathie: Die Rolle von Beweisen
(Aging and Osteopathy: The Role of Evidence)
McGovern, R. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1754

Signifikanz
(Significance)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1755

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1756

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1757

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text
1758

Intercostal rib release
McCarty, C. L.
The AAO Journal, 2006/03
Free full text
1759

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03
1760

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text
1761

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1762

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1763

Matrix-Rhythmus-Therapie und osteopathischer Ansatz
(Matrix rhythm therapy and osteopathic approach)
Randoll, U. G., McCutcheon, R., Hennig, F. F.
Osteopathische Medizin, 2006/02
1764

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1765

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1766

Die Neue Schmerz- und Organtherapie (NPSO) nach Rudolf Siener - Geschichte und Anwendung
(The new pain and organ therapy (NPSO) according to Rudolf Siener - History and application)
Münch, M., Kaufmann, W.
Osteopathische Medizin, 2006/02
1767

Das bedeutende Vermächtnis der osteopathischen Prinzipien
(The most important legacy of osteopathic principles)
McGovern, J. J.
Osteopathische Medizin, 2006/02
1768

(Various approaches for the treatment of postpartal problems)
Ligner, B.
Osteopathische Medizin, 2006/02
Free full text
1769

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1770

Ethische Überlegungen zur Anwendung manipulativer Therapien in Altenpflegeheimen
(Ethical considerations for the use of manipulative therapy in nursing homes for the elderly)
Buckler, D., Strait, B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1771

Zur Übersetzung grundlegender Konzepte von A.T. Still: Philosophy, God and Experience
(For the translation of basic concepts of A.T. Still: Philosophy, God and Experience)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1772

Das Studium des Lebens
(The study of life)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1773

Osteopathie bei älteren Menschen und der derzeitige Stand der klinischen Forschung
(Osteopathy in the elderly and the current state of clinical research)
Noll, D. R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1774

Die osteopathische Versorgung älterer Menschen
(Osteopathic treatment of the elderly)
McGovern, J. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1775

Mit Statistik manipulieren
(Manipulate through statistics)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1776

Gedanken zur Gesundheit und zum Altern von Dr. Andrew Taylor Still
(Thoughts on Health and Aging by Dr. Andrew Taylor Still)
Haxton, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
Free full text
1777

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12
1778

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text
1779

American Osteopathic Association adopts policies on treatment of patients in pain: an overview
D'Alonzo, G. E., Jr., Stipp
The Journal of the American Osteopathic Association, 2005/11
Free full text
1780

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text
1781

Manual techniques addressing the lymphatic system: origins and development
Chikly, B. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
1782

Andrew Taylor Still-Techniken
(Andrew Taylor Still techniques)
Bachand, P.
Osteopathische Medizin, 2005/10
1783

Die osteopathische Medizin im Dilemma zwischen Tradition und Moderne
(Osteopathic medicine in the dilemma between tradition and modern approach)
Beck, M., Unverricht, R.
Osteopathische Medizin, 2005/10
1784

(H. M. Patterson, D.O.: His life as an osteopath)
Patterson, M. M.
Osteopathische Medizin, 2005/10
1785

Osteopathie. Eine quasi-medizinische Spielart des unvollständigen Nihilismus? Versuch einer ontologischen Standortbestimmung
(Osteopathy - A quasi-medical game of incomplete nihilism? Attempt of an ontological status)
Sommerfeld, P.
Osteopathische Medizin, 2005/10
1786

Morphologie, Funktion und Biomechanik des Hüftgelenks
(Morphology, function and biomechanics of the hip joint)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1787

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1788

Der fasziale Test und die Behandlung der Articulatio coxae
(The fascial test and treatment of the articulatio coxae)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1789

Automatic Shifting
Paulson, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1790

Ein Osteopath auf eigenen Wegen
(An osteopath on his own paths)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1791

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1792

Die akute Hüfte. Differenzialdiagnostische Überlegungen aus orthopädischer Sicht
(The Acute Hip. Considerations in Differential Diagnosis from an Orthopedic Aspect)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1793

Das Hüftgelenk
(The hip joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1794

Der holistische Imperativ in der Osteopathie
(The holistic imperative in osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1795

Interventional pain management: an overview for primary care physicians
Boyajian, S. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1796

Headache pain
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1797

Management of neuropathic pain
Galluzzi, K. E.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1798

Clinical Prevention and Population Health Curriculum Framework: the nursing perspective
Allan, J. D., Stanley, J., Crabtree, M. K., Werner, K. E., Swenson, M.
Journal of Professional Nursing, 2005/09
Free full text
1799

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1800

Management of osteoarthritic knee pain
Rubin, B. R.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1801

An osteopathic approach to treating women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1802

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1803

Legends and Lessons: William “Wild Bill” Wyatt, DO
Capobianco, A. D.
The AAO Journal, 2005/09
Free full text
1804

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text
1805

Anatomy in the Osteopathic Field
Paulus, S. F.
The AAO Journal, 2005/09
Free full text
1806

The Instrument of our Distinction: The Hand
Smutny, C. J. III.
The AAO Journal, 2005/09
Free full text
1807

Somatische Dysfunktion - Reflektion über die Anwendung des Begriffs in der osteopathischen Praxis
(Somatic dysfunction - Reflection on the use of the term in osteopathic practice)
Comeaux, Z.
Osteopathische Medizin, 2005/09
1808

Muscle energy technique: Geschichte, Modell und Wirksamkeit, Teil 2 - Das Modell
(Muscle energy technique. History, model and effectiveness, part 2 - The model)
Franke, H.
Osteopathische Medizin, 2005/09
1809

Biologische Basis des osteopathischen Konzeptes
(Biological basis of osteopathic concepts)
Korr, I. M.
Osteopathische Medizin, 2005/09
1810

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text
1811

The mechanics of cranial motion—the sphenobasilar synchondrosis (SBS) revisited
Cook, A.
Journal of Bodywork and Movement Therapies, 2005/07
1812

Muscle Energy Technique. Geschichte, Modell und Wirksamkeit, Teil 1
(Muscle energy technique. History, model and effectiveness - Part 1)
Franke, H.
Osteopathische Medizin, 2005/07
1813

Osteopathische Narbenbehandlung
(Osteopathic cicatrice treatment)
Mayer, J.
Osteopathische Medizin, 2005/07
1814

Qualitätssicherung in der Osteopathie in Österreich
(Quality assurance in osteopathy in Austria)
Mückler, A.
Osteopathische Medizin, 2005/07
1815

Dreigliedrige Osteopathie
(Triune osteopathy)
Pöttner, M., Hartmann, C.
Osteopathische Medizin, 2005/07
1816

Das stomatognathe System aus osteopathischer Sicht
(The Stomatognathic System from an Osteopathic Aspect)
Amigues, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1817

Das Kiefergelenk des Menschen
(The Human Jaw)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1818

Störungen in der Entwicklung des kindlichen Kiefers
(Developmental Disorders of the Jaw in Children)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1819

Literaturliste
(Bibliography)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1820

Etienne Cloet - Was wirklich zählt
(Etienne Cloet - What really matters)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1821

Osteopathie bei Kindern mit Asthma
(Osteopathy in children with asthma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1822

Soll Kieferorthopädie mit fest sitzenden Apparaten durch Osteopathie begleitet werden? Pro und Contra
(Should orthodontics with fixed appliances be accompanied by osteopathy? Pros and cons)
Seider, R., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1823

Tagebuch aus Kirksville
(Diary from Kirksville)
Sutmar, S.C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1824

Das Kiefergelenk
(The temporomandibular joint)
Terhorst, L., Sundermann, W.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1825

Erfahrungsprozess oder Bungee-Sprung in den Interzellularraum? Zu den Grundlagen osteopathischer Spiritualität
(A matter of experience or a bungee jump into intercellular space? On the foundations of osteopathic spirituality)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1826

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text
1827

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text
1828

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text
1829

Active fascial contractility: Fascia may be able to contract in a smooth muscle-like manner and thereby influence musculoskeletal dynamics
Schleip, R., Klingler, W., Lehmann-Horn, F.
Medical Hypotheses, 2005/06
1830

The UK BEAM trial – a review and discussion
Vogel, S., Dear, J., Evans, D. W.
International Journal of Osteopathic Medicine, 2005/06
1831

Sir William Osler then and now: thoughts for the osteopathic profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2005/05
Free full text
1832

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text
1833

La fondation de losteopathie par Andrew Taylor Still.
(The foundation of osteopathy by Andrew Taylor Still)
Hamonet, C.
La Revue du praticien, 2005/05
1834

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
1835

Facilitated oscillatory release - a dynamic method of neuromuscular and ligamentous/articular assessment and treatment
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/04
1836

Zur Übersetzung grundlegender Konzepte von A.T. Still: „Man is Triune“
(Regarding the translation of fundamental concepts of A.T. Still: “Man is Triune“)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1837

Das okulo-vestibulo-zervikale Funktionsmodell in der osteopathischen Praxis
(The oculo-vestibulo-cervico function model in the osteopathic practice)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1838

Osteopathische Therapie bei Glaukom
(Osteopathic Therapy of Glaucoma)
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1839

Wanderer zwischen den Osteopathiewelten
(Roamer between osteopathic worlds)
Fossum, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1840

Der Einfluss der osteopathischen Behandlung auf die Verkrümmung der Cornea
(The influence of osteopathic treatment on corneal curvature)
Haase, A.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1841

Tränenkanalstenose und andere Augenbeschwerden bei Kindern
(Lacrimal duct stenosis and other eye disorders in children)
Heinisch, M., Oberhuber, H.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1842

Die Bedeutung von Abstracts
(The importance of abstracts)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1843

Wie wichtig ist die visuelle Wahrnehmung in der Osteopathie? Pro und Contra
(How important is visual perception in osteopathy? Pros and cons)
Muts, R. K., Cloet, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1844

Osteopathie gegen Schielen
(Osteopathy for strabismus)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1845

Osteopathische Pilotstudie zum Offenwinkelglaukom
(Osteopathic pilot study on open-angle glaucoma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1846

Okulomotorik. Was bewegt das Auge?
(Oculomotorics: What makes the eye move?)
Storr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1847

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1848

Pain management in end-of-life care
Leleszi, J. P., Lewandowski, J. G.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1849

AOA's position against use of placebos for pain management in end-of-life care
Nichols, K. J., Galluzzi, K. E., Bates, B., Husted, B. A., Leleszi, J. P., Simon, K., Lavery, D., Cass, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1850

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03
1851

Medical Coverage for the American Team at the World 24-hour Championship Race in Brno Czech Republic
Lovy, A.
The AAO Journal, 2005/03
Free full text
1852

Rolfing und Osteopathie: Form und Funktion aus der Sicht des Rolfing
(Rolfing and osteopathy: Form and function from the viewpoint of rolfing)
Flury, H.
Osteopathische Medizin, 2005/03
1853

Qualität in der Osteopathiepraxis
(Quality in osteopathy practice)
Hafen, F.
Osteopathische Medizin, 2005/03
1854

Wo steht die Osteopathische Medizin? Stand und Zukunft der Osteopathischen Medizin aus Sicht des EROP
(What is the position of osteopathic medicine? Current state and future of osteopathic medicine from the viewpoint of the European Register for Osteopathic Physicians (EROP))
Mayer, J.
Osteopathische Medizin, 2005/03
1855

Palpation und Forschung
(Palpation and research in osteopathy)
Muzzi, D.
Osteopathische Medizin, 2005/03
1856

Wie ein Osteopath die Rolfingmethode sieht
(How an osteopath looks upon the rolfing method)
Proby, J.
Osteopathische Medizin, 2005/03
1857

Heilige Einfalt/Spannungsreiche Dreifaltigkeit
(Philosophy in osteopathic medicine: Sacred naivety/excoting trinity)
Wührl, P.
Osteopathische Medizin, 2005/03
1858

The biodynamic model of osteopathy in the cranial field
McPartland, J. M., Skinner, E.
Explore (NY), 2005/01
1859

Integrating Osteopathic terminology into SNOMED CT
Nash, S.
AMIA - Annual Symposium Proceedings, 2005/01
Free full text
1860

Wie hilfreich sind Fryette’s Gesetze in der Praxis? Pro und Contra
(How helpful are Fryette's laws in practice? Pros and cons)
Duncan, S., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1861

John Wernham - A.T. Stills “Enkel”
(John Wernham - A.T. Still's “Grandson“)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1862

Viszerosomatische Reflexe
(Viscerosomatic reflexes)
Friedman, H. D.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1863

Die Wirbelsäule
(The Spine)
Fuhrmann, M., Kühn, J.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1864

Osteopathie und Chiropraktik
(Osteopathy and chiropractic)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1865

Die Entwicklung der Wirbelsäule (Teil 1)
(The Development of the Spinal Column (Part 1))
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1866

Safety bei Untersuchung der Wirbelsäule
(Safety in the area of the spinal column)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1867

Aktuelle medizinische Definitionen: Die Verwendung der MeSH
(Current medical definitions: The use of medical subjects headings (MeSH))
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1868

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1869

Subakuter Rückenschmerz: Osteopathie als nützliche und kosteneffektive Ergänzung der Routinebehandlung
(Subacute spinal pain: Osteopathy as a useful and cost effecticve add-on to usual care)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1870

Untersuchungsresultate der Herzmobilität durch dreidimensionale Observation
(Heart motion, quantified by magnetic resonance imaging)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1871

Zur Übersetzung grundlegender Konzepte von A.T. Still: Biogen
(Regarding the translation of fundamental concepts of A.T. Still: Biogen)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1872

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text
1873

Blagrave-Technik zur Halswirbelsäulenbehandlung
(The Blagrave procedure for the treatment of the cervical spine)
Blagrave, P.
Osteopathische Medizin, 2004/11
1874

Die sensomotorische Entwicklung des Kindes
(The sensomotoric development of the child)
Darraillans, B.
Osteopathische Medizin, 2004/11
1875

Osteopathie beim Kleinkind
(Osteopathy in small children)
Dufresne, D.
Osteopathische Medizin, 2004/11
1876

Gibt es eine kranielle Osteopathie?
(Is there such a thing as cranial osteopathy?)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1877

F. X. Mayr-Diagnostik -Therapie und Osteopathie
(F.X. Mayr diagnosis and therapy and osteopathy)
Wilde, W.
Osteopathische Medizin, 2004/11
1878

Osteopathie in der kraniellen Sphäre
(Osteopathy in the cranial sphere)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1879

Anatomie der Schädelbasis: Os sphenoidale, ethmoidale und die Sinus paranasales
(Anatomy of the Skull Base)
Eser-Bindl, U.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1880

Ist das alte Modell der sphenobasilaren Symphyse noch aktuell? Pro und Contra
(Is the old sphenobasilar symphysis model still relevant? Pros and cons)
Esser, T., Guillaume, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1881

Sutherland und das “flüssige Licht”
(Sutherland and the “liquid light“)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1882

The unique role of osteopathic physicians in treating patients with low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/11
Free full text
1883

“Kraniosakral”- Mythen und Fakten
(“Craniosacral” - Myths and Facts)
Resch, K.L., Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1884

Intraossäre Läsion des Sphenoids und Os temporale - Ansichten und Vorgehen von Viola Frymann
(Intraosseus lesion of the sphenoid and temporalis. Views and Procedures from Viola Frymann)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1885

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text
1886

Kraniosakrale Osteopathie - Was ist das?
(What's craniosacral osteopathy?)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1887

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text
1888

Einigung über Curriculum in Frankfurt
(Agreement on curriculum for osteopathic training in Germany
Schmidt, S.
Osteopathische Medizin, 2004/11
1889

An introduction to the use of outcomes questionnaires in osteopathic practice
Vaughan, B., DiVenuto, G.
Journal of Osteopathic Medicine, 2004/10
1890

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09
1891

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09
1892

Wirksamkeit der Manipulation bei der Behandlung von Lumbago: Die Gültigkeit der Schlussfolgerungen bei Metaanalysen
(Effectiveness of manipulation in the treatment of low back pain: Validity of the conclusions in metaanalyses)
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Osteopathische Medizin, 2004/08
1893

Das Selbstverständnis eines Osteopathen
(Self-image of an osteopath)
Dräger, K.
Osteopathische Medizin, 2004/08
1894

Osteopathie beim Säugling
(Osteopathy in infants)
Dufresne, D.
Osteopathische Medizin, 2004/08
1895

Einführung in die Aquatische Osteopathie
(Introduction to aquatic osteopathy)
Dufresne, M.
Osteopathische Medizin, 2004/08
1896

Fulkren in der Aquatischen Osteopathie
(Fulcrum in aquatic osteopathy)
Dufresne, M.
Osteopathische Medizin, 2004/08
1897

Zur klinischen Bedeutung der Suturen im Hinblick auf das kraniosakrale System
(Clinical significance of sutures with regard to the craniosacral system)
Fanghänel, J., Preuße, U.
Osteopathische Medizin, 2004/08
1898

Suturen – Wachstumszentren des Schädels
(Sutures - Cranial growth centers)
Fanghänel, J., Preuße, U.
Osteopathische Medizin, 2004/08
1899

Den M. transversus perinei profundus gibt es nicht
(The deep transverse muscle of the perineum does not exist)
Gshwend, J., Hirth, T.
Osteopathische Medizin, 2004/08
1900

Der gastro-ösophagale Übergang in der Diagnostik und Behandlung (Teil 2)
(The esophagogastric junction in diagnosis and treatment (Part 2))
Helsmoortel, J., Hirth, T., Kleßen, H.
Osteopathische Medizin, 2004/08
1901

Russische Forschungsstudien im Bereich der kranialen Osteopathie
(Russian research in cranial osteopathy)
Kravchenko, T. I., Moskalenko, Y. E., Vartanyan, I. A.
Osteopathische Medizin, 2004/08
1902

Die Level der Halsweichteile – praktische Nomenklatur nach Neck dissection
(The level of soft tissues of the neck - Practical nomenclature after neck dissection)
Lehnert, B.
Osteopathische Medizin, 2004/08
1903

Verkettungen in der muskuloskelettalen Medizin
(Concatenations in musculoskeletal medicine)
Lewit, K.
Osteopathische Medizin, 2004/08
1904

Literaturrecherche mithilfe des Internets
(Literature search on the internet)
Müller, T. M.
Osteopathische Medizin, 2004/08
1905

Einheitliche Ausbildungsrichtlinien für Osteopathen Einigung in greifbarer Nähe
(Standardized educational guidelines for osteopaths)
Schmidt, S.
Osteopathische Medizin, 2004/08
1906

Ganz ganzheitlich: Ganzheitlichkeit der Osteopathie?
(Completely comprehensive: Comprehensiveness of osteopathy?)
Wührl, P.
Osteopathische Medizin, 2004/08
1907

Ganz ganzheitlich: Was von den Teilen in der Ganzheit übrig bleibt
(Completely comprehensive: What remains of the parts in the entirety)
Wührl, P.
Osteopathische Medizin, 2004/08
1908

Rechtsgutachten: Ist der Osteopath zur selbstständigen Berufsausübung in der Osteopathie berechtigt?
(Legal expert's opinion: Is an osteopath authorized to practice independently in osteopathy?)
Boxberg, E.
Osteopathische Medizin, 2004/08
1909

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1910

Anatomischer Aufbau und Funktion des Thorax - Topografie des Mediastinums
(Anatomic structure and function of the thorax - a topography of the mediastinum)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1911

Der Thorax: eine polyvalente, integrative wichtige Körperzone
(The thorax: an important polyvalent and integrative part of the body)
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1912

Globale integrierte Myofasziale Osteopathische Therapie (GIMFOT)
(Global integrated myofascial osteopathic therapy (GIMFOT))
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1913

Vom Gegen- und Miteinander
(Of working together and working against each other)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1914

Mobilisation der Rippen - in die ein geschränkte oder in die freie Richtung? Pro und Contra
(Mobilization of the ribs - in the restricted or in the free direction? Pros and cons)
Küttner, T., Geldschläger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1915

Eckpunkte für Curriculum festgelegt
(Cornerstones for curriculum established)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1916

Charles J. Smutny III - Neuer Fellow der AAO
(Charles J. Smutny III - New Fellow of the AAO)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
Free full text
1917

Wissenschaft, die Wissen schafft
(Science creating knowledge)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1918

Osteopathie im Bereich des Brustkorbs
(Osteopathy in the thoracic region)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1919

Risk management for chiropractors and osteopaths: informed consent. A common law requirement
Walker, B. F., Cameron, M., French, S., Pollard, H. P., Vitiello, A. L., Reggars, J. W., Werth, P. D.
Australasian Chiropractic & Osteopathy, 2004/07
1920

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text
1921

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text
1922

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text
1923

Osteopathie und Senkung der Arbeitsunfähigkeitszeit
(Osteopathy and disability reduction)
Hack, A.
Manuelle Medizin, 2004/05
1924

Die Entwicklung und osteopathische Behandlung von Kindern
(The development and osteopathic treatment of children)
Beinborn, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1925

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1926

Schutzimpfungen bei Kindern - Pro und Contra
(Vaccinations in children - pros and cons)
Dockx-Reinken, F., Rabe, S.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1927

Zur funktionellen Anatomie des kindlichen Schädels
(The functional anatomy of the infantile skull)
Fanghänel, J., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1928

The spotted monster
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1929

Das Unmögliche wagen
(Daring the impossible)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1930

Aspekte des Dialogs zwischen Kinderarzt und Osteopath
(Aspects of dialogue between paediatricians and osteopath)
Philippi, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1931

Das Okziput - ein wichtiger Aspekt der kraniosakralen Osteopathie bei Säuglingen
(Occiput: An important aspect of craniosacral osteopathy in infants)
Schwerdtner, H.P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1932

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text
1933

A divisional approach to enhancing research among osteopathic family practice residents
Smith-Barbaro, P., Fulda, K. G., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2004/04
Free full text
1934

Viewpoint
Evans, D.
Journal of Osteopathic Medicine, 2004/04
1935

Breathing pattern disorders, motor control, and low back pain
Chaitow, L.
Journal of Osteopathic Medicine, 2004/04
1936

Clinical considerations of sacroiliac joint anatomy: a review of function, motion and pain
McGrath, M. C.
Journal of Osteopathic Medicine, 2004/04
1937

The use of cranial osteopathy in the treatment of infants with breast feeding problems or sucking dysfunction
Wescott, N.
The Australian Journal of Holistic Nursing, 2004/04
1938

Energy medicine: an osteopath's personal view
Handoll, N.
The Journal of Alternative and Complementary Medicine, 2004/03
1939

The Neuroendocrine-Immune Complex Illustrated in the Work of Dr. Frank Chapman
Capobianco, J. D.
The AAO Journal, 2004/03
Free full text
1940

From the Archives: The Lymphatic System, Applied Anatomy
Millard, F. P.
The AAO Journal, 2004/03
Free full text
1941

Tägliche Eigenübungen
(Daily self-exercises)
Comeaux, Z., Haßfeld, U.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1942

Akuter Lumbago - ein funktioneller Ansatz
(Acute lumbago: a functional approach)
Debroux, J.J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1943

John Martin Littlejohn, Vater der europäischen Osteopathie
(John Martin Littlejohn, father of European osteopathy)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1944

Das Meeting der World Osteopathic Health Organisation (WOHO)
(The meeting of the World Osteopathic Health Organisation (WOHO))
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1945

“...jederzeit voll und ganz dabei sein!“
(“...be fully involved at all times!“)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1946

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text
1947

Die Bedeutung der Faszien in der manuellen Therapie
(The importance of fasciae in manual therapy)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1948

Wie viel Intensität braucht die Behandlung des Fasziengewebes? Pro und Contra
(How much intensity does the treatment of fascial tissue need? Pros and cons)
Schwind, P., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1949

Der “Diagnostic Touch“ von Rollin E. Becker
(The diagnostic touch from Rollin E. Becker)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1950

Stills Faszienkonzept
(Still’s fascia concept)
Stark, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1951

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text
1952

Efficacy of manipulation in low back pain treatment: The validity of meta-analysis conclusions
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Journal of Bodywork and Movement Therapies, 2004/01
1953

Erectile dysfunction and comorbid diseases, androgen deficiency, and diminished libido in men
Fine, S. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text
1954

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text
1955

Review of integrated neuromusculoskeletal release and the novel application of a segmental anterior/posterior approach in the thoracic, lumbar, and sacral regions
Danto, J. B.
The Journal of the American Osteopathic Association, 2003/12
Free full text
1956

From The Archives: A Glimpse of Dr. Still's Art
McConnell, C. P.
The AAO Journal, 2003/12
Free full text
1957

The Common Compensatory Pattern: Its Origin and Relationship to the Postural Model
Pope, R. E.
The AAO Journal, 2003/12
Free full text
1958

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11
1959

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text
1960

Osteopathie hilft bei Prävention & Reha
(Osteopathy helps in prevention and rehabilitation)
Schaa, J.
Pflege Aktuell, 2003/11
1961

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text
1962

Position-Assisted Combination Technique (PACT) in the Management of Type-II Impairment in the Thoracic and Lumbar Spine
Makofsky, H. W.
Journal of Manual and Manipulative Therapy, 2003/10
1963

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10
1964

A review of the physiology of cranial osteopathy
Ferguson, A.
Journal of Osteopathic Medicine, 2003/10
1965

Intervertebral dysfunction: a discussion of the manipulable spinal lesion
Fryer, G.
Journal of Osteopathic Medicine, 2003/10
1966

The Epley manoeuvre for treatment of benign paroxysmal positional vertigo: a simple office based technique
McIlwraith, B.
Journal of Osteopathic Medicine, 2003/10
1967

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10
1968

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text
1969

Viewpoint
Chaitow, L.
Journal of Osteopathic Medicine, 2003/10
1970

Ist der Osteopath in Deutschland zur selbstständigen Berufsausübung berechtigt?
(Is the osteopath authorized to practice independently in Germany?)
Boxberg, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1971

Veränderungen im Bereich des Beckenbodens in der Schwangerschaft
(Pregnancy-related changes in the pelvic floor region)
Dittmar, F. W.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1972

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1973

Osteopathie in der Schwangerschaft
(Osteopathy during pregnancy)
Gillemot, B.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1974

Osteopathie – ohne Frauen undenkbar!
(Osteopathy - unthinkable without women!)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1975

James McGovern, Anwalt der Osteopathie
(James McGovern, Osteopathic Advocate)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1976

Osteopathische Begleitung während der Schwangerschaft
(Osteopathic support during pregnancy)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1977

Ein Blick über den Zaun: Beckenbodentraining bei Schwangerschaftsinkontinenz
(Looking beyond the fence: pelvic floor muscle training during pregnancy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1978

Osteopathie in der Schwangerschaft: Profitieren Mutter und Kind?
(Osteopathy in pregnancy: positive impact on mother and child?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1979

Gesundheitsstörungen in der Schwangerschaft: Joker Osteopathie?
(Pregnancy associated health problems: joker osteopathy?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1980

Behandlung von Symphysis pubis, knöchernem Becken und Beckenboden
(Treatment of symphysis pubis, bony pelvis and pelvic floor)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1981

Osteopathische Selbsthilfe bei Unterleibsschmerzen und Beckenbodendysfunktion
(Osteopathic self-help for abdominal pain and pelvic floor dysfunction)
Tettambel, M. A.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1982

Place de l’acupuncteur et du thérapeute manuel dans la prise en charge pluridisciplinaire des douloureux chroniques
(Place of acupuncturist and osteopath in multidisciplinary chronic pain management)
Meas, Y., Nizard, J., Rouxeville, Y., Lajat, Y.
Douleur et Analgesie, 2003/09
1983

Likening Likening Strikes. Psychiatry, Osteopathy, and the Likeness Argument
Tyreman, S.
Philosophy, Psychiatry & Psychology, 2003/09
1984

History of Osteopathy in France
Barillon, B.
The AAO Journal, 2003/09
Free full text
1985

Facilitated Oscillatory Release - a method of dynamic assessment and treatment of Somatic Dysfunction
Comeaux, Z. J.
The AAO Journal, 2003/09
Free full text
1986

Dynamic Strain-Vector Release: An Energetic Approach to OMT
Hendryx, J. T., O'Brien, R. L.
The AAO Journal, 2003/09
Free full text
1987

“The Energy cyst“: Its Ramifications and Use in Osteopathic Manipulative Management
MacDonald, R. C.
The AAO Journal, 2003/09
Free full text
1988

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text
1989

A primary care approach to comprehensive care of patients with type 1 and type 2 diabetes mellitus
Keilers, R. K.
The Journal of the American Osteopathic Association, 2003/08
Free full text
1990

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text
1991

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text
1992

Osteopathic manipulative medicine in the treatment of hypertension: An alternative, conventional approach
Spiegel, A. J., Capobianco, J. D., Kruger, A., Spinner, W. D.
Heart Disease, 2003/07
1993

Treating patients in primary care: the impact of mood, behavior, and thought disturbances
Baron, D. A., Hay, D. P., Easom, H. M.
The Journal of the American Osteopathic Association, 2003/07
Free full text
1994

Aufbau und Funktion des Peritoneums
(Structure and function of the peritoneum)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
1995

Abenteuer Leichenbeschaffung
(Adventure of providing cadavers)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
1996

Die mechanische Funktion des rechten Kolonwinkels
(The mechanical function of the right colonic angle)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
1997

Zum primären Verletzungsmechanismus bei Beschleunigungsverletzungen
(Whiplash injury: What you should know)
Keller, M., Bischoff, A., Schwerla, B. S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
1998

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
1999

Nackenschmerzen: Hand anlegen überlegen!
(Neck pain: manual therapy scores best)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2000

Nackenschmerzen: Manualtherapie am günstigsten
(Cost-effectiveness of common treatments for neck pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2001

Bauchschmerzen - Wer untersucht? Wer behandelt?
(Abdominal pain - Who examines? Who treats?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2002

Die Viszera - Konsequenzen aus der Autonomie für die Osteopathie? Pro und Contra
(The viscera - consequences of autonomy for osteopathy? Pros and cons)
Wührl, P., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2003

From the Archives: A Manual of Cranial Technique
Lippincott, R. C., Lippincott, H. A.
The AAO Journal, 2003/06
Free full text
2004

Physiological Background of the Cranial Rhythmic Impulse and The Primary Respiratory Mechanism
Moskalenko, Y., Frymann, V., Kravchenko, T., Weinstein, G.
The AAO Journal, 2003/06
Free full text
2005

A call for osteopathic descriptive research: use of a functional model to distinguish segmental motion behavior
Johnston, W. L., Vorro, J.
Journal of Osteopathic Medicine, 2003/04
2006

What is the clinical utility of the cervical extension rotation test as routinely applied in the premanipulative screening process?
Moran, R., Mullany, A.
Journal of Osteopathic Medicine, 2003/04
2007

Single system research designs in osteopathy
Sanders, G.
Journal of Osteopathic Medicine, 2003/04
2008

Praktische osteopathische Überlegungen zu den Nasennebenhöhlen
(Practical osteopathic considerations for the paranasal sinuses)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2009

Sinus sphenoidalis und ethmoidalis
(Sphenoid sinus and ethmoid sinus)
Eser-Bindl, U.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2010

Funktionelle Anatomie der Nasennebenhöhlen
(Functional anatomy of the paranasal sinuses)
Fanghänel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2011

Wie kam die Allopathie in die amerikanische Osteopathie?
(How did allopathy get into American osteopathy?)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2012

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2013

Renzo Molinari, Medizin des dritten Jahrtausends
(Renzo Molinari, Medicine of the third millennium)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2014

Die chronische Sinusitis: Eine Übersicht
(A review of chronic sinusitis)
Resch, K.L., Häfner, S., Stadler, M., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2015

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2016

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2017

Wissenswertes zum Bereich von Hals, Nase und Ohren
(Things to know about the area of the throat, nose and ears)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2018

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2019

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2020

Bibliotherapy: the therapeutic use of didactic and literary texts in treatment, diagnosis, prevention, and training
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2003/03
Free full text
2021

Bioelectric responsiveness of fascia: A model for understanding the effects of manipulation
O'Connell, J. A.
Techniques in Orthopaedics, 2003/03
2022

Etiological Factors in Sacral Somatic Dysfunctions
Danto, J. B.
The AAO Journal, 2003/03
Free full text
2023

From the Archives: The Contribution of John Martin Littlejohn to Osteopathy
Hall, T. E., Wernham, J.
The AAO Journal, 2003/03
Free full text
2024

Conceptual and Treatment Models in Osteopathy
Jordan, T.
The AAO Journal, 2003/03
Free full text
2025

Andrew Taylor Still and the birth of osteopathy (Baldwin, Kansas, USA, 1855)
Hamonet, C.
Joint Bone Spine, 2003/02
2026

Spinal manipulation for low-back pain: a treatment package agreed to by the UK chiropractic, osteopathy and physiotherapy professional associations
Harvey, E., Burton, A. K., Moffett, J. K., Breen, A.
Manual Therapy, 2003/02
2027

Manipulation of the cervical spine
Hing, W. A., Reid, D. A., Monaghan, M.
Manual Therapy, 2003/02
2028

The national cholesterol education program adult treatment panel ill guidelines
Clearfield, M. B.
The Journal of the American Osteopathic Association, 2003/01
Free full text
2029

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text
2030

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01
2031

Allgemeiner Aufbau des Kniegelenks
(General structure of the knee joint)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2032

Praxis optimieren: Eingang und Flur
(Optimizing your practice: Entrance and hallway)
Edelmann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2033

Hausaufgaben und Tipps für’s Knie
(Homework and tips for the knee)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2034

Anthony G. Chila - Die zwei Seiten einer Medaille
(Anthony G. Chila - Two sides of the same coin)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2035

Die Arthrose in die Knie gezwungen? Studie zu chronisch-degenerativen Knie- bzw. Hüftschmerzen
(Osteoarthritis brought to its knees? Study on chronic degenerative knee or hip pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2036

Das schmerzhafte Knie: Eine Übersicht
(The painful knee: an overview)
Resch, K.L., Bachem, S., Salzmann, I., Schwartz, U., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2037

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2038

Traumatologische Diagnostik des Kniegelenks
(Traumatological diagnostics of the knee joint)
Schwerdtner, H.P., Schallier, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2039

Das posttraumatische Kniegelenk
(The post-traumatic knee joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2040

The Primary Respiratory Mechanism
Nelson, K. E.
The AAO Journal, 2002/12
Free full text
2041

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2042

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2043

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11
2044

Aptitude for osteopathic training. 1939
Yarborough, J. U.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2045

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2046

A critical appraisal of an article comparing the effectiveness of osteopathic manipulation and chemonucleolysis in the management of symptomatic lumbar disc herniation
Legge, D.
Journal of Osteopathic Medicine, 2002/10
2047

Developing research at The British School of Osteopathy
Nash, K., Vogel, S.
Journal of Osteopathic Medicine, 2002/10
2048

Getting to the point: an osteopathic appreciation of Janet Travell
McPartland, J. M.
Journal of Osteopathic Medicine, 2002/10
2049

Osteopathic perturbation and immune network compensation
Degabriele, R.
Journal of Osteopathic Medicine, 2002/10
2050

From the Archives: Vindication
Bennett, G. M.
The AAO Journal, 2002/09
Free full text
2051

Digging On: Some thoughts on the integration of Russellian Cosmology and Osteopathy
Scariati, P. D.
The AAO Journal, 2002/09
Free full text
2052

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text
2053

Educating health professionals, first responders, and the community about bioterrorism and weapons of mass destruction
Silvagni, A. J., Levy, L. A., McFee, R. B.
The Journal of the American Osteopathic Association, 2002/09
Free full text
2054

Osteopathy in the cranial field: uncovering challenges and potential applications
King, H. H.
The Journal of the American Osteopathic Association, 2002/07
Free full text
2055

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text
2056

A Discussion of Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
Lemley, W. W.
The AAO Journal, 2002/06
Free full text
2057

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text
2058

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text
2059

Joint cracking and popping: understanding noises that accompany articular release
Protopapas, M. G., Cymet, T. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text
2060

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04
2061

A critical appraisal of an article examining the efficacy of ultrasound treatment for carpal tunnel syndrome
Lucas, N.
Journal of Osteopathic Medicine, 2002/04
2062

The immune network and homeostasis
Degabriele, R.
Journal of Osteopathic Medicine, 2002/04
2063

Inter-examiner reliability in detecting cervical spine dysfunction: A short review
Vaughan, B.
Journal of Osteopathic Medicine, 2002/04
2064

'We will look for health': the Osteopathic Center for Children
Chilton, K.
Alternative Therapies in Health and Medicine, 2002/03
2065

Tackling birth trauma with cranio-sacral therapy
Turney, J.
The Practising Midwife, 2002/03
2066

From the Archives: Osteopathic Fundamentals
Page, L. E.
The AAO Journal, 2002/03
Free full text
2067

Edgar Cayce and Osteopathy: Can we learn more about osteopathic philosophy from Cayce?
Richardson, M. E.
The AAO Journal, 2002/03
Free full text
2068

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text
2069

The Anatomy Professor That Ate New York: Some Dinosaurs Are Teachers, And Some Teach About Dinosaurs
Cammarata, J.
The AAO Journal, 2002/03
Free full text
2070

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02
2071

Proposed tenets of osteopathic medicine and principles for patient care
Rogers, F. J., D'Alonzo, G. E., Jr., Glover, J. C., Korr, I. M., Osborn, G. G., Patterson, M. M., Seffinger, M. A., Taylor, T. E., Willard
The Journal of the American Osteopathic Association, 2002/02
Free full text
2072

Can an Internet-based system assist with administration and distance learning for third- and fourth-year rural clinical rotations?
Baker, H. H., Foster, R. W., Cope, M. K., Boisvert, C., Wallace, G. H.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2073

Introduction to the Texas College of Osteopathic Medicine at the University of North Texas Health Science Center at Fort Worth
Aylett, K., Squires, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2074

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2075

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text
2076

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2077

Pre-Doctoral Fellowship Program in the Osteopathic Manipulative Medicine Program at the Texas College of Osteopathic Medicine
Slicho, T., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2078

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2079

Research Accomplishments of the Department of Osteopathic Manipulative Medicine of the Texas College of Osteopathic Medicine
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2080

Neuromusculoskeletal Medicine and Osteopathic Manipulative Treatment Residency Programs at the Osteopathic Medical Center of Texas
Stoll, S. T., Carnes, M., Brooks, L.
The AAO Journal, 2001/12
Free full text
2081

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2082

A framework for and case study of medical informatics development at Michigan State University College of Osteopathic Medicine
Notman, M., Greene, J. F.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2083

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2084

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2085

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text
2086

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text
2087

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text
2088

Hands on care
Turney, J.
Nursing Standard, 2001/10
2089

Measurement challenges in physical diagnosis: refining inter-rater palpation, perception and communication
Comeaux, Z., Eland, D., Chila, A. G., Pheley, A., Tate, M.
Journal of Osteopathic Medicine, 2001/10
2090

Considerations for planning and conducting clinic-based research in physical therapy
Fitzgerald, G., Delitto, A.
Journal of Osteopathic Medicine, 2001/10
2091

Examining diagnostic tests: An evidence-based perspective
Fritz, J., Wainner, R.
Journal of Osteopathic Medicine, 2001/10
2092

Patient positioning and spinal locking for lumbar spine rotation manipulation
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10
2093

Acute low cervical nerve root conditions: symptom presentations and pathobiological reasoning
Gifford, L.
Journal of Osteopathic Medicine, 2001/10
2094

Destiny of osteopathic profession. 1916
Meacham, W. B.
The Journal of the American Osteopathic Association, 2001/10
2095

Cervical spine manipulation and the precautionary principle
Vautravers, P., Maigne, J.Y.
Journal of Osteopathic Medicine, 2001/10
2096

The case for uncontrolled clinical trials: a starting point for the evidence base for complementary and alternative medicine (CAM)
White, A., Ernst, E.
Journal of Osteopathic Medicine, 2001/10
2097

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text
2098

Andrew Taylor Still Memorial Lecture: the osteopathic difference--is it only manipulation? 1984
Siehl, D.
The Journal of the American Osteopathic Association, 2001/10
2099

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09
2100

A research program for the osteopathic profession. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2101

Research our great and only hope
Snyder, O. J.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2102

Elbow injuries in golf
Stockard, A. R.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2103

Osteopathische Diagnose und Behandlung von Dysfunktionen des Brustkorbs und der Rippen
(Osteopathic diagnosis and treatment of thoracic and costal dysfunctions)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2001/09
2104

Angina pectoris with special reference to its mechanical causes. 1938
Appleyard, E. C.
The Journal of the American Osteopathic Association, 2001/08
Free full text
2105

Osteopathic treatment of the common cold. 1937
Becker, A. D.
The Journal of the American Osteopathic Association, 2001/08
Free full text
2106

The osteopathic lesion as the etiological factor in some common surgical disorders. 1948
Conley, G. J.
The Journal of the American Osteopathic Association, 2001/08
Free full text
2107

Methods of applying manipulative technic. 1945
Burns, L.
The Journal of the American Osteopathic Association, 2001/07
Free full text
2108

Soft tissues in areas of osteopathic lesion. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/07
Free full text
2109

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2110

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2111

Cold-induced urticaria
Mahmoudi, M.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2112

A randomized clinical trial of exercise and spinal manipulation for patients with chronic neck pain
Bronfort, G., Evans, R., Nelson, B., Aker, P. D., Goldsmith, C. H., Vernon, H.
Journal of Osteopathic Medicine, 2001/04
2113

Evaluation of acute headaches in adults
Clinch, C. R.
Journal of Osteopathic Medicine, 2001/04
2114

Spinal manipulation: Indications, risks and benefits
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/04
2115

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text
2116

Balanced on a tight rope between low back pain and evidence-based practice
Shacklock, M.
Journal of Osteopathic Medicine, 2001/04
2117

Osteopathic treatment considerations for rheumatic diseases
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
2118

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
2119

Abbreviations for use in osteopathic case notes
Fryer, G.
Journal of Osteopathic Medicine, 2001/04
2120

The Interdisciplinary Generalist Curriculum Project at Nova Southeastern University College of Osteopathic Medicine
Blavo, C., Steinkohl, D. C.
Academic Medicine, 2001/04
Free full text
2121

Review of Sacral Somatic Dysfunction
Janiak, D. D.
The AAO Journal, 2001/03
Free full text
2122

The primary respiratory mechanism beyond the craniospinal axis
Lee, R. P.
The AAO Journal, 2001/03
Free full text
2123

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text
2124

Researched and demonstrated: inquiry and infrastructure at osteopathic institutions
Gevitz, N.
The Journal of the American Osteopathic Association, 2001/03
Free full text
2125

The somatic components of disease. 1956
MacBain, R. N.
The Journal of the American Osteopathic Association, 2001/03
Free full text
2126

Osteopathische Medizin
(Osteopathic Medicine)
Tempelhof, S., Weingart, J. R.
Erfahrungsheilkunde, 2001/03
2127

Muscle and the myoneural junction. Their relation to segmental spinal dysfunctions. 1955
Cole, W. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text
2128

Analyzing the osteopathic lesion. 1940
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/02
Free full text
2129

The place of the osteopathic concept in the healing art. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/01
Free full text
2130

Collaboration on research picks up steam
Dyer, M. J., Wood, D. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text
2131

Osteopathy--fifty years later. Founders Memorial Lecture. 1951
Fischer, R. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text
2132

Minor depression in primary care
Banazak, D. A.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2133

Endoscopic retrograde cholangiopancreatography: what role does it have in primary care?
Biery, D. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2134

Sleep-related gastroesophageal reflux
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2135

Spirituality in Osteopathic Medicine
Lee, R. P.
The AAO Journal, 2000/12
Free full text
2136

What osteopathists stand for in legislation. 1910
Hildreth, A. G.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2137

Government control of medicine
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2138

A primary care approach to pediatric gastroesophageal reflux
Sunku, B., Marino, R. V., Sockolow, R.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2139

The future in retrospect. 1935
Swope, C. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2140

Tendencies in a social, political, and governmental way which may influence doctors. 1937
Thomas, E. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2141

Acute gastrointestinal bleeding: clinical essentials for the initial evaluation and risk assessment by the primary care physician
Zuckerman, G. R.
The Journal of the American Osteopathic Association, 2000/12
2142

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2143

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2144

The venous side: current directions in anticoagulant therapy
Kaatz, S.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2145

Long-term therapy of coronary artery disease: a vascular biology perspective
Mathé, A. J., Clearfield, M. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2146

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2147

Diagnosis and treatment of carotid artery stenosis
Mintz, B. L., Hobson, R. W.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2148

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2149

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2150

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2151

Thrombolytic, antithrombin, and antiplatelet treatment of acute coronary syndromes
Puma, J. A., Sketch, M. H.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2152

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2153

The clinical spectrum of acute coronary syndromes
Rogers, F. J.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2154

How West Virginia School of Osteopathic Medicine achieves its mission of providing rural primary care physicians
Stookey, J. R., Baker, H. H., Nemitz, J. W.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2155

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2156

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2157

Osteoporosis
Cymet, T. C., Wood, B., Orbach, N.
The Journal of the American Osteopathic Association, 2000/10
2158

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text
2159

Managing common problems in perimenopausal women
Forstein, D. A.
The Journal of the American Osteopathic Association, 2000/10
2160

Vascular medicine and osteopathic medicine: treating the whole patient
Gironta, M. G., Rosenfeld, C. R.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2161

Endovascular treatment of peripheral arterial disease
Gray, B. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2162

Glycation as the glucose link to diabetic complications
Gugliucci, A.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2163

Hypertension and renal artery stenosis: a complex clinical scenario
Jaff, M. R.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2164

Clinical use of selective estrogen receptor modulators
Krueger, P. M.
The Journal of the American Osteopathic Association, 2000/10
2165

Diagnosis and medical management of patients with intermittent claudication
LaPerna, L.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2166

Influencing the vegetative nervous system through manipulation. 1945
Northup, G. W.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2167

Update: the latest on hormone replacement therapy
Packin, G. S.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2168

Spirituality in history taking
Spaeth, D. G.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2169

The autonomic nervous system in osteopathic therapy. 1948
Waitley, D. D.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2170

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2171

Headache as a manifestation of otolaryngologic disease
Cosenza, M. J.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2172

The Role of Vibration or Oscillation in the Development of Osteopathic Thought
Comeaux, Z. J.
The AAO Journal, 2000/09
Free full text
2173

An Ancient Persian High-Velocity, Low-Amplitude Thrusting Technique for Somatic Dysfunctions of the Thoracic Spine
Namazian, M., Clark, R. C., Binkerd, J.
The AAO Journal, 2000/09
Free full text
2174

Carpal tunnel syndrome: more than just a problem at the wrist
Ramey, K. A.
The AAO Journal, 2000/09
Free full text
2175

Osteopathic cranial lesions. 1948
Kimberly, P. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2176

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2177

Psychologic aspects of chronic headache
Mueller, L.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2178

The cranial bowl. 1944
Sutherland, W. G.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2179

Treatment of acute migraine attacks
Weintraub, J. R.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2180

Strategic choices for a primary care advantage: re-engineering osteopathic medicine for the 21st century
Glover, S. H., Rivers, P. A.
Health Services Management Research, 2000/08
2181

Circadian rhythm sleep disorders
D'Alonzo, G. E., Krachman, S. L.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2182

Dangers of sleepiness and inattention while driving
Eberhart, R., Hu, X., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2183

Sleep and breathing disorders: the genesis of obstructive sleep apnea
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2184

Osteopathy and insanity. 1917
Gerdine, L. V.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2185

Schizophrenia. 1939
Hildreth, A. G., Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2186

Workup and indications for polysomnography in patients with sleep-related complaints
Knox, K. S., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2187

Osteopathic and “old school“ results in mental diseases. 1933
Merrill, E. S.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2188

Psychosis and osteopathy
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2189

The mechanism of anatomical structure in its relation to osteopathy. 1911
Bernard, H.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2190

Clinical research: the process
Goldstein, F. J.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2191

The emerging concept of the osteopathic lesion. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2192

Latex allergy: a primary care primer
Mahmoudi, M., Hunt, L. W.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2193

Inhaled corticosteroid-induced bone loss and preventive strategies
Singh, R. F., Muskelly, C. C.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2194

Early legal cases on appeal that became case law for osteopaths and chiropractors
Jackson, R. B.
Chiropractic History, 2000/06
2195

Osteopathic practice. 1903
Bernard, H. E.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2196

Rural osteopathic family physician supply: past and present
Tooke-Rawlins, D.
The Journal of Rural Health, 2000/06
2197

From the Archives: Prenatal Care
Grow, O. P.
The AAO Journal, 2000/06
Free full text
2198

Cardiovascular disease and obstructive sleep apnea: implications for physicians
Foresman, B. H., Gwirtz, P. A., McMahon, J. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2199

The compensatory pattern, as seen in art and osteopathy
Quinn, A.
The AAO Journal, 2000/06
Free full text
2200

Palpatory diagnosis. 1932
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2201

A glimpse of Dr. Still's art. 1917
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2202

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05
2203

One hundred thousand cases of influenza with a death rate of one-fortieth of that officially reported under conventional medical treatment. 1919
Smith, R. K.
The Journal of the American Osteopathic Association, 2000/05
Free full text
2204

Influenza and its osteopathic management. 1937
Ward, E. A.
The Journal of the American Osteopathic Association, 2000/05
Free full text
2205

Osteopathic success in the treatment of influenza and pneumonia. 1919
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/05
Free full text
2206

Somatic sensory impulses and vertebral lesions. 1921
Burns, L.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2207

Use of magnetic resonance imaging to diagnose common wrist disorders
DiMarcangelo, M. T., Smith, P. A.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2208

Early research: the A.T. Still Research Institute and Louisa Burns
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2209

Osteopathie - Die sanfte Chirotherapie
(Osteopathy - The gentle chirotherapy)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2000/04
2210

Research Directions From 1940-1988
Beal, M. C.
The AAO Journal, 2000/03
Free full text
2211

Advancing Osteopathic Medicine in Health Care: Integrating OMM into Osteopathic Medical Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 2000/03
Free full text
2212

The overactive bladder in multiple sclerosis
Fingerman, J. S., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 2000/03
Free full text
2213

Office evaluation of the patient with an overactive urinary bladder
Kowalczyk, J. J.
The Journal of the American Osteopathic Association, 2000/03
Free full text
2214

Surgical and medical treatment options for urge incontinence
Lonsway, J. M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
2215

Manual medicine treatment of the cervical spine and whiplash injury
Bilkey, W. J., Tomski, M. A.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
2216

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02
2217

The Comprehensive Osteopathic Medical Licensing Examination, COMLEX-USA: a new paradigm in testing and evaluation
Osborn, G. G., Meoli, F. G., Buser, B. R., Clearfield, M. B., Bruno, J. P., Sumner-Truax, L.
The Journal of the American Osteopathic Association, 2000/02
Free full text
2218

Reiter's syndrome and reactive arthritis
Parker, C. T., Thomas, D.
The Journal of the American Osteopathic Association, 2000/02
2219

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
2220

The economic burden of back pain in the UK
Maniadakis, N., Gray, A.
Pain, 2000/01
2221

Management of osteoporosis in the new millennium
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2000/01
2222

Osteoporosis: a new understanding of its impact and pathogenesis
Chopra, A.
The Journal of the American Osteopathic Association, 2000/01
2223

Effective strategies for the prevention of osteoporosis across the life span
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2000/01
2224

Role of antileukotriene agents in asthma therapy
Gawchik, S. M., Saccar, C. L.
The Journal of the American Osteopathic Association, 2000/01
Free full text
2225

Osteopathy an independent system co-extensive with the science and art of healing. 1901
Littlejohn, J. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text
2226

Evaluation of osteoporosis
Nichols, K. J.
The Journal of the American Osteopathic Association, 2000/01
2227

Muscle energy concepts - a need for change.
Fryer, G.
Journal of Osteopathic Medicine, 2000
Free full text
2228

A new challenge: Replacing opinion-based with evidence-based decisions
Heath, D. M., Kelso, A. F.
The AAO Journal, 1999/12
Free full text
2229

What's in a name? For DOs, plenty
Guglielmo, W. J.
Medical Economics, 1999/12
2230

Mechanism of action of high-velocity, low amplitude thrust technique
Mesina, J., Balmer, J., Esper, S., Esper, E., Evans, R., Hampton, D.
The AAO Journal, 1999/12
Free full text
2231

An overview of osteopathic medicine
Lesho, E. P.
Archives of Family Medicine, 1999/11
2232

ABC of complementary medicine. The manipulative therapies: osteopathy and chiropractic
Vickers, A., Zollman, C.
The BMJ, 1999/10
2233

A review of the principles of William G. Sutherland's general techniques
Golden, W. J.
The AAO Journal, 1999/09
Free full text
2234

Health services research: Evidence-based medicine and the AAO five-year strategy
Kelso, A. F., Heath, D. M.
The AAO Journal, 1999/09
Free full text
2235

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text
2236

Perspectives: An overview of support for osteopathy in the cranial field
Kuchera, M. L.
The AAO Journal, 1999/09
Free full text
2237

Gastroesophageal reflux disease update for the primary care physician
Mitz, H. S.
Journal of Osteopathic Medicine, 1999/08
Free full text
2238

Research resources to advance osteopathic theory and practice
Kelso, A. F., Heath, D. M.
The AAO Journal, 1999/06
Free full text
2239

Osteopathy – A philosophical perspective
Masiello, D. J.
The AAO Journal, 1999/06
Free full text
2240

OMM beyond the classroom – The Future is now
Veneziano, M.
The AAO Journal, 1999/06
Free full text
2241

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text
2242

An osteopathic approach to asthma
Rowane, W. A., Rowane, M. P.
Journal of Osteopathic Medicine, 1999/05
Free full text
2243

Support programs for minority students at Ohio University College of Osteopathic Medicine
Thompson, H. C., Weiser, M. A.
Academic Medicine, 1999/04
2244

Visualization technology in medical education
Gorbis, S., Hallgren, R. C.
Journal of Osteopathic Medicine, 1999/04
Free full text
2245

We stand on the shoulders of giants in our profession! What do we see?
Heath, D. M., Kelso, A. F.
The AAO Journal, 1999/03
Free full text
2246

So you want to be an ... osteopath
Hocking, J.
Nursing Times, 1999/03
2247

The management of low back pain: Short leg syndrome/postural balance
Nelson, K. E.
The AAO Journal, 1999/03
Free full text
2248

The principles of osteopathic structural therapy – Part IV
Page, L. E.
The AAO Journal, 1999/03
Free full text
2249

A model for teaching and assessing high velocity low amplitude thrust techniques
Wells, K.
The AAO Journal, 1999/03
Free full text
2250

Is human cerebrospinal fluid reabsorbed by lymph? Lymph drainage therapy (LDT) and manual drainage of the central nervous system
Chikly, B.
The AAO Journal, 1998/12
Free full text
2251

The Early History of Osteopathy
Dowling, D. J.
The AAO Journal, 1998/12
Free full text
2252

Evolving Strategies for Management of Various Musculoskeletal Disorders: Evidence-Based Approaches and Beyond
Gilliar, W. G.
The AAO Journal, 1998/12
Free full text
2253

How does our profession get 100,000 cases of influenza reported?
Heath, D. M., Kelso, A. F.
The AAO Journal, 1998/12
Free full text
2254

A century of radiology in osteopathic healthcare
Rosenbaum, R. R.
Journal of Osteopathic Medicine, 1998/12
Free full text
2255

The evolution of professional identity: the case of osteopathic medicine
Miller, K.
Social Science & Medicine, 1998/12
2256

The principles of osteopathic structural therapy – Part III
Page, L. E.
The AAO Journal, 1998/12
Free full text
2257

Women's health osteopathy: an alternative view
Hyne, J.
Nursing Management, 1998/12
2258

Scoliosis and Osteopathic Manipulative Treatment
Weatherly, J.
The AAO Journal, 1998/12
Free full text
2259

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text
2260

Dual approval of a residency program: ten years' experience and implications for postdoctoral training
Hayes, O. W.
Journal of Osteopathic Medicine, 1998/11
Free full text
2261

Truth in science
Heath, D. M., Kelso, A. F.
The AAO Journal, 1998/09
Free full text
2262

L'ostéopathie et la chiropraxie.
(Osteopathy and chiropractic)
Klein, P.
Revue médicale de Bruxelles, 1998/09
2263

Integrating cranial osteopathy with gnathologic orthopedics
Kennedy, J. M.
The Journal - American Academy of Gnathologic Orthopedics, 1998/09
2264

The origin and relief of common pain
Irvin, R. E.
Journal of Back and Musculoskeletal Rehabilitation, 1998/09
2265

The principles of osteopathic structural therapy – Part II
Page, L. E.
The AAO Journal, 1998/09
Free full text
2266

Scalene entrapment syndrome
Royder, J. O.
The AAO Journal, 1998/09
Free full text
2267

Dysfunction of the 'sacred' sacrum – Techniques for treating individual pole restrictions
Wells, K.
The AAO Journal, 1998/09
Free full text
2268

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text
2269

S.T.A.R.: A more viable alternative descriptor system of somatic dysfunction
Dowling, D. J.
The AAO Journal, 1998/06
Free full text
2270

Osteopathic Clinical Research Communications
Heath, D. M., Kelso, A. F.
The AAO Journal, 1998/06
Free full text
2271

Solar Plexus Injuries: An old injury with a new twist
Jones, J. M., May, T.
The AAO Journal, 1998/06
Free full text
2272

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06
2273

The principles of osteopathic structural therapy – Part I
Page, L. E.
The AAO Journal, 1998/06
Free full text
2274

Role of the DOs in the 'Spanish Flu' Pandemic of 1918-1920
Richardson, M. E.
The AAO Journal, 1998/06
Free full text
2275

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05
2276

Muscle energy concepts and coupled motion of the spine
Gibbons, P., Tehan, P.
Manual Therapy, 1998/05
2277

The sword and the scalpel--the osteopathic 'war' to enter the Military Medical Corps: 1916-1966
Gevitz, N.
Journal of Osteopathic Medicine, 1998/05
2278

Dr. Still's Grasp of Truth
Booth, E. R.
The AAO Journal, 1998/03
Free full text
2279

Psychosynergisis®, a synthesis of cranial osteopathy, acupuncture, and homeopathic medicine in psychiatry
Pribadi, K. S.
The AAO Journal, 1998/03
Free full text
2280

Communication for osteopathic manipulative treatment (OMT): the language of lived experience in OMT pedagogy
Gaines, E., Chila, A. G.
Journal of Osteopathic Medicine, 1998/03
2281

The medical school curriculum for the 21st century
Wood, D. L., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/02
2282

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02
2283

A compilation of the thoughts of George W. Northup, DO, on the philosophy of osteopathic medicine
Peterson, B.
Journal of Osteopathic Medicine, 1998/01
2284

Positional release techniques in the treatment of muscle and joint dysfunction
Chaitow, L.
Clinical Bulletin of Myofascial Therapy, 1998/01
2285

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01
2286

The basic principles of osteopathic practice
Hollis, A. S.
The AAO Journal, 1997/12
Free full text
2287

The sacrum: A bone of contention
Nelson, K. E.
The AAO Journal, 1997/12
Free full text
2288

Did D.D. Palmer visit A.T. Still in Kirksville?
Hart, J. F.
Chiropractic History, 1997/12
2289

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text
2290

Anatomy of an OPTI: Part I. Form, function, and relationships
Meyer, C. T., Mann, M. P., Riley, C., Portanova, R.
Journal of Osteopathic Medicine, 1997/10
Free full text
2291

Osteopathic manifesto. X. The distinctive difference. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/10
Free full text
2292

Managing back pain in general practice--is osteopathy the new paradigm?
Williams, N.
British Journal of General Practice, 1997/10
Free full text
2293

The silver thread – The perennial aspect of osteopathic thought
Comeaux, Z. J.
The AAO Journal, 1997/09
Free full text
2294

Andrew Taylor Still, M.D.: founder of osteopathy
Burns, S. B., Burns, J. L.
The Journal of Alternative and Complementary Medicine, 1997/09
2295

Osteopathic manifesto. IX. What about our distinctiveness? 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/09
Free full text
2296

Pondering the effects of the Reconciliation Budget law on osteopathic medical education
Wood, D. L.
Journal of Osteopathic Medicine, 1997/09
Free full text
2297

The art of osteopathy
Wales, A. L.
The AAO Journal, 1997/09
Free full text
2298

Osteopathic manifesto. VIII. Our distinct image. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/08
Free full text
2299

The controversy of cranial bone motion
Rogers, J. S., Witt, P. L.
Journal of Orthopaedic & Sports Physical Therapy, 1997/08
2300

An osteopathic prescription for medical education reform: Part 2. Specialty mix and community integration
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/08
Free full text
2301

Osteopathic manifesto. VII. Shadows and images. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/07
Free full text
2302

An osteopathic prescription for medical education reform: Part 1. Curriculum and infrastructure
Ross-Lee, B., Wood, D. L., Mann, D. D., Portanova, R. P., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/07
Free full text
2303

Osteopathic research: A challenge to the specialist
Eisenhart, A. W.
The AAO Journal, 1997/06
Free full text
2304

Fluid hydraulics in human physiology
Royder, J. O.
The AAO Journal, 1997/06
Free full text
2305

Osteopathic manifesto. VI. The light of the profession. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/06
Free full text
2306

Looking at the whole. Osteopathic health care in Michigan
Peters, B.
Michigan Health & Hospitals, 1997/06
2307

Introducing the cranial approach in osteopathy and the treatment of infants and mothers
Sullivan, C.
Complementary Therapies in Nursing and Midwifery, 1997/06
2308

Muscle tones
Waldron, B. J.
The AAO Journal, 1997/06
Free full text
2309

From 'Osteopathic Manipulative Procedure in Disorders of the Eye'
Wolf, A. H.
The AAO Journal, 1997/06
Free full text
2310

Repositioning maneuver for benign paroxysmal positional vertigo (BPPV)
Brooks, J. G., Abidin, M. R.
Journal of Osteopathic Medicine, 1997/05
Free full text
2311

Osteopathic medical considerations of reflex sympathetic dystrophy
Nelson, K. E.
Journal of Osteopathic Medicine, 1997/05
Free full text
2312

Osteopathic manifesto. V. Legislative and legal vigilance. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/05
Free full text
2313

MDs & DOs. Allopaths and osteopaths have learned to coexist
BeSaw, L.
Texas Medicine, 1997/04
2314

Osteopathic manifesto. IV. The search. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/04
Free full text
2315

Soft tissue manipulation: neuromuscular and muscle energy techniques
Roberts, B. L.
Journal of Neuroscience Nursing, 1997/04
2316

Interlinear thinking: Are we thinking osteopathy?
Heath, D. M.
The AAO Journal, 1997/03
Free full text
2317

'Visible and recognized': osteopathic invisibility syndrome and the two percent solution
Gevitz, N.
Journal of Osteopathic Medicine, 1997/03
Free full text
2318

Osteopathic manifesto. III. The beginning or the end. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/03
Free full text
2319

Osteopathic manifesto. I. Introduction. II. The roots. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/02
Free full text
2320

Osteopathic physicians and expert medical testimony
McAbee, G. N.
Journal of Osteopathic Medicine, 1997/01
Free full text
2321

Research lacking in osteopathic medical profession
Wood, D. L.
Journal of Osteopathic Medicine, 1997/01
Free full text
2322

Planning research on ambulatory care
Heath, D. M., Kelso, A. F.
The AAO Journal, 1996/12
Free full text
2323

From Principles of Osteopathy
Page, L. E.
The AAO Journal, 1996/12
Free full text
2324

AOA continuing medical education
MacPherson, S. B., Rodgers, D. J.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2325

Osteopathic graduate medical education
Bronersky, V. M., Falbo, P. W.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2326

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2327

Research programs of the AOA and their role in osteopathic medical education
Retz, K. C., McGill, S. L.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2328

Income and expenditures of osteopathic medical colleges
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2329

Undergraduate osteopathic medical education
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2330

Certification of osteopathic physicians
Glatz, L., Dolan, S.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2331

Osteopathic medical education: the introduction of managed care principles into our undergraduate curriculum
Musser, A. E., Vinn, N.
The Journal of the American Osteopathic Association, 1996/10
Free full text
2332

A manipulative technique of Andrew Taylor Still as reported by Charles Hazzard, DO, in 1905
Van Buskirk, R. L.
The Journal of the American Osteopathic Association, 1996/10
Free full text
2333

Results of the 1996 National Resident Matching Program: family practice
Kahn, N. B., Jr., Garner, J. G., Schmittling, G. T., Ostergaard, D. J., Graham
Family Medicine, 1996/09
2334

Transforming osteopathic medical education
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/08
Free full text
2335

Factitious disorders and the 'professional patient'
Lande, R. G.
The Journal of the American Osteopathic Association, 1996/08
Free full text
2336

Craniosacral therapy
Elsdale, B.
Nursing Times, 1996/07
2337

Osteopathic manipulative treatment applications for the emergency department patient
Paul, F. A., Buser, B. R.
The Journal of the American Osteopathic Association, 1996/07
Free full text
2338

The Effects of Somatic Dysfunction on the Spinal Accessory Nerve (CN XI) with Subsequent Distal Dysfunction
Gorbis, S.
The AAO Journal, 1996/06
Free full text
2339

Outcome Research on Health Care in Ambulatory Care Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 1996/06
Free full text
2340

An Osteopathic Approach to HIV/AIDS
Mulligan, T.
The AAO Journal, 1996/06
Free full text
2341

Fighting the odds in the UK
Richmond, C.
Canadian Medical Association Journal, 1996/05
2342

(Diagnosis and therapy for reversible hypomobile dysfunction in the chest wall)
Neumann, H.D.
Manuelle Medizin, 1996/04
2343

Ambulatory care training standards for continuity of care in osteopathic family medicine
Winters, F. D., Zonia, S., Cook, J. N., Dora, D. L., Meyer, C. T.
The Journal of the American Osteopathic Association, 1996/04
Free full text
2344

The osteopathic physician teacher
Grimshaw, D. N.
The AAO Journal, 1996/03
Free full text
2345

A functional approach to heel lift therapy
Johnson, K. H.
The AAO Journal, 1996/03
Free full text
2346

Curriculum goals for the training of osteopathic family practice residents for the year 2000
Dickerman, J., Rich, P.
The Journal of the American Osteopathic Association, 1996/03
Free full text
2347

Osteopathy and medical evolution (1962)
Korr, I. M.
The AAO Journal, 1996/03
Free full text
2348

Sacral shear: Review and a new treatment for obstetrical patients
Treadwell, R. C., Magnus, W. W.
The AAO Journal, 1996/03
Free full text
2349

Update on osteopathic medical concepts and the lymphatic system
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 1996/02
Free full text
2350

Studying the impact of women on osteopathic physician workforce predictions
Simpson, M. A., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/02
Free full text
2351

(Manual therapy, chiropractic, osteopathy. From alternative therapy to medicine)
Ylinen, J., Piispanen, J., Silen, K., Airaksinen, O.
Duodecim, 1996/01
2352

Structural and Hormonal Influences on Pelvic Mechanics in Labor and Delivery
Tettambel, M. A.
The AAO Journal, 1995/12
Free full text
2353

Osteopathic postdoctoral training institution: the osteopathic 'road map' to graduate medical education viability
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/11
Free full text
2354

Medical licensure for osteopathic physicians in Louisiana: why the State Board of Medical Examiners should accept the NBOME
Bellemare, N. A.
The Journal of the Louisiana State Medical Society, 1995/10
2355

OMM Residency Training and Certification
Ettlinger, H., Pelkey, Z.
The AAO Journal, 1995/09
Free full text
2356

Hospital guidelines for diagnosis-related groups/osteopathic manipulative treatment
Feely, R. A.
The Journal of the American Osteopathic Association, 1995/09
Free full text
2357

The Nature of Fascia and the Role of Lower Extremity Fascia in Low Back Pain
Hessler, D. D.
The AAO Journal, 1995/09
Free full text
2358

From 'Practical Visions'
Millard, F. P.
The AAO Journal, 1995/09
Free full text
2359

Three-Dimensional Counterstrain Lifts (3-DCL) Theoretical Concept and Applications
Carlson, J. A., Carlson, J. M., Earl, D. T.
The AAO Journal, 1995/06
Free full text
2360

Axoplasmic Transport
Dott, G. A.
The AAO Journal, 1995/06
Free full text
2361

A standardized form for DSM-IV review of symptoms and mental status examination for students and residents
Reeves, R. R., Bullen, J. A.
The Journal of the American Osteopathic Association, 1995/06
Free full text
2362

Continuum Technique
Typaldos, S.
The AAO Journal, 1995/06
Free full text
2363

The Experimental Method of Learning
Young, M. D.
The AAO Journal, 1995/06
2364

Nerve compression syndromes as models for research on osteopathic manipulative treatment
Luckenbill-Edds, L., Bechill, G. B.
The Journal of the American Osteopathic Association, 1995/05
Free full text
2365

Making sense of federal GME reforms: the need for secondary reforms
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/05
Free full text
2366

Emphasizing a preventive medicine orientation during primary care/family practice residency training
Inwald, S. A., Winters, F. D.
The Journal of the American Osteopathic Association, 1995/04
Free full text
2367

Making sense of federal GME reforms: the impact on osteopathic medicine
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/04
Free full text
2368

Challenges and opportunities in occupational medicine
McCunney, R. J.
The Journal of the American Osteopathic Association, 1995/02
Free full text
2369

Postnatal back care
Parsons, C.
The Modern Midwife, 1995/02
2370

A model for improving generalist physician output: the osteopathic experience
Cummings, M., Ennis, M.
Academic Medicine, 1995/01
Free full text
2371

A perspective from osteopathic medical schools
Arnstein, S. R., Haspel, L. U.
The Milbank Quarterly, 1994/12
Free full text
2372

Thank you, Mr Shaw
Pheils, M. T.
British Medical Journal, 1994/12
2373

Triggerband Technique
Typaldos, S.
The AAO Journal, 1994/12
Free full text
2374

A Hypothesis for the Facilitated Segment Based Upon Biological Principles Associated with Tumorigenesis
Yonuschot, G., Mokler, J., Winterson, B. J.
The AAO Journal, 1994/12
Free full text
2375

The danger of complacency
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/11
Free full text
2376

Colleges of Osteopathic Medicine
The Journal of the American Osteopathic Association, 1994/11
Free full text
2377

Membership of AOA Committees on Osteopathic Medical Education 1994-1995
The Journal of the American Osteopathic Association, 1994/11
Free full text
2378

Overview of financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1994/11
Free full text
2379

An osteopathic cardiologist's review of hypertension: beyond the Fifth Report of the Joint National Committee on Detection, Evaluation, and Treatment of High Blood Pressure
Williams, A. M.
The Journal of the American Osteopathic Association, 1994/10
Free full text
2380

Management of the Cervical Area
Denslow, J. S.
The AAO Journal, 1994/09
Free full text
2381

Ohio doc with ties to Caremark faces kickback charges
Burns, J.
Modern Healthcare, 1994/09
2382

The Cranial Rhythmic Impulse and Headache: A Synthesis for Clinicians and Scientists Working Toward Mutual Education
Lipton, J. A.
The AAO Journal, 1994/09
Free full text
2383

Entry of US medical school graduates into family practice residences: 1993-1994 and 3-year summary
Kahn, N. B., Jr., Schmittling, G., Graham
Family Medicine, 1994/09
2384

Results of the 1994 National Resident Matching Program: family practice
Kahn, N. B., Jr., Schmittling, G., Ostergaard, D. J., Graham
Family Medicine, 1994/09
2385

Clinical practice guidelines: a review
Hayes, O. W.
The Journal of the American Osteopathic Association, 1994/09
Free full text
2386

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text
2387

Differential evolution of the osteopathic and chiropractic professions in the United States
Wardwell, W. I.
Perspectives in Biology and Medicine, 1994/08
2388

Effect of clerkship training at rural sites on students' clinical skills
Brandau, D., Heun, L.
Academic Medicine, 1994/08
Free full text
2389

The outlook for osteopathic medical specialists within a reformed healthcare system
Ross-Lee, B., Weiser, M. A., Kiss, L.
The Journal of the American Osteopathic Association, 1994/07
Free full text
2390

Cranio-sacral therapy and the treatment of common childhood conditions
Attlee, T.
Health Visitor, 1994/07
2391

Managed care and graduate medical education: mutual objectives, barriers, and prospects
Natkow, N., Fry, L. J.
The Journal of the American Osteopathic Association, 1994/07
Free full text
2392

Complexity of the healthcare crisis in rural America
Simpson, C., Simpson, M. A.
The Journal of the American Osteopathic Association, 1994/06
Free full text
2393

A Tensegrity Model for Osteopathy in the Cranial Field
Cummings, C. H.
The AAO Journal, 1994/06
Free full text
2394

Stranger in a New Land
Mills, M.
The AAO Journal, 1994/06
Free full text
2395

Introducing the Fascial Distortion Model
Typaldos, S.
The AAO Journal, 1994/06
Free full text
2396

Quality of Care: An Assessment of the Contributions of Osteopathic Medicine
Chila, A. G.
The AAO Journal, 1994/06
Free full text
2397

Specialty-oriented internships
Opipari, M. I.
The Journal of the American Osteopathic Association, 1994/06
Free full text
2398

State healthcare reform: an arena for the osteopathic medical profession's influence
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/05
Free full text
2399

Alternative medicine in the United States
Wardwell, W. I.
Social Science & Medicine, 1994/04
2400

'Parallel and distinctive': the philosophic pathway for reform in osteopathic medical education
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/04
Free full text
2401

Craniomandibular/temporomandibular/cervical implications of a forced hyper-extension/hyper-flexion episode (i.e., whiplash)
O'Shaughnessy, T.
The Functional Orthodontist, 1994/04
2402

Preparing the osteopathic academic health centers for healthcare reform
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/04
Free full text
2403

An Osteopathic Approach to Treating Chondromalacia-Patellae with Counterstrain Manipulation
Haman, J. L.
The AAO Journal, 1994/03
Free full text
2404

Opportunities and Issues for Osteopathic Hospitals
The AAO Journal, 1994/03
Free full text
2405

Transfusion of blood contaminated by HIV raises consent issues. Jones v. Philadelphia College of Osteopathic Medicine
Hospital Law Newsletter, 1994/03
2406

Manual Medicine and its Role in Psychiatry
Osborn, G. G.
The AAO Journal, 1994/03
Free full text
2407

Osteopathy – How It Differs from Other Manual Methods
Woodall, P. H.
The AAO Journal, 1994/03
Free full text
2408

Medicaid reform: an opportunity for the osteopathic medical profession
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/03
Free full text
2409

Managed care: an opportunity for osteopathic physicians
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/02
Free full text
2410

Danger and safety in medicines
O'Neill, A.
Social Science & Medicine, 1994/02
2411

Osteopathic manipulative treatment: what does it really do?
Steiner, C.
The Journal of the American Osteopathic Association, 1994/01
Free full text
2412

The primary medicine initiative--continuity in medical education
Wood, D. L.
The Journal of the American Osteopathic Association, 1994/01
Free full text
2413

A Description of the Common Compensatory Pattern in Relationship to the Osteopathic Postural Examination
DeFeo, G. A., Hicks, L. V.
The AAO Journal, 1993/12
Free full text
2414

Definitions of Osteopathy as a School of Medicine
McCole, G. M.
The AAO Journal, 1993/12
Free full text
2415

The osteopathic distinction: fact or fancy?
Peppin, J. F.
The Journal of Medical Humanities, 1993/12
2416

Crafting effective internal memos
Baker, H. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text
2417

Health Care Hall of Fame 1993 inductees: each a legendary reformer. Clara Barton; Graham Davis; William Graham; Andrew Still, D.O.; Robert Toomey
Modern Healthcare, 1993/11
2418

Important characteristics of a director of medical education
Powell, V. D., Jr., George
The Journal of the American Osteopathic Association, 1993/11
Free full text
2419

Financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1993/11
Free full text
2420

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text
2421

We Need National Health – Not National Health Insurance
Clark, R. C.
The AAO Journal, 1993/09
Free full text
2422

The Lesion
Hulett, G. D.
The AAO Journal, 1993/09
Free full text
2423

Entry of US medical school graduates into family practice residencies: 1992-1993 and three-year summary
Kahn, N. B., Jr., Graham, R., Schmittling
Family Medicine, 1993/09
2424

Teaching residents to write a research paper
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1993/09
Free full text
2425

Complementary medicine. Osteopathy
Trevelyan, J.
Nursing Times, 1993/08
2426

Die vergessenen Gutachten über die Chiropraktik
(Forgotten expertise about chiropractic)
Geiser, M.
Schweizerische Rundschau für Medizin Praxis, 1993/08
2427

The HIV-infected house officer: residency training issues
Fernandez, E. S., Troutman, H. T., Herbert, B., Condoluci, D. V.
The Journal of the American Osteopathic Association, 1993/08
Free full text
2428

Type “O“ disorders
Walker, B. F.
COMSIG Review, 1993/07
Free full text
2429

Pioneer Women in Medicine
Carlton, C.
The AAO Journal, 1993/06
Free full text
2430

'Blueprint' for creating classroom facilities in teaching hospitals
Hayes, O. W.
The Journal of the American Osteopathic Association, 1993/06
Free full text
2431

Research secures the future of osteopathic medicine: Part 2: Readdressing the function and structure of colleges of osteopathic medicine
Papa, F. J.
The Journal of the American Osteopathic Association, 1993/06
Free full text
2432

Research secures the future of osteopathic medicine: Part 1. Research--foundation for faculty development, institutional recognition
Papa, F. J.
The Journal of the American Osteopathic Association, 1993/05
Free full text
2433

Arranging affiliation agreements and outside rotations
Willard, R. L.
The Journal of the American Osteopathic Association, 1993/04
Free full text
2434

Support of collaborative practice
Kuehn, A. F.
The Missouri Nurse, 1993/04
2435

Osteopathy--an aid to the healing process
Waldman, P.
Professional Nurse, 1993/04
2436

Shame and the origin of physician-patient conflict
Martin, J. T.
The Journal of the American Osteopathic Association, 1993/04
Free full text
2437

Osteopathic medicine: a call for reform
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/04
Free full text
2438

The Centennial Celebration: The Crime of the Century
Baker, J. T.
The AAO Journal, 1993/03
Free full text
2439

Thoracic outlet syndrome--a myofascial variant: Part 3. Structural and postural considerations
Sucher, B. M., Heath, D. M.
The Journal of the American Osteopathic Association, 1993/03
Free full text
2440

Integrating OMT Into The Hospital Setting
Jones, L. B.
The AAO Journal, 1993/03
Free full text
2441

Researching the Effectiveness of Osteopathic Health Care in Practice: Agency for Health Care Policy and Research Plans
Kelso, A. F.
The AAO Journal, 1993/03
Free full text
2442

Primary & Secondary Respiration – Part II
Lee, R. P.
The AAO Journal, 1993/03
Free full text
2443

Osteopathie
(Osteopathy)
Beck, M.
Deutsche Krankenpflegezeitschrift, 1993/03
2444

Assessing outcomes of the educational program of the West Virginia School of Osteopathic Medicine
Cope, M. K., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text
2445

Procedures to follow when dismissing an intern or resident
Opipari, M., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text
2446

Early osteopathy gives best results
Nursing Standard, 1993/02
2447

An approach to training and retaining primary care physicians in rural Appalachia
Roberts, A., Foster, R., Dennis, M., Davis, L., Wells, J., Bodemuller, M. F., Bailey, C. A.
Academic Medicine, 1993/02
Free full text
2448

Managing substance use disorders in resident physicians
Benzer, D. G.
The Journal of the American Osteopathic Association, 1993/02
Free full text
2449

Clinical teaching in the ambulatory care setting: how to capture the teachable moment
Bowling, J. R.
The Journal of the American Osteopathic Association, 1993/02
Free full text
2450

Skin manifestations of human immunodeficiency virus (HIV): Part 2. Noninfectious skin manifestations
Kurgis, B. S.
The Journal of the American Osteopathic Association, 1993/02
Free full text
2451

Integrate osteopathic principles and practices in postgraduate medical education--now
Kasovac, M., Jones, J. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text
2452

Manual therapy: a critical assessment of role in the profession of physical therapy
Farrell, J. P., Jensen, G. M.
Physical Therapy, 1992/12
2453

Patient Education Is Vital to Osteopathy's Future
Jones, L. B.
The AAO Journal, 1992/12
Free full text
2454

The crisis in osteopathic medicine
Meyer, C. T., Price, A.
Academic Medicine, 1992/12
2455

Primary & Secondary Respiration – Part I
Lee, R. P.
The AAO Journal, 1992/12
Free full text
2456

Integrating Osteopathic Medicine into the Second 100 Years
O'Connell, J. A.
The AAO Journal, 1992/12
Free full text
2457

Anatomy, Asthma and Dysautonomia
Sanders, E. C.
The AAO Journal, 1992/12
Free full text
2458

Four approaches to using patients to teach and evaluate clinical skills of residents, interns, and students
Medio, F. J., Morewitz, S. J.
The Journal of the American Osteopathic Association, 1992/11
Free full text
2459

Continuing Osteopathic Research in New Zealand
Carruthers, R.
The AAO Journal, 1992/09
Free full text
2460

Mississippi State Board of Medical Licensure annual report July 1, 1990 through June 30, 1991
Morgan, F. J.
Journal of the Mississippi State Medical Association, 1992/09
2461

Manuelle Medizin an der Wirbelsäule--Indikation, diagnostische und therapeutische Möglichkeiten.
(Manual medicine of the spine--indication, diagnostic and therapeutic possibilities)
Kissling, R. O., Hochstrasser, R., Kubli, D.
Schweizerische Rundschau für Medizin Praxis, 1992/09
2462

Strategy for Addressing Third Party Payors on OMT
O'Connell, J. A.
The AAO Journal, 1992/09
Free full text
2463

Challenge to osteopathic education. Returning to its primary care roots
Cummings, M.
JAMA: The Journal of the American Medical Association, 1992/09
2464

Graduate medical education
JAMA: The Journal of the American Medical Association, 1992/09
2465

The evolution of osteopathic manipulative technique: the Spencer technique
Patriquin, D. A.
The Journal of the American Osteopathic Association, 1992/09
Free full text
2466

Suggestions for clinicians providing--and residents seeking--feedback
Sprafka, S.
The Journal of the American Osteopathic Association, 1992/08
Free full text
2467

One doctor's Rx for the recession
Rice, B.
Medical Economics, 1992/08
2468

Will Your Recipe Even Be In The Cookbook?
Ammann-Hasbrouck, L.
The AAO Journal, 1992/06
Free full text
2469

Is Osteopathic Education Ready For Its Next Century?
Corbett, S. R.
The AAO Journal, 1992/06
Free full text
2470

College of Podiatric Medicine and Surgery in Des Moines
Tomczak, R. L.
Journal of the American Podiatric Medical Association, 1992/06
Free full text
2471

Somatic Dysfunction: A Neurophysiologic & Osteopathic Overview
Tsompanidis, A. J.
The AAO Journal, 1992/06
Free full text
2472

Recruiting interns and residents to an osteopathic medical training program
Slick, G. L.
The Journal of the American Osteopathic Association, 1992/05
Free full text
2473

Revamped osteopathic hospital group flourishing
Burda, D.
Modern Healthcare, 1992/05
2474

Training osteopathic medical students in behavioral medicine and psychiatry
Magen, J.
The Journal of the American Osteopathic Association, 1992/05
Free full text
2475

(Diseases of the autonomic nervous system. General aspect of symptomatology)
Takahashi, A., Hasegawa, Y., Kihara, M., Nakao, N.
Nihon Rinsho, 1992/04
2476

Osteopathy: the 'orthodox' alternative
Kaye, J.
Occupational Health, 1992/04
2477

Osteopathy: the 'orthodox' alternative
Kaye, J.
Occupational Health, 1992/04
2478

Laterally transposed pelvis: a new and proper name for an old problem
Patriquin, D. A.
The Journal of the American Osteopathic Association, 1992/04
Free full text
2479

Osteopathic Research in New Zealand
Carruthers, R.
The AAO Journal, 1992/03
Free full text
2480

The medical education system in Oklahoma
Lapolla, M., Duffy, D., Lewis, C. S.
The Journal of the Oklahoma State Medical Association, 1992/03
2481

An Integrated Approach for Treating the OB Patient: Treating the Five Diaphragms of the Body, Part II
Johnson, K.
The AAO Journal, 1992/03
Free full text
2482

Osteopathy & Chronic Pain
Miller, T. D.
The AAO Journal, 1992/03
Free full text
2483

Case presentation as a teaching tool: making a good thing better
Brose, J. A.
The Journal of the American Osteopathic Association, 1992/03
Free full text
2484

Observations on A. T. Still
Willard, A.
The AAO Journal, 1992/03
Free full text
2485

'Blueprint' for designing a curriculum for intern and residency programs
Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 1992/02
Free full text
2486

A curriculum database with boolean natural-language searching in HyperCard
Mann, D., Goodrum, K., DeWine, J. M., McVicker, J.
Proceedings Annual Symposium on Computer Application in Medical Care, 1992/01
Free full text
2487

OLIO+: an osteopathic medicine database
Woods, S. E.
Medical Reference Services Quarterly, 1991/12
2488

Cranial Osteopathy: A New Perspective
Ferguson, A.
The AAO Journal, 1991/12
Free full text
2489

Let's Return to the Basics
Heatherington, J. S.
The AAO Journal, 1991/12
Free full text
2490

An Integrated Approach for Treating the OB Patient: Treating the Five Diaphragms of the Body, Part I
Johnson, K.
The AAO Journal, 1991/12
Free full text
2491

Evaluation of Managed Care Contracting
Schnack, T. H.
The AAO Journal, 1991/12
Free full text
2492

US osteopathic medical school finances
Reich, M. M.
The Journal of the American Osteopathic Association, 1991/11
Free full text
2493

A tissue pressure model for palpatory perception of the cranial rhythmic impulse
Norton, J. M.
The Journal of the American Osteopathic Association, 1991/10
Free full text
2494

The Tightrope Walk of Osteopathy
Ferguson, A.
The AAO Journal, 1991/09
Free full text
2495

Pathophysiologic Models: Aids to the Selection of Manipulative Techniques
Hruby, R. J.
The AAO Journal, 1991/09
Free full text
2496

Who Will Hatch Our Students?
Morey, L.
The AAO Journal, 1991/09
Free full text
2497

A proposal to modify research and scholarly activities during osteopathic residency training
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1991/09
Free full text
2498

Osteopathic Medicine: A Century Old Prophesy of Modern Health, Nutrition and Exercise Principles
Ramirez, M. A., Spillman, D. M., Lipnickey, S. C.
The AAO Journal, 1991/06
Free full text
2499

Clinical Findings in the Suspect Patient with Low Back Pain
Teitelbaum, D.
The AAO Journal, 1991/06
Free full text
2500

Cranial osteopathy
Holmes, P.
Nursing Times, 1991/05
2501

An alternative method of teaching strain/counterstrain manipulation
Woolbright, J. L.
The Journal of the American Osteopathic Association, 1991/04
Free full text
2502

Nursing practice in an osteopathic community
Flarey, D. L.
Nursing Administration Quarterly, 1991/03
2503

Why The Osteopathic Profession Needs a Triple By-Pass In Order to Survive
Jones, L. B.
The AAO Journal, 1991/03
Free full text
2504

A Report to the Statutory Advisory Committee on Medical Care: Craniosacral Manipulation
Lee, R. P.
The AAO Journal, 1991/03
Free full text
2505

Anatomic Metaphors: Clues to the Emotions of Our Patients
Teitelbaum, D.
The AAO Journal, 1991/03
Free full text
2506

Osteopathic research: the needed paradigm shift
Korr, I. M.
The Journal of the American Osteopathic Association, 1991/02
Free full text
2507

Osteopathic medicine
Eaton, J. A., Bates, B. P., Willard, F. H.
Orthopaedic Nursing, 1991/01
Free full text
2508

The sociopolitical development of British chiropractic
Baer, H. A.
Journal of Manipulative and Physiological Therapeutics, 1991/01
2509

Osteopathic medicine and primary care practice: plan or serendipity?
Melnick, A.
Academic Medicine, 1990/12
2510

Osteopathic postdoctoral education
Baker, H. H., Wachtler, J.
The Journal of the American Osteopathic Association, 1990/11
Free full text
2511

Research programs of the AOA and their role in osteopathic education
Retz, K. C.
The Journal of the American Osteopathic Association, 1990/11
Free full text
2512

L'ostéopathie crânienne, leurre ou realité?
(Cranial osteopathy, delusion or reality?)
Ferré, J. C., Chevalier, C., Lumineau, J. P., Barbin, J. Y.
Actualités odonto-stomatologiques, 1990/09
2513

Osteopathic medicine: the profession's role in society
Korr, I. M.
The Journal of the American Osteopathic Association, 1990/09
Free full text
2514

A model of cooperation between complementary and allopathic medicine in a primary care setting
Budd, C., Fisher, B., Parrinder, D., Price, L.
British Journal of General Practice, 1990/09
2515

Scott Memorial lecture: the challenge of change
Greenman, P. E.
The Journal of the American Osteopathic Association, 1990/08
Free full text
2516

Louisa Burns memorial lecture: research in residencies
Belsky, D. H.
The Journal of the American Osteopathic Association, 1990/07
Free full text
2517

Quality assurance monitoring of osteopathic manipulative treatment
Koss, R. W.
The Journal of the American Osteopathic Association, 1990/05
Free full text
2518

The Century Club: a model for staff-supported medical education
Meyer, C. T.
The Journal of the American Osteopathic Association, 1990/05
Free full text
2519

The pull toward the vacuum: osteopathic medical education in the 1980s
Cummings, M.
The Journal of the American Osteopathic Association, 1990/04
Free full text
2520

General practice residency training and the osteopathic profession: trends and issues for the 1990s
Aquilina, A. D.
The Journal of the American Osteopathic Association, 1990/02
Free full text
2521

War, politics, and osteopathic medicine
Goldstein, M.
The Journal of the American Osteopathic Association, 1990/02
Free full text
2522

Controversies in temporomandibular joint disorder
Ramer, E.
The Dental Clinics of North America, 1990/01
2523

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12
 
 
 






  • Impressum • Legal notice • Datenschutz •


ostlib.de/advanced



Supported by

OSTLIB recommends