Advanced search



 
 82.7% of the records
 
 17.3 % of the records
 
 55.7 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Medically Underserved Area*Osteopathic Medicine*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabducens nerveabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsolute alpha powerabstractabstractsacademicacademic barrieracademic difficultiesacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic surgeryacademies and institutesacademy of osteopathyaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive release techniqueactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadmissionadmission criteriaadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced trainingadvancing TBI careadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective empathyaffective touchafferenceAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcoholismalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltingAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappraisalsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismArcticarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory test foilartifical intelligenceartificial jointartificial respirationartificial ventilationartilcleartsartticleasanaaspirationassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical swallowingaudiovisual aidsauditory canalauditory channelauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawards and prizesawarenessawareness of spaceaxesaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberinebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioenergetic modelbioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumabladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood supplyblood systemblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrand disputeBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksC-reactive proteinC-tactileC-tactile afferentsC. BowlesC. DoveC. J. Smutny IIIC. S. GonsteadC. SteeleC. WeaverC1cability crisiscadavercadaver dissectioncadaveric dissectioncadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciumcalfCaliforniacaloric restrictioncalot’s triangleCAMCanadaCanadiancanal syndromecancercancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecarbon dioxidecarbon emissionscarcinoid tumorcarcinomacardiac arrestcardiac frequencycardiac implantable electronic devicecardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase reportcase reportscase seriescase studycase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicothoracic diaphragmcervicothoracic junctioncesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wall defectchewingChiari I malformationChicagoChicago College of Osteopathic Medicinechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communitychinese medicinechinese traditional medicinechiropracticchiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclavicleclavicle fractureCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoituscold temperaturecoliccolitis ulcerosacollaborationcollagencollagen fiberscollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasesColoradocolorectal endometriosisCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phasecongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontol interventionscontraceptive carecontract governing medical treatmentcontractilitycontractioncontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapycooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilitycostal cartilagescostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial volumecranial-sacral-motioncraniocranio sacral osteopathycranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutionculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniquecybernetic systemcyberneticscynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. HerbertD. J. ClauwD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latadeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdeglutition disordersdegreesdehydrationdelayed developmentdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissolutiondistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational resourceeducational standardseducational statuseducational technologyeducational toolsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30elastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselbowelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic fieldselectromagnetic interactionelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyempirical approachempirical evidenceempirical researchempiricismemployee disciplineemployment disabilityemu oilenactivismencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineEpley maneuverEpstein-Barr virusEQ-5Dequilibriumeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerythrocyte counterythrocytesesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidenced based osteopathyeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitionexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocular musclesextrinsic sleep disorderseyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial structurefacial tumorsfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitationfactfactor analysisfactual databasesfacultyfaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyfast fourier transformfastingfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst trimester pregnancyfirst year of lifefirst-choice residencyfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexion distraction techniqueflexion rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot lesionsfoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionfracture healingfracturesFraminghamFranceFrankfurt DeclarationFred Mitchellfree energy principlefree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency-tuningfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principlefulcrumfull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilityGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenetic mutationgeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenomicsgentlenessgeodesicgeographic factorsGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingivitisgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral jointglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteus maximusglycated hemoglobin Aglycosylationglygoaminoglycansglymphaticglymphatic systemglymphaticsgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaitihallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand painhand strengthhandballhandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharmonic techniqueharmonic therapyHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead painhead positionhead repositioninghead retraction reflexheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare costhealthcare costshealthcare deliveryhealthcare initiativehealthcare needshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity, low-amplitudeHigher educationhiphip arthroplastyhip dislocationhip dysplasiahip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistorical articlehistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organshome carehome exercisehomeless personshomeless populationhomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axishrvHTA-Report 124humanhuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehumanitiesHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourhurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronic acidhydrationhydraulic mechanismhydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogonadismhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueicosahedronICPideal muscle functionidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimage-guided spine interventionimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantationsimpotenceimpotence medicineimpulsein vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationInfrared thermal camerainfrared thermographyinfraspinatusinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninpatientinpatient outcomeinpatient rehabilitationinpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8Interleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternationalityinternetinternet useinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterviewsintestinalintestinal constipationintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra ocular pressureintra- and inter-rater reliabilityintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemic compressionischemic pressureischialgiaIsele-methodisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohnston’s functional methodsjointjoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejoyful discoursejudgmentjugular compressionjumpingjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketorolac tromethaminekeyword searchkidneykidney mobilitykidney motilitykidney stonekidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory testlaboratory valueslabral tearlacerationslack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislarynxLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture seriesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevel of evidencelevels of anxiety and depressionLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdle muscular dystrophylimb injurieslimb placodelimb symmetrylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylorazepamlordosislordotic angleloss of a childloss of childlovelow anorectal malformationlow backlow back injurylow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelunglung capacitylung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusm. piriformism. rectus capitis posterior minorM. WilsonM. Wyvekensmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratesmatched-pair analysismateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatrix-rhythm-therapymattermaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionmediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical graduatesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmelancholic wholenessmelanomaMelicien TettambelmembranesmemorymenMeniere’s diseasemeningesmeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental disordermental disordersmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticameridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetastasismetastatic abdominal cancermetastudiesmethodismmethodological qualitymethodologymethodsmethyl-sulfonyl-methanemethylprednisolonemetronidazoleMFI-20mfrMFT challenge discmiceMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studymobile appsmobile clinicmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMöbius syndromemolar shimmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRImsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle contractilitymuscle contractionmuscle developmentmuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tendernessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal injurymusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathyMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymytonometryN. Mithanaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessneedle biopsyneedlesneeds assessmentnegentropyNelson-Dennyneonatalneonatal abstinence syndromeneonatal hyperbilirubinemianeonatal intensive care unitneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsnephroptosisnerve activitynerve compressionnerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingneumuscular therapyneuracneural canalneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroinflammationneurokinesiologyneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular junctionneuromuscular rehabilitationneuromuscular systemneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuropsychiatric disorderneuropsychological testsneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotransmissionneurotransmitterneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstetic populationobstetric deliveryobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal planeocclusal splintocclusal splint therapyocclusionocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid use disorderopioid-related disordersopioidsopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoral ?uidoral aversionoral cavityoral diagnosisoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan of perceptionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic manipulationorthopedic proceduresorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteochondrosisosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. KimberlyP. MisslinP. Schwindpad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepaintingspalatal disjunctionpalatine bonepaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackspanic disorderspapillomavirus infectionspapillomavirus vaccinesparaesophageal herniaparafunctionparallel accreditationparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentpartient-reported outcomesparturitionpassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpelvicpelvic adhesionspelvic anatomypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centered carepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalguspharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphytotherapyPIC syndromepicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disordersplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespopulation dynamicspopulation healthpopulation surveillanceportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromeposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencypovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-menopausal womenpre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive processingpredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematurepremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologypreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepreserved ejection fraction exacerbationspressurepressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprisonprivate collegesprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsproceduresprocess approachprocessesprocessus styloideusprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studyPROMsprone positionproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapyPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsrctre-findingsre-orientation processreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseasesrespiratory disordersrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumeresponses to treatmentrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoscopyretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroutine examinationroutine findingsroutine physical therapyrowingrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. Typaldossacral basesacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal regionsacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsscalesscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniascholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic neuritissciatic neuropathysciatic painsciaticasciencescientific journalscientific proofscientific publicationscientific researchscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreeningscreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshared decision makingsharing informationsharp painshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-effectsidebendingSIDSsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusskatersskeletalskeletal muscleskiersskiingskillskills transferskinskin blood flow indexskin burning sensationskin cancerskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmokerssmokingsmoking cessationsmoking preventionsmooth musclesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessolar keratosissoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspeakingspecial needs childrenspecializationspecialty boardspecialty boardsspecialty trainingspecific adjustmentspecific laryngeal manipulationspecificityspectroscopyspeechspeech acousticsspeech developmentspeech development disordersspeech disorderspeech disordersspeed of blood flowspelling disordersspencer techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainsSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stephen Tyremanstereoidssterilitysternal painsternal recoil techniquesternotomiesternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoragestrabismstrabismusStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniqueStretchingstretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsStudents, Pharmacystudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubclavian arterysubclavian steal syndromesubcutaneous hemorrhageSubject Headingssubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointSubtle energy measurementsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicidesumatriptanSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperoxide anion radicalssupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessuprarenal gland,supraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurveysSurveys and Questionnairessurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationSynergeticsynostosis sphenooccipitalis,synovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetastwelttattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBI careteachersteachingteaching assistantteaching clinicteaching effectivenessteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteamUP Short-FormteamUP-SFteamworktechnical requirementsTechniquetechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth settingtelemanagementtelemedicinetelemetrytelephonetelescopic bridgeworktemperamenttemperaturetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendonitistendonstenetstennistennis elbowtenotomytensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?TGF-?Thai foot reflex zone massagethai massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical basistheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelsTherapeutic presencetherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal, skin temperaturethermodiagnosisthermographythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree months colicthree-dimensional imagingthree-dimensional printingthroacic transverse processesthroatthrombolytic therapythrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticksticstideTietze syndromeTiffeneau indextilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?tnf-?TNF-atnterpretation analysis comparative studiestobacco use disordertoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstrainingtraining deliverytraining hourstraining programmstraining programstraining requirementstraining supporttranscranial Doppler ultrasonographytranscranial magnetic stimulationtransdisciplinarytransferencetransformation phasestransgendertransgender personstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretrauma-informes caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatically induced lesiontraumatized patientstravelTravell trigger pointstreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerstrimesters of pregnancytrinitytrisomy 21triunetriune mantriune osteopathytriunity Routine-diagnosistroponin itroubles musculo-squelettiquestruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk stabilizationtrunk torsiontrusttruthtruth disclosuretryptaminestuba auditiva techniqueTug navicular techniquetumortumor necrosis factortumor necrosis factor-alphatunnel syndrometurbttutoringtwin pregnancytwinstympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderservedunderserved areaunderserved areasunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionUnified Parkinson Disease Rating Scaleunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beingUniversitiesuniversityuniversity outpatient departmentsunna nevusunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamicsurogenital stage or phallic stageurogenital systemurogenital tracturologic systemurologyurticariaUSAusmleUSMLE scoresUSMLE Step 1usmle step 2uterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvaliditityvalidityvalidity of testsvalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverificationVermontvertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcarewestern worldWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwoman?s organismwomenwomen’s healthworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopworld health organisationWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenZ. ComeauxzenZIMMTzinczinc deficiencyZink modelZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

2076 results (please see below)  Sort:    
1

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06

2

Relational clinical practice: A hermeneutic, enactive, intersubjective model of osteopathy
Banton, A., Vogel, S.
International Journal of Osteopathic Medicine, 2024/03

3

Combating Modern DO Stigmatization
Cooney, A., Vega, L., Goodwin, B. J., Adams, J., Mangrola, F., Price, L. M., Powell, L.
International Journal of Osteopathic Medicine, 2024/03

4

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/03
Free full text

5

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03

6

Introduction to running analysis in the clinical setting: A masterclass
Tripodi, N., Feehan, J., Corcoran, D., Vaughan, B., McLaughlin, P.
International Journal of Osteopathic Medicine, 2024/03
Free full text





11

Funktionelle Anatomie der Interozeption
(Functional anatomy of interoception)
Luthin, D., Neuhuber, W.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

12

Der Schluckakt
(The act of swallowing)
Sergueef, N.
Osteopathische Medizin, 2024/03
Free full text

13

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

14

Aus der digitalen Welt
(From the digital world)
Sonntag, M.
Osteopathische Medizin, 2024/03
Free full text

15

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

16

The Sentient Cell: Implications for Osteopathic Medicine
Bordoni, B., Escher, A. R., Castellini, F., Vale, J.
Cureus, 2024/02
Free full text

17

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/02

18

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text

19

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/02

20

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text


22

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

23

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

24

Das Mundatmungssyndrom in der osteopathischen Praxis
(Mouth breathing syndrome in the osteopathic practice)
Keller, M., Brümmer, M., Schulz, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

25

Mitleid und Mitgefühl
(Pity and compassion)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01


27

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

28

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/01
Free full text

29

A superficial dissection approach to the sphenopalatine (pterygopalatine) ganglion to emphasize osteopathic clinical relevance
Matz, O. C., Rudberg-Post, L. J., Gustafson, H. C., Matz, D. G.
Journal of Osteopathic Medicine, 2024/01
Free full text




33

Psychosomatische Osteopathie
(Psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2023/12

34

Besonderheiten osteopathischer Forschung
(Peculiarities of osteopathic research)
Scheuchl, F., Peuker, E., Kamp, R.
Osteopathische Medizin, 2023/12

35

(Gender competence in medicine and osteopathy)
Wikus, P., Wimpissinger, A.
Osteopathische Medizin, 2023/12

36

Power and capital: In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12



39

(Features of the state of occlusion with partial loss of teeth (literature review))
Zhulev, E. N., Saakyan, M. Y., Vel'makina, I. V., Bragina, O. M., Vokulova, Y. A.
Russian Osteopathic Journal, 2023/12

40

Simplicity of Osteopathy
Fryette, H. H.
The AAO Journal, 2023/12

41

Head Pain
Miller, H. C.
The AAO Journal, 2023/12

42

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12

43

Augmentation of immune response to vaccinations through osteopathic manipulative treatment: a study of procedure
Sanchez, J., Martinez, E. S., Loveless, B., Sees, J. P., Zammuto, J., Szurmant, H., Fuchs, S., Crone, P., Hostoffer, R.
Journal of Osteopathic Medicine, 2023/11
Free full text

44

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text


46

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text

47

Adductor magnus: Extending the knowledge – A short review of structure and function
Corcoran, D., McNamara, T., Feehan, J., Tripodi, N.
International Journal of Osteopathic Medicine, 2023/09

48

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09

49

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09


51

Stomatognathes System: Stellenwert für die Osteopathie
(Stomatognathic system: Significance for osteopathy)
Prätorius, O., Herdick, T.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09

52

Die Rolle des Menstruationszyklus bei Sportverletzungen
(The role of the menstrual cycle in sports injuries)
Stierl, J. A., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09

53

Mechanische Eigenschaften der Arterien
(Mechanical characteristics of the arteries)
Wyvekens, M., Hirth, T., Wyvekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09


55

Остеопатия в мире современной медицины
(Osteopathy in the world of modern medicine)
Konopleva, E. L., Ostapenko, V. M., Tarasov, N. A.
Russian Osteopathic Journal, 2023/09

56

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09

57

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09


59

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text

60

Gleichgewicht und Propriozeption
(Balance and proprioception)
Barral, J.P.
Osteopathische Medizin, 2023/09



63

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09

64

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text

65

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text

66

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07

67

Peritoneal Adhesions in Osteopathic Medicine: Theory, Part 1
Bordoni, B., Escher, A. R., Girgenti, G. T.
Cureus, 2023/07
Free full text

68

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text


70

Sprechen wir noch eine Sprache?
(Are we still speaking the same language?)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06






76

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06

77

Combating poor mental health in emergency responders: Helping Emergency Responders Overcome (HERO) Act
Derynda, B., Gupta, K. A., Bhattacharya, S., Hollar, T. L.
Osteopathic Family Physician, 2023/06

78

Embryologie und Midline
(Embryology and midline)
Wojtowicz, A., Freeman, B., Dijs, P.
Osteopathische Medizin, 2023/06
Free full text


80

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06

81

Соматическая дисфункция. Клинические рекомендации 2023
(Somatic Dysfunction. Clinical Guidelines 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06

82

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06

83

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text

84

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text

85

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

86

Abwertung als Ziel
(Devaluation as a goal)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

87

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

88

Anatomie der Halswirbelsäule
(Anatomy of the cervical spine)
Mihajlovic, Z., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03







95

Fascia; facts and fantasies
Hoppeler, H.
European Journal of Translational Myology, 2023/03

96

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text



99

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03

100

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text

101

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03

102

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text

103

Prostate Cancer with a Presenting Symptom of Lower Thoracic Back Pain
Malhotra, V., Singh, C., Weening, A., Patel, S., Mayi, B., Migliozzi, J., Malhotra, V.
Osteopathic Family Physician, 2023/03



106

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03

107

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text

108

Mind, Body and Spirit: What Makes Osteopathic Medicine is Hands on
Williams, B. R.
Osteopathic Family Physician, 2023/03

109

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text


111

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text

112

Reconceptualizing Somatic Dysfunction in the Light of a Neuroaesthetic Enactive Paradigm
Consorti, G., Castagna, C., Tramontano, M., Longobardi, M., Castagna, P., Di Lernia, D., Lunghi, C.
Healthcare, 2023/02
Free full text

113


114


115

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01


117

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text


119

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text

120







126

Quality of Care: An Assessment of the Contributions of Osteopathic Medicine
Chila, A. G.
The AAO Journal, 2022/12
Free full text



129

Five challenges for manual therapies trials with placebo controls: A proposal
D'Alessandro, G., Ruffini, N., Iacopini, A., Annoni, M., Kossowsky, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/12


131

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11

132

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text

133

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/10

134

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09





139

Синдром грушевидной мышцы
(Piriformis syndrome)
Belash, V. O., Petrova, E. A.
Russian Osteopathic Journal, 2022/09


141

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09



144

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text

145

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08

146

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08

147

Das zerebrospinale venöse System
(The cerebrospinal venous system)
Flenker, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07

148

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07

149

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text

150

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text

151

Addressing disparities in medicine through medical curriculum change: a student perspective
Kureshi, A., Landman, S., Ahmed, M., Savinova, O. V., Becker, D.
Journal of Osteopathic Medicine, 2022/07
Free full text

152

Overcoming reward deficiency syndrome by the induction of “dopamine homeostasis” instead of opioids for addiction: illusion or reality?
Blum, K., Soni, D., Badgaiyan, R. D., Baron, D.
Journal of Osteopathic Medicine, 2022/07
Free full text

153

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07

154

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/07



157

An Enactive-Ecological Model to Guide Patient-Centered Osteopathic Care
Cerritelli, F., Esteves, J. E.
Healthcare, 2022/06
Free full text

158

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text


160

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06


162

Reconceptualizing the therapeutic alliance in osteopathic practice: Integrating insights from phenomenology, psychology and enactive inference
Shaw, R., Abbey, H., Casals-Gutiérrez, S., Maretic, S.
International Journal of Osteopathic Medicine, 2022/06

163

Where do people acquire their beliefs about low back pain?
Suhail, A., Poulter, D. C.
International Journal of Osteopathic Medicine, 2022/06



166

Transverse colon adenocarcinoma with direct cutaneous extension: complex multidisciplinary surgical management
Snow, Z. A., Marshall, B. N., Dreher, P., Parikh, S. N., Walchak, A., Cahn, D. B.
Journal of Osteopathic Medicine, 2022/06
Free full text

167

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/05

168

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text


170

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text

171

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text

172

Os trigonum identified after trauma to heel
Pargeon, M. E., Tjiattas-Saleski, L. R.
Journal of Osteopathic Medicine, 2022/05
Free full text

173

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text

174

Clinical evaluation and management of calcific tendinopathy: an evidence-based review
Catapano, M., Robinson, D. M., Schowalter, S., McInnis, K. C.
Journal of Osteopathic Medicine, 2022/04
Free full text

175

Bleeding gums due to immune thrombocytopenic purpura
Trydal, L., Liu, T.
Journal of Osteopathic Medicine, 2022/04
Free full text

176

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text


178

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text

179

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text


181

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

182

A.T. Still’s Biogen
Masiello, D. J.
The AAO Journal, 2022/03
Free full text


184

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text

185

Should person-centredness care be an affordable goal in French osteopathic education?
Salmon, M., Cretal, A., Gonzales-Bandres, M.
International Journal of Osteopathic Medicine, 2022/03
Free full text

186

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

187

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03


189

Weibliche Anatomie: Die Harnblase
Female Anatomy: The Urinary Bladder
Bazin, O., Naudin, M.
Osteopathische Medizin, 2022/03


191

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03

192

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text

193

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02

194

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text

195

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text

196

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02

197

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text

198

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text

199

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01

200

Teilleistungsstörung bei visueller Wahrnehmungsstörung
(Partial performance disorder in visual perception disorder)
Engemann, K., Preiss-Leger, B.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01

201




204

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/01

205

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05

206

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text




210

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12



213

Osteopathic ableism: A critical disability view of traditional osteopathic theory in modern practice
MacMillan, A.
International Journal of Osteopathic Medicine, 2021/12

214

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text

215

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11

216

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11


218

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text



221

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10




225

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09


227




230

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, Dr C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09

231

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text

232

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09

233

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09

234

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09


236

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09

237

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text


239

Ungleichgewicht von Produktion und Resorption des LCS
(Imbalance of production and absorption of the LCS.)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07

240

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07

241

Der Mensch und seine Mikroben
(Man and its microbes)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07



244

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text





249

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07

250

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07

251

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06

252

Osteopathy: Italian professional profile. A professional commentary by a group of experts of the European community of practice
Cerritelli, F., Lunghi, C., Esteves, J. E., Vaucher, P., van Dun, P. L. S., Alvarez, G., Biberschick, M., Wagner, A., Merdy, O., Menard, M., Tavernier, P., Clouzeau, C., Risch, A., Ruffini, Nuria, Nunes, A., Santiago, R., Marett, P., Grech, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06




256

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text

257

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text

258

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05

259

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

260

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05





265

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04

266

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text


268

Der Knochen aus osteopathischer Sicht
(The bone from an osteopathic point of view)
Junge, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03


270

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03


272

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03




276

Joining forces to administer COVID-19 vaccines
Johnson, K. H.
Journal of Osteopathic Medicine, 2021/03
Free full text







283

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01


285

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01

286



288

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text

289

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text

290

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text

291

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text

292

Embryologische Wellenreiter
(Embryological surfers)
Keown, D.
Osteopathische Medizin, 2020/12







299

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12

300

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12




304

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text

305

The Battle Between Politics and Science Is Costing Us a Timely Victory Over the COVID-19 Pandemic
Hahn, M. B.
The Journal of the American Osteopathic Association, 2020/11
Free full text

306


307

Postoperative peritoneale Adhäsionen
(Postoperative peritoneal adhäsionen)
Liedler, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10

308

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text

309




312

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text




316

Spinal Manipulation and Select Manual Therapies: Current Perspectives
Hinkeldey, N., Okamoto, C., Khan, J.
Physical medicine and rehabilitation clinics of North America, 2020/09

317






322

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

323

48-Hour Hospice Home Immersion Encourages Osteopathic Medical Students to Broaden Their Views on Dying and Death
Gugliucci, M. R., Padmanabhan, D. L., Silberstein, E. B.
The Journal of the American Osteopathic Association, 2020/08
Free full text

324

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

325

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text


327

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text


329

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06

330

(Corporeality of the heart)
Kozljanič, R. J., Scheuchl, F., Rösing, S.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06


332

A guide to writing a case report of an osteopathic patient
Vaughan, B., Fleischmann, M.
International Journal of Osteopathic Medicine, 2020/06

333

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06

334

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text


336

Test der Faszienkompartimente
(Test for fascia compartments)
Lunghi, C.
Osteopathische Medizin, 2020/06


338

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text








346

Graves Orbitopathy
Natali, S., Shogan, P.
The Journal of the American Osteopathic Association, 2020/06
Free full text

347

Partnering With Patients to Reduce Firearm-Related Death and Injury
Ozuna, L., Champion, C., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/06
Free full text



350

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

351

Antithrombotic Therapy for Patients With Atrial Fibrillation and Acute Coronary Syndrome or Percutaneous Coronary Intervention
Tseng, A. S., Shamoun, F. E., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/05
Free full text

352

Dermatofibrosarcoma Protuberans
Natali, S., Borelli, C., Shogan, P.
The Journal of the American Osteopathic Association, 2020/05
Free full text

353

Medizinischer Notfall in der Praxis: Ich packe meinen Koffer …
(Medical emergency in the practice: I pack my suitcase ...)
Merkt, P., Grasmück, J., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04



356

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04

357

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04

358

Academic Advising Using Theoretical Approaches for Medical Students Who Are Struggling in Preclinical Years
Tewary, S., Jordan, J. A., Rana, A. M., Mayi, B.
The Journal of the American Osteopathic Association, 2020/04
Free full text

359

Approach To Joint Pain In The Elderly For Osteopathic Providers
Daudfar, S., Nakajima, N., Faiss, K., Tegeler, L., Kuo, J., Dreibelbis, R., Goering, E., Katsaros, E., Pham, J. T.
Osteopathic Family Physician, 2020/04
Free full text

360

Osteopathic Primary Care Treatment Options for Ulcerative Colitis
Fernandez, A., Januchowski, R.
Osteopathic Family Physician, 2020/04
Free full text

361

Urticaria: Diagnosis and Treatment with Osteopathic Considerations
Stacey, S.., Burke, D., Brininger, T.
Osteopathic Family Physician, 2020/04
Free full text


363

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text

364

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text

365

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text

366

Skoliose und Osteopathie: Teil 1: Grundlagen
(Scoliosis and osteopathy. Part 1: Basics)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/03

367

Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research
Esteves, J. E., Zegarra-Parodi, R., van Dun, P., Cerritelli, F., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/03

368

The ICD-11 and opportunities for the osteopathy profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Orchard, D.
International Journal of Osteopathic Medicine, 2020/03

369

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text

370

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text



373

Antidepressant Discontinuation Syndrome: A Common but Underappreciated Clinical Problem
Rizkalla, M., Kowalkowski, B., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2020/02
Free full text


375

Shift Workers at Risk for Metabolic Syndrome
Kulkarni, K., Schow, M., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2020/02
Free full text

376

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text

377

Value of the Continuing Certification Modules and Challenging the Status Quo
Capoocia, A.
The Journal of the American Osteopathic Association, 2020/02
Free full text

378

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01




382

The Many Facets of Hypermobile Ehlers-Danlos Syndrome
Riley, B.
The Journal of the American Osteopathic Association, 2020/01
Free full text

383

Food Sensitivity Testing and Elimination Diets in the Management of Irritable Bowel Syndrome
Smith, E., Foxx-Orenstein, A., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/01
Free full text

384

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text

385

High-Velocity, Low-Amplitude Management of Posterior Rib Somatic Dysfunction
Kasten, K. M., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/01
Free full text


387

Preventing Premature Weaning: Management Options for Common Lactation Conditions, Including OMT
Sackett, D. R., Dajani, T., Shoup, D., Ikonne, U., Bombei, B.
Osteopathic Family Physician, 2020/01

388

Taxonomy of the Lateral Strain Patterns at the Sphenobasilar Synchondrosis for Osteopathic Cranial Manipulative Medicine
Capobianco, J. D., Shermon, S.
The Journal of the American Osteopathic Association, 2020/01
Free full text


390

Osteopathic Cranial Manipulative Medicine: Frontal and Parietal Lift Techniques
Mardini, D., Peña, N., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/12
Free full text







397

Role of Opioid Involved Drug Interactions in Chronic Pain Management
Bain, K. T., Knowlton, C. H.
The Journal of the American Osteopathic Association, 2019/12
Free full text

398

Review of Opioid Prescribing in the Osteopathic and Ambulatory Setting
Hussein, A. I., Bekampis, C. F., Jermyn, R. T.
The Journal of the American Osteopathic Association, 2019/12
Free full text

399

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text

400

An Osteopathic Physician's Approach to the Esports Athlete
Zwibel, H., DiFrancisco-Donoghue, J., DeFeo, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/11


402

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text

403

Visceral osteopathic manipulative treatment reduces patient reported digestive toxicities induced by adjuvant chemotherapy in breast cancer: A randomized controlled clinical study
Lagrange, A., Decoux, D., Briot, N., Hennequin, A., Coudert, B., Desmoulins, I., Bertaut, A.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2019/10




407

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text

408

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09

409

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

410

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09




414

Die Schilddrüse
(The thyroid)
Stöckl, D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

415

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatric, 2019/09

416

Fascial Nomenclature: An Update
Bordoni, B., Walkowski, S., Morabito, B., Varacallo, M. A.
Cureus, 2019/09
Free full text

417

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

418

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text

419

Kindlicher Kopfschmerz
(Child headache)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07

420

Körperarbeit als Zugang zum ganzen Menschen
(Bodywork as access to the whole person)
Petzold, T. D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07

421

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07



424

Нормы труда врача остеопата в учетом кодирования заболеваемости
(The labor standards of osteopath with regard to morbidity coding)
Shipova, V. M., Berseneva, E. A., Mikhailov, D. Y.
Problemy sotsial'noi gigieny, zdravookhraneniia i istorii meditsiny, 2019/07



427

Specific Adjusting Technique
(Specific Adjusting Technique)
Lamb, Gez, Schabel, Kai
Osteopathische Medizin, 2019/06

428

Osteopathic Cranial Manipulative Medicine and the Blood Brain Barrier: A Mechanistic Approach to Alzheimer Prevention
McAree, M., Dunn, A., Furtado, J., Timmerman, C., Winchell, Z., Rani, R., Farah, J., Crispino, L. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text

429

Refining the biopsychosocial model for musculoskeletal practice by introducing religion and spirituality dimensions into the clinical scenario
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/06



432

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text

433

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text

434

Integrating Osteopathic Philosophy in Cancer Care
Brown, Z. J., Martin, S. P., Carman, R.
The Journal of the American Osteopathic Association, 2019/06
Free full text

435

Cranial Osteopathy: Obscurantism and Enlightenment
Bordoni, B., Morabito, B., Simonelli, M.
Cureus, 2019/05

436

The Other Side of the Fascia: Visceral Fascia, Part 2
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05

437

The Other Side of the Fascia: The Smooth Muscle Part 1
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
Free full text

438

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05

439

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text

440

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text

441

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04

442

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text


444

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text

445

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text


447

The River of Life: Flüssigkeiten in der Osteopathie
(The river of life: fluids in osteopathy)
Mayer-Fally, E., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03

448

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03


450

Ist Asymmetrie Dysfunktion?
(Is asymmetry dysfunction?)
Robert, V.
Osteopathische Medizin, 2019/03


452

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03

453

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text

454

Manipulative Therapies: What Works
Smith, M. S., Olives, J., Smith, K.
American Family Physician, 2019/02
Free full text

455

The sacro-iliac joint: A potentially painful enigma. Update on the diagnosis and treatment of pain from micro-trauma
Le Huec, J. C., Tsoupras, A., Leglise, A., Heraudet, P., Celarier, G., Sturresson, B.
Orthopaedics & Traumatology: Surgery & Research, 2019/02

456

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text

457

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text

458

Der zervikothorakale Übergang
(The cervicothoracic junction)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

459

Welche Elemente charakterisieren die Osteopathie?
(Which elements characterize osteopathy?)
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

460

Back to the Roots: Palpation
(Back to the Roots: Palpation)
Eulenberg, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

461

Die Arbeit mit Diaphragmen im Zapchen
(Working with diaphragms through the Zapchen)
Weiß, B.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01


463

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text

464

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text

465

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text




469

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text

470

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text




474

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

475

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text

476

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text

477

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text

478

Changes on cervical range of motion in migraine patients after a strain counterstrain treatment
Giustino, V., Contrò, V., Brusa, J., Proia, P., Messina, G., Brighina, F.
The Journal of Headache and Pain, 2018/10

479

Die Kunst des Briefschreibens und der Korrespondenz
(The art of letter writing and correspondence)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
Free full text

480

The One Health Initiative as a Basis for Research Development in the Department of Pharmacology at Midwestern University
Prozialeck, W. C., Edwards, J. R.
The Journal of the American Osteopathic Association, 2018/09
Free full text

481

Hebammenarbeit und Osteopathie – Berührungspunkte
(Midwifery and osteopathy - points of contact)
Göggerle-Locher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09

482

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text

483

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09

484

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09


486

Anatomie am Lebenden
(Anatomy on the living object)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09


488

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09


490

Was ist Schmerzpsychotherapie?
(What is pain psychotherapy?)
Butz, M., Braun, C., Böger, A.
Osteopathische Medizin, 2018/09

491

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text

492

Umgangsformen: Respektvolles und offenes Miteinander
(Manners: Respectful and open interaction)
Brandes, M., Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09



495

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text

496

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text

497

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text


499

Mut zur Muße
(Dare to laze)
Lamersdorf, P. J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07


501

Still und das Geheimnis von Gesundheit
(Still and the secret of health)
Lewis, J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07


503

The Rule of the Artery Is Supreme. Or, Is It?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2018/07
Free full text

504

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07

505

Effect of HVLA on Chronic Neck Pain and Dysfunction
Cabahug, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text

506

Die Gesundheit in der Osteopathieausbildung
(Health in osteopathic education)
Bock, N.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07

507

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text

508

National Institutes of Health and Osteopathic Medicine: Another call for action and equality in a legal struggle won long ago
Peppers, B. P., Blumer, J. U., Hostofer, R. W., Rowane, M. P., Thomas, K. A., Byrnes, T. R.
The AAO Journal, 2018/06
Free full text

509

The challenges and opportunities of using patient reported outcome measures (PROMs) in clinical practice
Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2018/06

510

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text



513

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05

514

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text



517

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text

518

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03


520

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03

521

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03

522

Rethinking Superior and Inferior Sacroiliac Shear: A New Approach to Diagnosis and Treatment
Goldman, S. I., van Buskirk, R. L.
The AAO Journal, 2018/03
Free full text


524

Die Zusammenarbeit von Hebamme und Osteopath
(The collaboration of midwife and osteopath)
Steinfurth, G., Böhringer, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03

525

Interdisziplinäre Zusammenarbeit
(Interdisciplinary collaboration)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03



528

Clinical versus radiological findings: A paradox in diagnosing minor hamstring injuries
Arumugam, A.
International Journal of Osteopathic Medicine, 2018/03

529

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03

530

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text


532

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text

533

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

534

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text

535

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text

536

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text

537

Charlotte Weaver: Forschung zur Schädelwirbeltheorie
(Charlotte Weaver: Research on the cranial vertebra theory)
Engemann, K., Biermann, H.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

538

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

539

Beryl Arbuckle und die kraniale Osteopathie
(Beryl Arbuckle and cranial osteopathy)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01



542

Frauen in der osteopathischen Praxis
(Women in osteopathic practice)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

543

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text

544

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text

545

Anne Wales (1904 – 2005)
Dove, C.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

546

Wer war eigentlich Edna M. Lay?
(Who was Edna M. Lay?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

547




550

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text

551

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text

552

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text

553

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text

554

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text

555

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text

556

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text

557

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text

558

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

559

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10

560

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text

561

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text

562

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09





567

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

568

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09

569

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09


571

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text

572

Scheinselbstständigkeit in der osteopathischen Praxis
(False self-employment in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
Free full text

573

Das Nichts zwischen den Dingen – oder was ist Raum?
(The nothingness between things - or what is space?)
Wallbrecht, C., Nehlsen, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09

574

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text

575

Raum und Weite im Lernfeld Osteopathie
(Space and width in the learning field of osteopathy)
Brown, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09


577

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09

578

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text

579

Functional Somatic Syndrome: Assessment and Management
Graver, C. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

580

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

581

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text


583

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

584

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

585

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text





590

Reflexionen über Psyche und Geist in der Osteopathie
(Reflections on psyche and mind in osteopathy)
Turner, S., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text

591

Kraniozervikomandibulär bedingte Gleichgewichtsstörungen
(Vertigo caused by the cranio-cervico-mandibular complex)
Van Gorp, J., Stöcker, D.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06


593

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06

594

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text

595

Patienteninfo: Schwindel
(Patient information: Vertigo)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06

596

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text

597

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06

598

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text

599

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text

600

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text

601

An Osteopathic Approach to Chronic Pain Management
Jerome, J. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text

602

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text

603

Regulationsstörung
(Infantile colic)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04

604



606

Persistierende frühkindliche Reflexe
(Persistent early childhood reflexes)
Watrin, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04


608


609

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text



612

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text

613

The importance of pilot studies, how to write them and what they mean
Vogel, S., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2017/03

614

A process approach in osteopathy: beyond the structural model
Lederman, E.
International Journal of Osteopathic Medicine, 2017/03


616

Innovation in graduate medical education – using a competency based medical education curriculum
Riley, B. A., Riley, G.
International Journal of Osteopathic Medicine, 2017/03






622

Pectus Excavatum: A Review of Diagnosis and Current Treatment Options
Abid, I., Ewais, M. M., Marranca, J., Jaroszewski, D. E.
The Journal of the American Osteopathic Association, 2017/02
Free full text




626

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text

627

Die Architektur der extrazellulären Matrix
(The architecture of the extracellular matrix)
Armstrong, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

628

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text

629

Osteopathie, Krankheit und Gesundheit
(Osteopathy, disease and health)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

630

Die therapeutische Potency
(Therapeutic potency)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01



633

John Martin Littlejohn: Leben und Werk
(John Martin Littlejohn: life and work)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

634

(Thinking, feeling and wanting as component of a treatment)
Krause, R.
Osteopathische Medizin, 2016/12







641

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text

642

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text

643

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text

644

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text

645

A model for radiating leg pain of endometriosis
Bove, G. M.
Journal of Bodywork and Movement Therapies, 2016/10

646

Requirements for Certification in Surgery: A Comparison of the American Board of Surgery and the American Osteopathic Board of Surgery
Termuhlen, P. M., AH, O. Yurvati, Stella, J. J.
The Journal of the American Osteopathic Association, 2016/10
Free full text


648

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text



651

Patienteninfo: Leben ist Bewegung
(Patient information: Life is movement)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09



654

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

655




658

(Skin cancer: What you should watch out for in your patients)
Schnopp, C., Mempel, M., Baumstark, J.
Osteopathische Medizin, 2016/09


660

Nuad Boran – die traditionelle thailändische Massage
(Nuad Boran - the traditional Thai massage)
Rouhani, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09


662

Haftungsfälle in der osteopathischen Praxis
(Cases of liability in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09


664

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

665

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text

666

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text

667

Manual evaluation of the diaphragm muscle
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Journal of Chronic Obstructive Pulmonary Disease, 2016/08
Free full text





672

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text



675

Was macht die Psyche somatisch?
(What makes the psyche somatic?)
Vogt, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07

676

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text


678

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text


680

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06

681

(The polyvagal theory in osteopathy)
Porges, S. W., Liem, T.
Osteopathische Medizin, 2016/06


683

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06

684

Beliefs about back pain: The confluence of client, clinician and community
Darlow, B.
International Journal of Osteopathic Medicine, 2016/06

685

Time, space and form: Necessary for causation in health, disease and intervention?
Evans, D. W., Lucas, N., Kerry, R.
Medicine, Health Care and Philosophy, 2016/06

686

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text


688

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

689

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text

690

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

691

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

692

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03


694

Was ist eigentlich … Body-Mind-Centering®?
(What actually is Body-Mind-Centering®?)
Leinweber, D., Rustler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03



697

Anmerkungen zu Blechschmidt
(Comments on Blechschmidt)
Mildenberger, F. G.
Osteopathische Medizin, 2016/03

698

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text

699

Patienteninfo: Schilddrüsenunterfunktion
(Patient information: Hypothyroidism)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

700

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03


702

Assessment of Australian osteopathic learners
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03



705

Assessment of Australian osteopathic learners' clinical competence during workplace learning
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03

706

Patients' experiences of living with persistent back pain
van Griensven, Hubert
International Journal of Osteopathic Medicine, 2016/03

707

Die Polyvagal-Theorie
(The Polyvagal Theory)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

708

Research Into Osteopathic Manipulative Medicine: Steps on the Evidence Pyramid
Ching, L. M.
The Journal of the American Osteopathic Association, 2016/03
Free full text


710

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text


712


713

Modern Still Life
Pennekamp, A.
The Journal of the American Osteopathic Association, 2016/01
Free full text




717

Die Faszien im Alter
(Fascia in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

718

Bluthochdruck im Alter
(Hypertension in old age)
Seidler, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

719

Philosophie der Unsterblichkeit
(Philosophy of immortality)
Still, A. T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01


721

Der lange Weg bis ins hohe Alter
(The long walk to old age)
Chandler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

722

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

723

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text

724

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text







731

Safeguarding children in osteopathic practice part 2: Managing concerns about children
Feld, A., Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2015/12


733

The anatomy, biological plausibility and efficacy of visceral mobilization in the treatment of pelvic floor dysfunction
Horton, R. C.
Journal of Pelvic, Obstetric Gynaecological Physiotherapy, 2015/12
Free full text


735

Achilles Tendon Disorders
Saini, S. S., Reb, C. W., Chapter, M., Daniel, J. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text

736

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text

737

2015 Updated Method Guideline for Systematic Reviews in the Cochrane Back and Neck Group
Furlan, A. D., Malmivaara, A., Chou, R., Maher, C. G., Deyo, R. A., Schoene, M., Bronfort, G., van Tulder, M. W.
Spine (Phila Pa 1976), 2015/11

738

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text

739

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text

740



742

Osteopathie in Auroville
(Osteopathy in Auroville)
Kraus, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

743

Understanding Fibroblasts in Order to Comprehend the Osteopathic Treatment of the Fascia
Bordoni, B., Zanier, E.
Evidence-based Complementary and Alternative Medicine, 2015/09
Free full text



746

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09


748

Kinesiologisches Taping in der Osteopathie
(Kinesiology taping in osteopathy)
Seifert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
Free full text

749

Rechtliches rund um die osteopathische Praxis: Abrechnung der Behandlung
(Billing of treatment)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09



752

Patienteninfo: Anzeichen für einen Schlaganfall
(Patient information: Signs of a stroke)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

753

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

754

Im Westen was Neues
(News from the West)
Dick-Wallace, S. F.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

755

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09

756

Der Zehengang
(Toe walking)
Guerassimiouk, D., Goussel, W., Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

757

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text

758

Modeled Osteopathic Manipulative Treatments: A Review of Their in Vitro Effects on Fibroblast Tissue Preparations
Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/08
Free full text

759

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text

760

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text

761

Das Schleimhaut-assoziierte lymphatische Gewebe (MALT)
(Mucosa Associated Lymphatic Tissue (MALT))
Höppner, J.P., Stark, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07


763

Entzündungsreaktionen aus Sicht der Osteopathie
(Inflammatory reactions from an osteopathic point of view)
Sarzeaud, R., Thon, N., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
Free full text




767

Strömung
(Flow)
Geyer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07


769

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07



772

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text

773

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

774

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text


776

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06



779

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text

780

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text

781

Wie können wir unsere Wahrnehmung verbessern?
(How can we improve our perception?)
Marris, T., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

782

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

783

Was nimmt mein Osteopath wahr?
(What does my osteopath perceive?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

784

Sutherland
Bordoni, B., Zanier, E.
Advances in Mind-Body Medicine, 2015/04

785

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text

786

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

787

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

788

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text



791

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text

792

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text

793

Was ist eigentlich … Wahrnehmung?
(What actually is perception?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

794

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

795

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

796

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

797

Recognizing the Value of Manual Therapy Interventions in Women's Health: An Interim Report
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text


799

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03

800

Osteopathic Considerations in the Management of Migraine in Pregnancy
Soshnick, S., Mezzone, C., Yao, S., Abu-Sbaih, R.
Osteopathic Family Physician, 2015/03
Free full text


802

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text



805

Osteopathische Sterbebegleitung
(Osteopathic terminal care)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
Free full text

806

Alt geworden oder jung geblieben?
(Grown old or stayed young?)
von Studzinski, I.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

807

Veränderungen im Alter
(Changes in old age)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

808

Patienteninfo: Gute Ernährung für gesundes Altern
(Patient information: Good nutrition for healthy aging)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

809

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01

810

Durch Tanzen anders altern
(Aging differently through dancing)
Gierz, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

811

Kann die Arbeit mit dem Liquor älteren Patienten helfen?
(Can working with cerebrospinal fluid help elderly patients?)
Grundberg, S., Höflehner-Schnürch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01



814

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text

815

Laser Doppler Flowmetry in Manual Medicine Research
Zegarra-Parodi, R., Snider, E. J., Park, P. Y. S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/12
Free full text


817

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text



820

Safeguarding children in osteopathic practice: Part 1: Identifying children at risk
Maddick, A. F., Feld, A., Laurent, S.
International Journal of Osteopathic Medicine, 2014/12

821

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text







828

Die Bedeutung der Faszien im Hochleistungssport
(The importance of fascia in high-performance sports)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text



831

Als Osteopath bei den Olympischen Sommerspielen
(At the Summer Olympics as an Osteopath)
Maurer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10



834

Hypnose in Leistungssport und Osteopathie
(Hypnosis in competitive sports and osteopathy)
von Fischern, I.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10

835

Achillodynie
(Achillodynia)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text



838

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

839

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text

840

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09


842

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text


844

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text


846

Osteopathic Primary Care of Patients With Inflammatory Bowel Disease: A Review
Bragg, J. D.
The Journal of the American Osteopathic Association, 2014/09
Free full text


848

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text




852

Osteopathische Annäherung an die Arteriosklerose
(Osteopathic approach to arteriosclerosis)
Elferink, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07

853

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text

854

Impact of the single accreditation agreement on GME governance and the physician workforce
Kelley, C. S.
The Journal of the American Osteopathic Association, 2014/07
Free full text

855

Patienteninfo: Herzinfarkt bei Frauen
(Patient information; Heart attack in women)
Gräfin von Pfeil, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07

856

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text


858

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06


860






865

Reprint of: Elevating the quality of disability and rehabilitation research: Mandatory use of the reporting guidelines
collective, Authors
International Journal of Osteopathic Medicine, 2014/06
Free full text

866

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06

867

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text

868

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text

869

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text

870

Two novel nonsurgical treatments of carpal tunnel syndrome
Schreiber, A. L., Sucher, B. M., Nazarian, L. N.
Physical Medicine and Rehabilitation Clinics of North America, 2014/05

871

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

872

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text

873

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text


875

Schlafstörungen bei Säuglingen und Kindern
(Sleep disorders in infants and children)
Lim, K. W., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04

876

Das fetale Alkoholsyndrom
(Fetal alcohol syndrome)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04

877


878

Hirnnerven und Dysfunktionen des Schädels
(Cranial nerves and dysfunctions of the skull)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04


880

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text


882

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text


884

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03




888

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text


890

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text

891

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03

892

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03


894

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03

895


896

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text



899

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text

900

A Research Primer, Part 2: Guidelines for Developing a Research Project
Yens, D. P., Brannan, G. D, Dumsha, J. Z.
The Journal of the American Osteopathic Association, 2014/01
Free full text

901

Schuhe und chronische Fußschmerzen im Alter
(Shoes and chronic foot pain in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01



904

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

905

Der lebendige Fuß des Menschen aus osteopathischer Sicht
(The living human foot from an osteopathic perspective)
Wales, A., Mitha, N., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

906

Der Osteopath am Fuße des Patienten
(The osteopath at the foot of the patient)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

907

Was ist Podo-Postural-Therapie?
(What's Podo-Postural Therapy?)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

908

Die Mechanik des Fußes
(The mechanics of the foot)
Zwierzchowska, Z., Vieten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

909


910

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text




914

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12

915

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12

916

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12

917

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text

918

Potential New Dimensions in Dermatology: The Osteopathic Approach to Cutaneous Disease
Michunovich, A. M., Stern, R.
The AAO Journal, 2013/12
Free full text





923

Plagiozephalie – Ursachen und Hintergründe
(Plagiocephaly - Causes and background)
Künzel, K.H., Hoermann, R.
Osteopathische Medizin, 2013/11


925

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text

926

Swedenborgs Einfluss auf die Osteopathie
(Swedenborg's influence on osteopathy)
Fuller, D. B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10

927

„Mein Andrew Taylor Still“
(“My Andrew Taylor Still“)
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10

928


929




932


933

A. T. Still und die Wissenschaft
(A. T. Still and science)
Trowbridge, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10


935

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text

936

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text

937

Markenstreit beendet
(Brand dispute settled)
Osteopathische Medizin, 2013/09





942

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text

943

Wer waren eigentlich …
(Who actually were ...)
Lewis, J. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07



946

Okulomotorik und visuelle Teilleistungsstörungen
(Oculomotor and partial visual impairment)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

947

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text

948

Die frühkindliche Bewegungsentwicklung
(Early childhood movement development)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07


950

Oxytocingabe während der Geburt und ADHS
(Oxytocin during birth and ADHD)
Fleischer, F.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

951

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07






957

Osteopathie als Kunst?
(Osteopathy as art?)
Novy, R., Sommerfeld, P.
Osteopathische Medizin, 2013/06


959

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text

960

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text


962

The liquorodynamic model of the primary respiratory mechanism
Moskalenko, Y. E., Kravchenko, T. I., Weinstein, G. B., Vardy, T. C.
The AAO Journal, 2013/06
Free full text

963

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text





968

Vaskularisierung der Lendenwirbelsäule
(Vascularization of the lumbar spine)
Rapprich, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04

969

The use of placebo interventions in clinical practice
Linde, K.
Complementary Therapies in Medicine, 2013/04
Free full text


971

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

972

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

973

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

974

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

975

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

976

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text

977

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03

978

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03


980

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03

981

The Biopsychosocial model: Redefining osteopathic philosophy?
Penney, J. N.
International Journal of Osteopathic Medicine, 2013/03

982

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

983

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03






989

Trauma: Betrachtung aus osteopathischer Sicht
(Trauma: Viewed from an osteopathic perspective)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01




993

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text




997

Die Gesundheit im Trauma entdecken
(Discovering health within trauma)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01

998

A logical approach to complicated sacral and innominate dysfunction
Klock, G. B.
The AAO Journal, 2012/12
Free full text

999

The stabilometric platform as a measuring instrument
Huard, Y.
The AAO Journal, 2012/12
Free full text

1000

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12

1001

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12



1004

Techniken der kardiovaskulären Osteopathie
(Techniques of cardiovascular osteopathy)
Van Den Heede, P., Danjon, J.L.
Osteopathische Medizin, 2012/12

1005

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12

1006

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1007

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1008

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1009

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1010

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1011

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text


1013

Form-Funktion und die Sache mit der Embryologie
(Form-Function and the matter of embryology)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10


1015

Die hilflosen Helfer
(Helplessly helping)
Textor, R.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10

1016

Posture and chronic gonalgia in the elderly: contribution of osteopathic treatment
Huard, Y.
Computer Methods in Biomechanics and Biomedical Engineering, 2012/10

1017

Osteopathic manipulative treatment: novel application to dermatological disease
Campbell, S. M., Winkelmann, R. R., Walkowski, S.
Journal of Clinical and Aesthetic Dermatology, 2012/10

1018

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text

1019

Heterotaxien in der menschlichen Entwicklung
(Heterotaxies in human development)
Doll, S.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10



1022







1028

The eccentricities of osteopathy
Moore, W.
The BMJ, 2012/09

1029

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text

1030

Consent, competence and confidentiality for children and young people: Case problems from osteopathic practice
Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2012/09

1031

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1032

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1033

Topografie des weiblichen Beckens
(Topography of the female pelvis)
Lütjen-Drecoll, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1034

Stressinkontinenz nach einer Geburt
(Stress incontinence after childbirth)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07


1036

Packende Fachartikel – So geht es
(Writing gripping professional articles - Here's how)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07


1038

Patienteninfo: Beckenbodenübungen
(Patient information: pelvic floor exercises)
Vleminckx, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1039

From clinical experience to a model for the human fascial system
Day, J. A., Copetti, L., Rucli, G.
Journal of Bodywork and Movement Therapies, 2012/07

1040

Trauma: Sexuelle Gewalt und ihre Folgen
(Trauma: Sexual Violence and its aftermath)
Dietrich, B.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1041

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1042

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text


1044

A consideration of the elbow as a tensegrity structure
Scarr, G.
International Journal of Osteopathic Medicine, 2012/06

1045

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06





1050

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text

1051

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text




1055

Kopfschmerzforschung – ein Update
(Headache research - an update)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04



1058

Zeitmanagement – Entschleunigen Sie Ihr Leben!
(Time management - slow down your life!)
Schopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04

1059

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text


1061

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text



1064

Osteopathie und Wissenschaft
(Osteopathy and science)
Liem, T., Hilbrecht, H., Schmidt, T.
Osteopathische Medizin, 2012/03



1067

Osteopathie in Belgien
(Osteopathy in Belgium)
van Dun, P. L. S.
Osteopathische Medizin, 2012/03

1068

Selected fascial aspects of osteopathic practice
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2012/03
Free full text

1069

Reflex Relationships of Paravertebral Muscles
Elbe, J. N.
The AAO Journal, 2012/03
Free full text

1070

The Ram of Reason Seal: Musings on its Origin and Meaning
Hruby, R. J.
The AAO Journal, 2012/03
Free full text

1071

Spontaneous Release by Positioning
Jones, L. H.
The AAO Journal, 2012/03
Free full text

1072

The Neural Basis of the Osteopathic Lesion
Korr, I. M.
The AAO Journal, 2012/03
Free full text

1073

Structural Pelvic Function
Mitchell, F. L.
The AAO Journal, 2012/03
Free full text

1074

The Role of the Fascae in the Maintenance of Structural Integrity
Page, L. E.
The AAO Journal, 2012/03
Free full text

1075

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text

1076

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text

1077

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03





1082

Osteopathie studieren – wieso, weshalb, warum?
(Why study osteopathy?)
Meyer, B., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02



1085

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text

1086

Keep it simple!
(Keep it simple!)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02

1087

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02


1089

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02

1090

Osteopathische Berührung im Spiegel der Supervision
(Osteopathic touch in the mirror of supervision)
Hähn-Jakobs, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02

1091

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text



1094

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12

1095

Manipulative Methods of Dr. A.T. Still
Archer, J.
The AAO Journal, 2011/12
Free full text

1096

What is health? What is disease? Thoughts on a complex issue
Flatscher, M., Liem, T.
The AAO Journal, 2011/12
Free full text

1097

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text



1100

Osteopathie in Österreich
(Osteopathy in Austria)
Schulmeyer, A.
Osteopathische Medizin, 2011/12

1101

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text

1102

Innenstrukturen des Thorax
(Internal structures of the thorax)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10

1103

Steuerungsorgan Zwerchfell
(Control organ diaphragm)
Büsser, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10


1105

Atmung und obere Thoraxöffnung
(Breathing and upper thoracic opening)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10

1106

Lungen: Form und Funktion in der osteopathischen Praxis
(Lungs: Form and function in osteopathic practice)
Kuhlmann, C., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10



1109

Lymphatic pump treatment enhances the lymphatic and immune systems
Hodge, L. M., Downey, H. F.
Experimental Biology and Medicine (Maywood, N.J.), 2011/10

1110

Patterns of chronic pain in the population
Carnes, D.
International Journal of Osteopathic Medicine, 2011/09

1111

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text

1112

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09

1113

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text


1115

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text





1120

Sutherland’s Signature
Stark, J.
The AAO Journal, 2011/09
Free full text

1121

Técnica articular para disfunción de malar en eversión
(Articular technique for zygoma in eversion dysfunction)
Antolinos Campillo, P. J., Baño Alcaraz, A., Pascual-Vaca, J. O.
Osteopatía Científica, 2011/09

1122

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09


1124

Der Wille des Patienten steht über allem
(The patient's will is above all else)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07


1126


1127


1128

Lymphsystem und osteopathische Forschung
(Lymphatic system and osteopathic research)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07

1129

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text



1132


1133

The Hawthorne effect: stronger than the placebo effect?
Berthelot, J. M., Le Goff, B., Maugars, Y.
Joint Bone Spine, 2011/07
Free full text


1135

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06

1136

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06

1137

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text




1141

Jenette “Nettie” Bolles: First woman to pioneer osteopathy
Blumer, J.
The AAO Journal, 2011/06
Free full text





1146

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text


1148

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1149

Tug technique de escafoides para escafoides en rotación externa
(The Tug navicular technique for externally rotated navicular bones)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05




1153

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text


1155

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1156

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1157

Was ist eigentlich …
(What actually is ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04

1158

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1159




1162

Das Urheberrecht (UrhG)
(Copyright law (UrhG))
Ulusal, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04

1163


1164

Is a postural-structural-biomechanical model, within manual therapies, viable?: A JBMT debate
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04

1165

Invited response: (without science, there must be art)
Hannon, J. C.
Journal of Bodywork and Movement Therapies, 2011/04

1166

Invited response (the postural structural model, with boundary conditions)
Irvin, R. E.
Journal of Bodywork and Movement Therapies, 2011/04


1168

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04

1169

Invited response
McGill, S.
Journal of Bodywork and Movement Therapies, 2011/04

1170

Helical tensegrity as a structural mechanism in human anatomy
Scarr, G.
International Journal of Osteopathic Medicine, 2011/03



1173

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text


1175

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03






1181




1184

Wer war eigentlich …
(Who actually was ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02

1185

Osteopathy and (hatha) yoga
Liem, T.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text




1189

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011

1190

An Osteopathic Approach to Hypothyroidism
Burns, D. K.
The AAO Journal, 2010/12
Free full text

1191

Restoration of a McManis Treatment Stool
Clark, R. C.
The AAO Journal, 2010/12
Free full text



1194

Atypical Pathologic Somatic Dysfunctions: Techniques Revisited
Miller, D. S.
The AAO Journal, 2010/12
Free full text


1196

Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways
Watson, L. A., Pizzari, T.
International Journal of Osteopathic Medicine, 2010/12

1197

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1198

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11

1199

Das Schädeldach als Tensegrity-Struktur
(The cranial roof as a tensegrity structure)
Scarr, G., Hinz, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1200

Hinweise auf eine fasziale Rhythmizität?
(Evidence of fascial rhythmicity?)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1201

Knochen wie Kontinentalschollen
(Bones like continental floes)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1202

Anatomische Gesichtspunkte zur harten Hirnhaut
(Anatomical viewpoints on the hard meninges)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1203



1205

Hirnschädel und Menschsein
(Neurocranium and being human)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1206

Auf der Suche nach der Mittellinie
(Searching for the midline)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1207

Suturen des Hirnschädels
(Sutures of the cranium)
Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10


1209

Placebo: Missverständnisse und Vorurteile
(Placebo: Misconceptions and prejudices)
Breidert, M., Hofbauer, K.
Osteopathische Medizin, 2010/09





1214

Tensegrity in der Osteopathie
(Tensegrity in osteopathy)
Pflüger, C.
Osteopathische Medizin, 2010/09

1215

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text

1216

Técnica de lift-off para dorsales medias (T4-T10)
(Lift off technique in medium dorsal vertebrae (T4-T10))
Iglesias, J. G., del Cerro, L. P., Rodríguez Blanco, C.
Osteopatía Científica, 2010/09

1217

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text

1218

A ‘system based’ approach to risk assessment of the cervical spine prior to manual therapy
Taylor, Alan J., Kerry, R.
International Journal of Osteopathic Medicine, 2010/09

1219

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07


1221

Notes on visceral adhesions as fascial pathology
Hedley, G.
Journal of Bodywork and Movement Therapies, 2010/07

1222

Der Gesichtsschädel
(Patient information: The viscerocranium)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

1223

The Fickle finger of quackery in otology: the saga of Curtis H. Muncie, Osteopath
Swamy, R. S., Jackler, R. K.
Otology & Neurotology, 2010/07


1225

Was sind eigentlich... Viszera?
(What actually are viscera?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
Free full text


1227

Zum Aufbau des Gesichts
(Regarding the facial structure)
Fanghänel, J., Eigenwillig, P., Proff, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

1228



1230

Entwicklung des Viszerokraniums
(Development of the viscerocranium)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

1231

What is 'manipulation'? A reappraisal
Evans, D. W., Lucas, N.
Manual Therapy, 2010/06
Free full text



1234

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text

1235

Principles of Osteopathy in the Battlefield
Kozminski, M.
The AAO Journal, 2010/06
Free full text

1236




1239

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06



1242

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05


1244

The challenges of primary care and innovative responses in osteopathic education
Shannon, S. C., Ferretti, S. M., Wood, D., Levitan, T.
Health Affairs, 2010/05

1245

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text

1246

Klinische Relevanz statt Placebo-Kontrolle
(Clinical relevance instead of placebo control)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

1247

Morbus Sudeck und Osteopathie?
(Complex Regional Pain Syndrome and Osteopathy?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04


1249

Störungsketten im Bindegewebe
(Patient information: Disruptive chains in the fascia)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04


1251

Was ist eigentlich... intrinsische Bewegung?
(What actually is intrinsic movement?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

1252

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

1253

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text

1254

Kontraktilität von Faszien
(Contractility of Fascias – How is This Behavior Possible?)
Brand, E.M.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04






1260

Composite sacroiliac joint pain provocation tests: A question of clinical significance
McGrath, M. C.
International Journal of Osteopathic Medicine, 2010/03

1261

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1262

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1263

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1264

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1265

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text

1266

Performing arts medicine--instrumentalist musicians, Part II--examination
Dommerholt, J.
Journal of Bodywork and Movement Therapies, 2010/01


1268

Fascia: A missing link in our understanding of the pathology of fibromyalgia
Liptan, G. L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text

1269

Ist das Bindegewebe ein Organ?
(Patient information: Is fascia an organ?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01


1271

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01

1272

The osteopathic physician and end-of-life care
Hernandez, M., Ledbetter, S., Trevil, R., Perez, A., White, C.
Osteopathic Family Physician, 2010/01


1274

Das Fasziendistorsionsmodell nach Stephen Typaldos
(The Fascial Distortion Model According to Stephen Typaldos)
Fischer, T., Rossmy, C., Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01

1275

Gary Fryer –”...there is not much that we can say without any doubt.”
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01



1278



1280

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12



1283

Dr. A. T. Still’s Treating Chair
Archer, J.
The AAO Journal, 2009/12
Free full text

1284

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text

1285

There Are More Things in Heaven and Earth…
Ching, L. M.G.
The AAO Journal, 2009/12
Free full text


1287

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text


1289

Leben ist Bewegung
(Life is movement)
Gillemot, B., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1290

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1291

Osteopathie für Pferd und Reiter
(Osteopathy for Horse and Rider)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10


1293

Manipulation vor dem Wettkampf?
(Manipulative treatment before the competition?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1294

Osteopathie im Sport
(Osteopathy in sports)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1295

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1296

Leistung optimieren: Osteopathie und Sport
(Optimizing performance: Osteopathy and sports)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1297

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

1298

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09

1299

The functions of breathing and its dysfunctions and their relationship to breathing therapy
Courtney, R.
International Journal of Osteopathic Medicine, 2009/09




1303


1304

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

1305

Understanding the Process of Fascial Unwinding
Minasny, B.
International Journal of Therapeutic Massage and Bodywork, 2009/09
Free full text

1306

La langue : déglutition, fonctions oro-faciales, croissance crânio-faciale
(The tongue: deglutition, orofacial functions and craniofacial growth)
Landouzy, J.M., Sergent Delattre, A., Fenart, R., Delattre, B., Claire, J., Biecq, M.
International Orthodontics, 2009/09

1307

Human Volume Tissue Investigation Method
Mokhov, D. E., Chashchin, A. V., Erofeev, N. P., Vcherashny, D. B.
The AAO Journal, 2009/09
Free full text

1308



1310

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text

1311

Time for the osteopathic profession to take the lead in musculoskeletal research
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/07
Free full text


1313

Osteopathische Behandlung akuter Erkrankungen
(Osteopathic Treatment of Acute Diseases)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1314

Magenulkus
(Gastric ulcer)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1315

Vincent Benedetto – Die Basis der Osteopathie
(Vincent Benedetto - The basis of osteopathy)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07


1317

Aufruf Arbeitskreis klinische Osteopathie
(Appeal for a Working Group Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1318

Osteopathie bei akuten Erkrankungen
(Osteopathy for acute diseases)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1319

Grundlagen der Entzündungspathologie
(Basics of the Pathology of Inflammation)
Siegert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1320



1322

Die gewollte Spaltung
(Deliberate division)
Gröbmüller, J.
Osteopathische Medizin, 2009/06


1324

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text

1325

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text

1326

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text

1327

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text

1328

Osteopathic postdoctoral training institutions: a decentralized model for facilitating accreditation and program quality
Peska, D. N., Opipari, M. I., Watson, D. K.
Academic Medicine, 2009/06
Free full text

1329

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text


1331

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text






1337


1338

Scapular Glide: Functional relationships, dysfunction and treatment
Kary, D. J.
The AAO Journal, 2009/06
Free full text

1339

Osteopathic approach to the spleen
Peeters, L., Lason, G.
The AAO Journal, 2009/06
Free full text



1342

Classroom lectures - where are the students and don't they care?
Reed, K.
Iowa Medicine: Journal of the Iowa Medical Society, 2009/03-04

1343

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1344

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03

1345

Therapeutic needling in osteopathic practice: An evidence-informed perspective
Rickards, L. D.
International Journal of Osteopathic Medicine, 2009/03

1346

The Integration of Undergraduate Osteopathic Manipulative Medicine Fellows into Medical Education: The KCUMB-COM Model
Cox, W. J., Boyajian-O'Neill, L. A., Roach, M. D., Ridgley, J. A.
The AAO Journal, 2009/03
Free full text


1348

WPO: Ein Meilenstein näher betrachtet
(WPO: A closer look at a milestone)
Fuhrmann, M., Weynen, R., von Tümpling, U.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03

1349

Geteilte Aufmerksamkeit
(Divided Attention)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03

1350

Das Handgelenk, eine Betrachtung
(The Wrist, a Reflection)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03


1352

Osteopathische Informationsquellen
(Osteopathic sources of information)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03

1353



1355

Palpation zwischen Struktur und Energie
(Palpation between Structure and Energy)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
Free full text

1356

Brachial plexus injuries in neonates: an osteopathic approach
Mason, D. C., Ciervo, C. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text


1358

Osteopathie und (Hatha-)Yoga
(Osteopathy and (Hatha) yoga)
Liem, T.
Osteopathische Medizin, 2009/02

1359

Die Leber – mehr als GOT und GPT?
(The liver – more than GOT and GPT?)
Preuße, U., Giebel, J.
Osteopathische Medizin, 2009/02



1362

DO • Korrespondenten berichten
(DO • Correspondents reporting)
Jevbratt, M.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
Free full text

1363

Osteopathische Früherkennung
(Osteopathic early detection)
Bayer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01




1367

Osteopathie bei Frühgeborenen
(Osteopathy with Premature Infants)
Lamberts, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01



1370

Hilfe – mein Kind ist schief!
(Help - my child is crooked!)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01

1371

Muscle Impulse, A Muscle Energy Variant
van Buskirk, R. L.
The AAO Journal, 2008/12
Free full text


1373

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12




1377

Kinder!
(Children!)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

1378

Unsere Haut – Bau und Leistungen, Teil 2
(Our Skin – Structure and Performance, Part 2)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

1379

Diagnosis and management of piriformis syndrome: an osteopathic approach
Boyajian-O'Neill, L. A., McClain, R. L., Coleman, M. K., Thomas, P. P.
The Journal of the American Osteopathic Association, 2008/11
Free full text


1381

Die drei Säulen der Y–Fuge der Säuglingshüfte
(The Three Pillars of the Hypsiloid Cartilage of the Hip of Infants)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

1382

Säuglinge sind Viszera
(Infants are Viscera)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11



1385

Legg reduction maneuver for patients with anterior shoulder dislocation
Dyck Jr., D. D., Porter, N. W., Dunbar, B. D.
The Journal of the American Osteopathic Association, 2008/10
Free full text

1386

Prevention, diagnosis, and management of osteoporosis-related fracture: a multifactoral osteopathic approach
Gronholz, M. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text

1387

The endocannabinoid system: an osteopathic perspective
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text

1388

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text

1389

Osteopathic Medicine and the Geriatric Patient
Hruby, R. J.
The AAO Journal, 2008/09
Free full text

1390

Valuing osteopathy: What are (our) professional values and how do we teach them?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09

1391

Whose values are we teaching? Deconstructing responsibilities and duties of teachers of osteopathy
Sommerfeld, P.
International Journal of Osteopathic Medicine, 2008/09


1393

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

1394

Unsere Haut – Bau und Leistungen Teil 1
(Our Skin – Structure and Performance, Part 1)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

1395

Einschneidende Rituale
(Drastic Rituals)
Knöppler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

1396

Querschnitt– und Längsschnittstudien
(Cross-sectional and longitudinal studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

1397


1398

Zwischen innen und außen: die Haut
(Between inside and outside: the skin)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08









1407

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text


1409


1410

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06

1411

The Cranial Plunger Theory
Burns, D. K.
The AAO Journal, 2008/06
Free full text

1412


1413

“Poiseuille’s Panacea”: a New Direction in Osteopathic Manipulation of the Thorax
McCombs, T. M., Towne, S., Treece, M.
The AAO Journal, 2008/06
Free full text

1414

The Osteopath Should Find Health
Höppner, J.P.
Osteopathische Medizin, 2008/05




1418

Das Herz - mehr als nur eine Pumpe
(The Heart - More Than Just a Pump)
Fraval, M., Norrie, A., del Pilar Munoz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04


1420

Retrospektive und prospektive Studien
(Retrospective and prospective studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04

1421

Das komplexe regionale Schmerzsyndrom
(The complex regional pain syndrome)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04


1423

Wunderwerkzeug Hand
(Miracle tool hand)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04



1426

Autistic Spectrum Disorder
Sorrell, M. A.
The AAO Journal, 2008/03
Free full text


1428

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1429

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03

1430

Die osteopathische Dysfunktion der Arterie
(Osteopathic Dysfunction of the Arteries)
Chauffour, P., Prat, E., Michaud, J.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02


1432

Entwicklung von Blut- und Lymphgefäßen
(The Development of Blood and Lymph Vessels)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02

1433

Die visuelle Analogskala
(The visual analog scale)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02

1434

Eigenrhythmizität von Blutgefäßen
(The Innate Rhythmicity of Blood Vessels)
Schmid-Schönbein, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02



1437

Der Rhythmus des Blutflusses
(The Rhythm Of Perfusion)
Wyvekens, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02


1439

Slow-Thrust Technik
(Slow thrust technique)
Dräger, K.
Osteopathische Medizin, 2008/01

1440

Die Gleitfähigkeit subkutaner Strukturen beim Menschen – eine Einführung
(Introduction to the knowledge of subcutaneous sliding system in humans)
Guimberteau, J. C., Sentucy-Rigall, J., Panconi, B., Bouleau, R., Mouton, P., Bakhach, J.
Osteopathische Medizin, 2008/01







1447


1448

OMT Homework
Clark, R. C.
The AAO Journal, 2007/12
Free full text






1454

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

1455

Spina bifida - Entstehung und Folgen
(Spina bifida - Development and Consequences)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

1456

Masterkurs in Kirksville - ein Stimmungsbild
(Master course in Kirksville - an impression)
Kaiser, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

1457

Lebensqualität
(Quality of Life)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10


1459

Müsli gegen Spina bifida
(Muesli against spina bifida)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

1460

Rauchen schadet Embryo
(Smoking harms the embryo)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10



1463

Occipital Compression and its Potential Uses in Obstetrics
McAfee, S. N., Chila, A. G.
The AAO Journal, 2007/09
Free full text

1464

Independence and Interdependence
Paulus, S. F.
The AAO Journal, 2007/09
Free full text



1467

Die Entwicklung der Wirbelsäule (Teil 2)
(The Development of the Spinal Column (Part 2))
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07


1469

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

1470

SEE - Die SomatoEmotionale Entspannung nach Upledger
(SER - SomatoEmotional Release according to Upledger)
Landeweer, G. G., Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07



1473

Speisen hält Leib und Seele zusammen
(Dining holds body and soul together)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

1474

Medizin und Kreativität
(Medicine and creativity)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

1475

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

1476

Eine kurze Geschichte der Seele
(A Short History of the Soul)
Sommerfeld, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07


1478

Neuromusculoskeletal Causes of Back Pain in Competitive Figure Skaters
Goldman, S. I., Moyer, M.
The AAO Journal, 2007/06
Free full text


1480






1485

Bau und Funktion des Ellbogengelenks
(Construction and Function of the Elbow)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

1486

Die Motrizität
(Motricity)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

1487

Studienarten
(Types of studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

1488

Embryologie des Ellbogens
(Embryology of the Elbow)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

1489

Tennisellbogen: Osteopathie statt Kortison!
(Tennis elbow: Osteopathy instead of cortisone!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

1490

Tennisellbogen: Was hilft? Was hilft wirklich?
(Tennis elbow: What helps? What really helps?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04


1492

Der Ellbogen
(The elbow)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

1493

Is Osteopathy research relevant? A challenge has been made
Lucas, N. P., Moran, R. W.
The AAO Journal, 2007/03
Free full text


1495

Back pain and the homoeostatic requirements of the spinal system
Brownhill, K.
International Journal of Osteopathic Medicine, 2007/03

1496

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03







1503

Die Bewegungen der Viszera: Die Mobilität, Teil 2
(Visceral Movements: Mobility, Part 2)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01

1504

Für eine streitbare und lebendige Osteopathie
(For a contentious and lively osteopathy)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01




1508


1509

Dr. A. T. Still’s Treating Chair
Jordan, T. R.
The AAO Journal, 2006/12
Free full text

1510

Cranial osteopathy: its fate seems clear
Hartman, S. E.
Chiropractic & Manual Therapies, 2006/12
Free full text

1511

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text

1512

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11

1513

Unser Fuß, ein komplexes Organ
(The Foot - A Complex Organ)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10

1514






1519

Osteopathic reasoning for the treatment of low back pain
Rennie, P. R.
Manuelle Medizin, 2006/10

1520

Brauchen Kinderfüße Einlagen?
(Do children's feet need insoles?)
Luthin, D., Rossi, S.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10

1521

Evidence based-Medizin (EBM)
(Evidence-based medicine (EBM))
Krause, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10


1523

Die Bewegungen der Viszera: Die Mobilität - Teil 1
(Visceral Movements: Mobility - Part 1)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10


1525

Was bringt die Ganganalyse? - Pro und Contra
(What are the benefits of gait analysis? - Pros and cons)
Fink, M., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10

1526

One Heritage, Two Traditions; A Look to the Future
Steele, K. M.
The AAO Journal, 2006/09
Free full text

1527

Palpation of the sacroiliac joint: An anatomical and sensory challenge
McGrath, M. C.
International Journal of Osteopathic Medicine, 2006/09

1528

Infantile colic: A critical appraisal of the literature from an osteopathic perspective
Lim, K. W.
International Journal of Osteopathic Medicine, 2006/09

1529

Osteopathic medicine in transition: postmortem of the Osteopathic Medical Center of Texas
Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2006/09
Free full text

1530







1536

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08

1537

Forschungen zur Somatischen Dysfunktion
(Research on somatic dysfunction)
Heath, D. M., Gevitz, N.
Osteopathische Medizin, 2006/08

1538



1540

Benötige ich ein Kunstgelenk?
(Do I need an artificial joint?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

1541

Das Ohr, Anatomie und Physiologie
(The Ear, Anatomy and Physiology)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07


1543



1545

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

1546

Konfidenzintervall
(Confidence interval)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

1547

Tinnitus aurium - Wenn das Ohr pfeift
(Tinnitus - When the ear whistles)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

1548

Das Os temporale und seine Beziehungen
(The Temporal Bone and its Relations)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

1549

What is the best treatment for infants with colic?
Crotteau, C. A., Wright, S. T.
The Journal of Family Practice, 2006/07

1550


1551

Psychology and low back pain
Bogduk, N.
International Journal of Osteopathic Medicine, 2006/06


1553

Sacroiliac Mechanics Revisited
Jordan, T. R.
The AAO Journal, 2006/06
Free full text

1554

Understanding comorbidity with depression and anxiety disorders
Aina, Y., Susman, J. L.
The Journal of the American Osteopathic Association, 2006/05

1555

Nonobstetric lacerations of the vagina
Sloin, M. M., Karimian, M., Ilbeigi, P.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1556

Mechanism-of-injury approach to evaluating patients with blast-related polytrauma
Scott, S. G., Belanger, H. G., Vanderploeg, R. D., Massengale, J., Scholten, J.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1557

Treating patients for comorbid depression, anxiety disorders, and somatic illnesses
Dolnak, D. R.
The Journal of the American Osteopathic Association, 2006/05


1559

The Drive for Legitimation by Osteopathy and Chiropractic in Australia: Between Heterodoxy and Orthodoxy
Baer, H. A.
Complementary Health Practice Review, 2006/04
Free full text


1561



1563


1564

Alles Schrott?
(All scrap?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

1565

Altern und Osteopathie: Die Rolle von Beweisen
(Aging and Osteopathy: The Role of Evidence)
McGovern, R. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

1566

Signifikanz
(Significance)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

1567

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

1568

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

1569

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text

1570

Intercostal rib release
McCarty, C. L.
The AAO Journal, 2006/03
Free full text

1571

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03

1572

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text

1573

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1574

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1575

Matrix-Rhythmus-Therapie und osteopathischer Ansatz
(Matrix rhythm therapy and osteopathic approach)
Randoll, U. G., McCutcheon, R., Hennig, F. F.
Osteopathische Medizin, 2006/02

1576

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1577

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text



1580

(Various approaches for the treatment of postpartal problems)
Ligner, B.
Osteopathische Medizin, 2006/02
Free full text

1581

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text



1584

Das Studium des Lebens
(The study of life)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01


1586

Die osteopathische Versorgung älterer Menschen
(Osteopathic treatment of the elderly)
McGovern, J. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01

1587

Mit Statistik manipulieren
(Manipulate through statistics)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01


1589

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12

1590

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text

1591

American Osteopathic Association adopts policies on treatment of patients in pain: an overview
D'Alonzo, G. E., Jr., Stipp
The Journal of the American Osteopathic Association, 2005/11
Free full text

1592

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text

1593

Manual techniques addressing the lymphatic system: origins and development
Chikly, B. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

1594

Andrew Taylor Still-Techniken
(Andrew Taylor Still techniques)
Bachand, P.
Osteopathische Medizin, 2005/10


1596

(H. M. Patterson, D.O.: His life as an osteopath)
Patterson, M. M.
Osteopathische Medizin, 2005/10



1599

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10


1601

Automatic Shifting
Paulson, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

1602

Ein Osteopath auf eigenen Wegen
(An osteopath on his own paths)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

1603

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10


1605

Das Hüftgelenk
(The hip joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

1606

Der holistische Imperativ in der Osteopathie
(The holistic imperative in osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

1607

Interventional pain management: an overview for primary care physicians
Boyajian, S. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1608

Headache pain
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1609

Management of neuropathic pain
Galluzzi, K. E.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1610

Clinical Prevention and Population Health Curriculum Framework: the nursing perspective
Allan, J. D., Stanley, J., Crabtree, M. K., Werner, K. E., Swenson, M.
Journal of Professional Nursing, 2005/09
Free full text

1611

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1612

Management of osteoarthritic knee pain
Rubin, B. R.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1613

An osteopathic approach to treating women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1614

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1615

Legends and Lessons: William “Wild Bill” Wyatt, DO
Capobianco, A. D.
The AAO Journal, 2005/09
Free full text

1616

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text

1617

Anatomy in the Osteopathic Field
Paulus, S. F.
The AAO Journal, 2005/09
Free full text

1618

The Instrument of our Distinction: The Hand
Smutny, C. J. III.
The AAO Journal, 2005/09
Free full text




1622

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text

1623

The mechanics of cranial motion—the sphenobasilar synchondrosis (SBS) revisited
Cook, A.
Journal of Bodywork and Movement Therapies, 2005/07


1625



1627

Dreigliedrige Osteopathie
(Triune osteopathy)
Pöttner, M., Hartmann, C.
Osteopathische Medizin, 2005/07


1629

Das Kiefergelenk des Menschen
(The Human Jaw)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

1630

Störungen in der Entwicklung des kindlichen Kiefers
(Developmental Disorders of the Jaw in Children)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

1631

Literaturliste
(Bibliography)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

1632

Etienne Cloet - Was wirklich zählt
(Etienne Cloet - What really matters)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

1633

Osteopathie bei Kindern mit Asthma
(Osteopathy in children with asthma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07


1635

Tagebuch aus Kirksville
(Diary from Kirksville)
Sutmar, S.C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

1636

Das Kiefergelenk
(The temporomandibular joint)
Terhorst, L., Sundermann, W.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07


1638

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text

1639

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text

1640

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text


1642

The UK BEAM trial – a review and discussion
Vogel, S., Dear, J., Evans, D. W.
International Journal of Osteopathic Medicine, 2005/06

1643

Sir William Osler then and now: thoughts for the osteopathic profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2005/05
Free full text

1644

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text


1646

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text




1650

Osteopathische Therapie bei Glaukom
(Osteopathic Therapy of Glaucoma)
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04

1651

Wanderer zwischen den Osteopathiewelten
(Roamer between osteopathic worlds)
Fossum, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04


1653


1654

Die Bedeutung von Abstracts
(The importance of abstracts)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04


1656

Osteopathie gegen Schielen
(Osteopathy for strabismus)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04

1657


1658

Okulomotorik. Was bewegt das Auge?
(Oculomotorics: What makes the eye move?)
Storr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04

1659

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1660

Pain management in end-of-life care
Leleszi, J. P., Lewandowski, J. G.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1661

AOA's position against use of placebos for pain management in end-of-life care
Nichols, K. J., Galluzzi, K. E., Bates, B., Husted, B. A., Leleszi, J. P., Simon, K., Lavery, D., Cass, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1662

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03



1665



1667




1670

The biodynamic model of osteopathy in the cranial field
McPartland, J. M., Skinner, E.
Explore (NY), 2005/01

1671

Integrating Osteopathic terminology into SNOMED CT
Nash, S.
AMIA - Annual Symposium Proceedings, 2005/01
Free full text


1673

John Wernham - A.T. Stills “Enkel”
(John Wernham - A.T. Still's “Grandson“)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

1674

Viszerosomatische Reflexe
(Viscerosomatic reflexes)
Friedman, H. D.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

1675

Die Wirbelsäule
(The Spine)
Fuhrmann, M., Kühn, J.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

1676

Osteopathie und Chiropraktik
(Osteopathy and chiropractic)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

1677

Die Entwicklung der Wirbelsäule (Teil 1)
(The Development of the Spinal Column (Part 1))
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

1678

Safety bei Untersuchung der Wirbelsäule
(Safety in the area of the spinal column)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01


1680





1684

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text



1687

Osteopathie beim Kleinkind
(Osteopathy in small children)
Dufresne, D.
Osteopathische Medizin, 2004/11

1688

Gibt es eine kranielle Osteopathie?
(Is there such a thing as cranial osteopathy?)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11


1690

Osteopathie in der kraniellen Sphäre
(Osteopathy in the cranial sphere)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11



1693

Sutherland und das “flüssige Licht”
(Sutherland and the “liquid light“)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11

1694

The unique role of osteopathic physicians in treating patients with low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/11
Free full text

1695

“Kraniosakral”- Mythen und Fakten
(“Craniosacral” - Myths and Facts)
Resch, K.L., Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11


1697

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text

1698

Kraniosakrale Osteopathie - Was ist das?
(What's craniosacral osteopathy?)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11

1699

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text


1701

An introduction to the use of outcomes questionnaires in osteopathic practice
Vaughan, B., DiVenuto, G.
Journal of Osteopathic Medicine, 2004/10

1702

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09

1703

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09


1705


1706

Osteopathie beim Säugling
(Osteopathy in infants)
Dufresne, D.
Osteopathische Medizin, 2004/08


1708



1710

Suturen – Wachstumszentren des Schädels
(Sutures - Cranial growth centers)
Fanghänel, J., Preuße, U.
Osteopathische Medizin, 2004/08



1713

Russische Forschungsstudien im Bereich der kranialen Osteopathie
(Russian research in cranial osteopathy)
Kravchenko, T. I., Moskalenko, Y. E., Vartanyan, I. A.
Osteopathische Medizin, 2004/08








1721

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07




1725

Vom Gegen- und Miteinander
(Of working together and working against each other)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07


1727

Eckpunkte für Curriculum festgelegt
(Cornerstones for curriculum established)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2004/07

1728

Charles J. Smutny III - Neuer Fellow der AAO
(Charles J. Smutny III - New Fellow of the AAO)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
Free full text

1729

Wissenschaft, die Wissen schafft
(Science creating knowledge)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07

1730

Osteopathie im Bereich des Brustkorbs
(Osteopathy in the thoracic region)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07

1731

Risk management for chiropractors and osteopaths: informed consent. A common law requirement
Walker, B. F., Cameron, M., French, S., Pollard, H. P., Vitiello, A. L., Reggars, J. W., Werth, P. D.
Australasian Chiropractic & Osteopathy, 2004/07

1732

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text

1733

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text

1734

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text



1737

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

1738

Schutzimpfungen bei Kindern - Pro und Contra
(Vaccinations in children - pros and cons)
Dockx-Reinken, F., Rabe, S.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

1739

Zur funktionellen Anatomie des kindlichen Schädels
(The functional anatomy of the infantile skull)
Fanghänel, J., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

1740

The spotted monster
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

1741

Das Unmögliche wagen
(Daring the impossible)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05



1744

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text

1745

A divisional approach to enhancing research among osteopathic family practice residents
Smith-Barbaro, P., Fulda, K. G., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2004/04
Free full text

1746

Viewpoint
Evans, D.
Journal of Osteopathic Medicine, 2004/04

1747

Breathing pattern disorders, motor control, and low back pain
Chaitow, L.
Journal of Osteopathic Medicine, 2004/04



1750

Energy medicine: an osteopath's personal view
Handoll, N.
The Journal of Alternative and Complementary Medicine, 2004/03

1751

The Neuroendocrine-Immune Complex Illustrated in the Work of Dr. Frank Chapman
Capobianco, J. D.
The AAO Journal, 2004/03
Free full text

1752

From the Archives: The Lymphatic System, Applied Anatomy
Millard, F. P.
The AAO Journal, 2004/03
Free full text

1753

Tägliche Eigenübungen
(Daily self-exercises)
Comeaux, Z., Haßfeld, U.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02

1754

Akuter Lumbago - ein funktioneller Ansatz
(Acute lumbago: a functional approach)
Debroux, J.J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02



1757

“...jederzeit voll und ganz dabei sein!“
(“...be fully involved at all times!“)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02

1758

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text

1759



1761

Der “Diagnostic Touch“ von Rollin E. Becker
(The diagnostic touch from Rollin E. Becker)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02

1762

Stills Faszienkonzept
(Still’s fascia concept)
Stark, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02

1763

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text

1764

Efficacy of manipulation in low back pain treatment: The validity of meta-analysis conclusions
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Journal of Bodywork and Movement Therapies, 2004/01

1765

Erectile dysfunction and comorbid diseases, androgen deficiency, and diminished libido in men
Fine, S. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text

1766

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text


1768

From The Archives: A Glimpse of Dr. Still's Art
McConnell, C. P.
The AAO Journal, 2003/12
Free full text


1770

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11

1771

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text


1773

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text


1775

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10

1776

A review of the physiology of cranial osteopathy
Ferguson, A.
Journal of Osteopathic Medicine, 2003/10

1777

Intervertebral dysfunction: a discussion of the manipulable spinal lesion
Fryer, G.
Journal of Osteopathic Medicine, 2003/10


1779

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10

1780

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text

1781

Viewpoint
Chaitow, L.
Journal of Osteopathic Medicine, 2003/10



1784

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

1785

Osteopathie in der Schwangerschaft
(Osteopathy during pregnancy)
Gillemot, B.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

1786

Osteopathie – ohne Frauen undenkbar!
(Osteopathy - unthinkable without women!)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

1787

James McGovern, Anwalt der Osteopathie
(James McGovern, Osteopathic Advocate)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

1788








1795

Likening Likening Strikes. Psychiatry, Osteopathy, and the Likeness Argument
Tyreman, S.
Philosophy, Psychiatry & Psychology, 2003/09

1796

History of Osteopathy in France
Barillon, B.
The AAO Journal, 2003/09
Free full text


1798

Dynamic Strain-Vector Release: An Energetic Approach to OMT
Hendryx, J. T., O'Brien, R. L.
The AAO Journal, 2003/09
Free full text

1799


1800

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text

1801

A primary care approach to comprehensive care of patients with type 1 and type 2 diabetes mellitus
Keilers, R. K.
The Journal of the American Osteopathic Association, 2003/08
Free full text

1802

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text

1803

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text

1804

Osteopathic manipulative medicine in the treatment of hypertension: An alternative, conventional approach
Spiegel, A. J., Capobianco, J. D., Kruger, A., Spinner, W. D.
Heart Disease, 2003/07

1805

Treating patients in primary care: the impact of mood, behavior, and thought disturbances
Baron, D. A., Hay, D. P., Easom, H. M.
The Journal of the American Osteopathic Association, 2003/07
Free full text

1806

Aufbau und Funktion des Peritoneums
(Structure and function of the peritoneum)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

1807

Abenteuer Leichenbeschaffung
(Adventure of providing cadavers)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

1808

Die mechanische Funktion des rechten Kolonwinkels
(The mechanical function of the right colonic angle)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

1809

Zum primären Verletzungsmechanismus bei Beschleunigungsverletzungen
(Whiplash injury: What you should know)
Keller, M., Bischoff, A., Schwerla, B. S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

1810

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

1811

Nackenschmerzen: Hand anlegen überlegen!
(Neck pain: manual therapy scores best)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07


1813

Bauchschmerzen - Wer untersucht? Wer behandelt?
(Abdominal pain - Who examines? Who treats?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07


1815

From the Archives: A Manual of Cranial Technique
Lippincott, R. C., Lippincott, H. A.
The AAO Journal, 2003/06
Free full text

1816

Physiological Background of the Cranial Rhythmic Impulse and The Primary Respiratory Mechanism
Moskalenko, Y., Frymann, V., Kravchenko, T., Weinstein, G.
The AAO Journal, 2003/06
Free full text



1819

Single system research designs in osteopathy
Sanders, G.
Journal of Osteopathic Medicine, 2003/04


1821

Sinus sphenoidalis und ethmoidalis
(Sphenoid sinus and ethmoid sinus)
Eser-Bindl, U.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

1822

Funktionelle Anatomie der Nasennebenhöhlen
(Functional anatomy of the paranasal sinuses)
Fanghänel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04


1824

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

1825


1826

Die chronische Sinusitis: Eine Übersicht
(A review of chronic sinusitis)
Resch, K.L., Häfner, S., Stadler, M., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

1827

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

1828

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04


1830

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

1831

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

1832

Bibliotherapy: the therapeutic use of didactic and literary texts in treatment, diagnosis, prevention, and training
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2003/03
Free full text


1834

Etiological Factors in Sacral Somatic Dysfunctions
Danto, J. B.
The AAO Journal, 2003/03
Free full text

1835

From the Archives: The Contribution of John Martin Littlejohn to Osteopathy
Hall, T. E., Wernham, J.
The AAO Journal, 2003/03
Free full text

1836

Conceptual and Treatment Models in Osteopathy
Jordan, T.
The AAO Journal, 2003/03
Free full text



1839

Manipulation of the cervical spine
Hing, W. A., Reid, D. A., Monaghan, M.
Manual Therapy, 2003/02

1840

The national cholesterol education program adult treatment panel ill guidelines
Clearfield, M. B.
The Journal of the American Osteopathic Association, 2003/01
Free full text

1841

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text

1842

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01

1843

Allgemeiner Aufbau des Kniegelenks
(General structure of the knee joint)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

1844

Praxis optimieren: Eingang und Flur
(Optimizing your practice: Entrance and hallway)
Edelmann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

1845

Hausaufgaben und Tipps für’s Knie
(Homework and tips for the knee)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

1846



1848

Das schmerzhafte Knie: Eine Übersicht
(The painful knee: an overview)
Resch, K.L., Bachem, S., Salzmann, I., Schwartz, U., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

1849

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

1850

Traumatologische Diagnostik des Kniegelenks
(Traumatological diagnostics of the knee joint)
Schwerdtner, H.P., Schallier, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

1851

Das posttraumatische Kniegelenk
(The post-traumatic knee joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

1852

The Primary Respiratory Mechanism
Nelson, K. E.
The AAO Journal, 2002/12
Free full text

1853

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1854

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1855

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11

1856

Aptitude for osteopathic training. 1939
Yarborough, J. U.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1857

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text


1859

Developing research at The British School of Osteopathy
Nash, K., Vogel, S.
Journal of Osteopathic Medicine, 2002/10

1860

Getting to the point: an osteopathic appreciation of Janet Travell
McPartland, J. M.
Journal of Osteopathic Medicine, 2002/10

1861

Osteopathic perturbation and immune network compensation
Degabriele, R.
Journal of Osteopathic Medicine, 2002/10

1862

From the Archives: Vindication
Bennett, G. M.
The AAO Journal, 2002/09
Free full text

1863


1864

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text

1865

Educating health professionals, first responders, and the community about bioterrorism and weapons of mass destruction
Silvagni, A. J., Levy, L. A., McFee, R. B.
The Journal of the American Osteopathic Association, 2002/09
Free full text

1866

Osteopathy in the cranial field: uncovering challenges and potential applications
King, H. H.
The Journal of the American Osteopathic Association, 2002/07
Free full text

1867

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text


1869

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text

1870

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text

1871

Joint cracking and popping: understanding noises that accompany articular release
Protopapas, M. G., Cymet, T. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text

1872

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04


1874

The immune network and homeostasis
Degabriele, R.
Journal of Osteopathic Medicine, 2002/04

1875


1876

'We will look for health': the Osteopathic Center for Children
Chilton, K.
Alternative Therapies in Health and Medicine, 2002/03

1877

Tackling birth trauma with cranio-sacral therapy
Turney, J.
The Practising Midwife, 2002/03

1878

From the Archives: Osteopathic Fundamentals
Page, L. E.
The AAO Journal, 2002/03
Free full text

1879


1880

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text


1882

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02

1883

Proposed tenets of osteopathic medicine and principles for patient care
Rogers, F. J., D'Alonzo, G. E., Jr., Glover, J. C., Korr, I. M., Osborn, G. G., Patterson, M. M., Seffinger, M. A., Taylor, T. E., Willard
The Journal of the American Osteopathic Association, 2002/02
Free full text

1884

Can an Internet-based system assist with administration and distance learning for third- and fourth-year rural clinical rotations?
Baker, H. H., Foster, R. W., Cope, M. K., Boisvert, C., Wallace, G. H.
The Journal of the American Osteopathic Association, 2001/12
Free full text


1886

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text

1887

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text

1888

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text


1890

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text



1893

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1894

A framework for and case study of medical informatics development at Michigan State University College of Osteopathic Medicine
Notman, M., Greene, J. F.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1895

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1896

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1897

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text

1898

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text

1899

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text

1900

Hands on care
Turney, J.
Nursing Standard, 2001/10

1901

Measurement challenges in physical diagnosis: refining inter-rater palpation, perception and communication
Comeaux, Z., Eland, D., Chila, A. G., Pheley, A., Tate, M.
Journal of Osteopathic Medicine, 2001/10

1902

Considerations for planning and conducting clinic-based research in physical therapy
Fitzgerald, G., Delitto, A.
Journal of Osteopathic Medicine, 2001/10

1903

Examining diagnostic tests: An evidence-based perspective
Fritz, J., Wainner, R.
Journal of Osteopathic Medicine, 2001/10

1904

Patient positioning and spinal locking for lumbar spine rotation manipulation
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10


1906

Destiny of osteopathic profession. 1916
Meacham, W. B.
The Journal of the American Osteopathic Association, 2001/10

1907

Cervical spine manipulation and the precautionary principle
Vautravers, P., Maigne, J.Y.
Journal of Osteopathic Medicine, 2001/10


1909

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text

1910

Andrew Taylor Still Memorial Lecture: the osteopathic difference--is it only manipulation? 1984
Siehl, D.
The Journal of the American Osteopathic Association, 2001/10

1911

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09

1912

A research program for the osteopathic profession. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2001/09
Free full text

1913

Research our great and only hope
Snyder, O. J.
The Journal of the American Osteopathic Association, 2001/09
Free full text

1914

Elbow injuries in golf
Stockard, A. R.
The Journal of the American Osteopathic Association, 2001/09
Free full text


1916

Angina pectoris with special reference to its mechanical causes. 1938
Appleyard, E. C.
The Journal of the American Osteopathic Association, 2001/08
Free full text

1917

Osteopathic treatment of the common cold. 1937
Becker, A. D.
The Journal of the American Osteopathic Association, 2001/08
Free full text

1918

The osteopathic lesion as the etiological factor in some common surgical disorders. 1948
Conley, G. J.
The Journal of the American Osteopathic Association, 2001/08
Free full text

1919

Methods of applying manipulative technic. 1945
Burns, L.
The Journal of the American Osteopathic Association, 2001/07
Free full text

1920

Soft tissues in areas of osteopathic lesion. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/07
Free full text

1921

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

1922

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

1923

Cold-induced urticaria
Mahmoudi, M.
The Journal of the American Osteopathic Association, 2001/05
Free full text

1924

A randomized clinical trial of exercise and spinal manipulation for patients with chronic neck pain
Bronfort, G., Evans, R., Nelson, B., Aker, P. D., Goldsmith, C. H., Vernon, H.
Journal of Osteopathic Medicine, 2001/04

1925

Evaluation of acute headaches in adults
Clinch, C. R.
Journal of Osteopathic Medicine, 2001/04

1926

Spinal manipulation: Indications, risks and benefits
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/04

1927

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text

1928

Balanced on a tight rope between low back pain and evidence-based practice
Shacklock, M.
Journal of Osteopathic Medicine, 2001/04

1929

Osteopathic treatment considerations for rheumatic diseases
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2001/04
Free full text

1930

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text

1931

Abbreviations for use in osteopathic case notes
Fryer, G.
Journal of Osteopathic Medicine, 2001/04


1933

Review of Sacral Somatic Dysfunction
Janiak, D. D.
The AAO Journal, 2001/03
Free full text

1934

The primary respiratory mechanism beyond the craniospinal axis
Lee, R. P.
The AAO Journal, 2001/03
Free full text

1935

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text

1936

Researched and demonstrated: inquiry and infrastructure at osteopathic institutions
Gevitz, N.
The Journal of the American Osteopathic Association, 2001/03
Free full text

1937

The somatic components of disease. 1956
MacBain, R. N.
The Journal of the American Osteopathic Association, 2001/03
Free full text

1938

Osteopathische Medizin
(Osteopathic Medicine)
Tempelhof, S., Weingart, J. R.
Erfahrungsheilkunde, 2001/03

1939

Muscle and the myoneural junction. Their relation to segmental spinal dysfunctions. 1955
Cole, W. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1940

Analyzing the osteopathic lesion. 1940
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1941

The place of the osteopathic concept in the healing art. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/01
Free full text

1942

Collaboration on research picks up steam
Dyer, M. J., Wood, D. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text

1943

Osteopathy--fifty years later. Founders Memorial Lecture. 1951
Fischer, R. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text

1944

Minor depression in primary care
Banazak, D. A.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1945

Endoscopic retrograde cholangiopancreatography: what role does it have in primary care?
Biery, D. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1946

Sleep-related gastroesophageal reflux
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1947

Spirituality in Osteopathic Medicine
Lee, R. P.
The AAO Journal, 2000/12
Free full text

1948

What osteopathists stand for in legislation. 1910
Hildreth, A. G.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1949

Government control of medicine
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1950

A primary care approach to pediatric gastroesophageal reflux
Sunku, B., Marino, R. V., Sockolow, R.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1951

The future in retrospect. 1935
Swope, C. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1952

Tendencies in a social, political, and governmental way which may influence doctors. 1937
Thomas, E. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text


1954

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1955

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1956

The venous side: current directions in anticoagulant therapy
Kaatz, S.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1957

Long-term therapy of coronary artery disease: a vascular biology perspective
Mathé, A. J., Clearfield, M. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1958

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1959

Diagnosis and treatment of carotid artery stenosis
Mintz, B. L., Hobson, R. W.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1960

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1961

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1962

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1963

Thrombolytic, antithrombin, and antiplatelet treatment of acute coronary syndromes
Puma, J. A., Sketch, M. H.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1964

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1965

The clinical spectrum of acute coronary syndromes
Rogers, F. J.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1966

How West Virginia School of Osteopathic Medicine achieves its mission of providing rural primary care physicians
Stookey, J. R., Baker, H. H., Nemitz, J. W.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1967

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1968

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1969

Osteoporosis
Cymet, T. C., Wood, B., Orbach, N.
The Journal of the American Osteopathic Association, 2000/10

1970

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text

1971

Managing common problems in perimenopausal women
Forstein, D. A.
The Journal of the American Osteopathic Association, 2000/10

1972

Vascular medicine and osteopathic medicine: treating the whole patient
Gironta, M. G., Rosenfeld, C. R.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1973

Endovascular treatment of peripheral arterial disease
Gray, B. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1974

Glycation as the glucose link to diabetic complications
Gugliucci, A.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1975

Hypertension and renal artery stenosis: a complex clinical scenario
Jaff, M. R.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1976

Clinical use of selective estrogen receptor modulators
Krueger, P. M.
The Journal of the American Osteopathic Association, 2000/10

1977

Diagnosis and medical management of patients with intermittent claudication
LaPerna, L.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1978

Influencing the vegetative nervous system through manipulation. 1945
Northup, G. W.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1979

Update: the latest on hormone replacement therapy
Packin, G. S.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1980

Spirituality in history taking
Spaeth, D. G.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1981

The autonomic nervous system in osteopathic therapy. 1948
Waitley, D. D.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1982

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1983

Headache as a manifestation of otolaryngologic disease
Cosenza, M. J.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1984

The Role of Vibration or Oscillation in the Development of Osteopathic Thought
Comeaux, Z. J.
The AAO Journal, 2000/09
Free full text

1985

An Ancient Persian High-Velocity, Low-Amplitude Thrusting Technique for Somatic Dysfunctions of the Thoracic Spine
Namazian, M., Clark, R. C., Binkerd, J.
The AAO Journal, 2000/09
Free full text

1986

Carpal tunnel syndrome: more than just a problem at the wrist
Ramey, K. A.
The AAO Journal, 2000/09
Free full text

1987

Osteopathic cranial lesions. 1948
Kimberly, P. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1988

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1989

Psychologic aspects of chronic headache
Mueller, L.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1990

The cranial bowl. 1944
Sutherland, W. G.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1991

Treatment of acute migraine attacks
Weintraub, J. R.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1992

Strategic choices for a primary care advantage: re-engineering osteopathic medicine for the 21st century
Glover, S. H., Rivers, P. A.
Health Services Management Research, 2000/08

1993

Circadian rhythm sleep disorders
D'Alonzo, G. E., Krachman, S. L.
The Journal of the American Osteopathic Association, 2000/08
Free full text

1994

Dangers of sleepiness and inattention while driving
Eberhart, R., Hu, X., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text

1995

Sleep and breathing disorders: the genesis of obstructive sleep apnea
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text

1996

Osteopathy and insanity. 1917
Gerdine, L. V.
The Journal of the American Osteopathic Association, 2000/08
Free full text

1997

Schizophrenia. 1939
Hildreth, A. G., Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text

1998

Workup and indications for polysomnography in patients with sleep-related complaints
Knox, K. S., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text

1999

Osteopathic and “old school“ results in mental diseases. 1933
Merrill, E. S.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2000

Psychosis and osteopathy
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2001

The mechanism of anatomical structure in its relation to osteopathy. 1911
Bernard, H.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2002

Clinical research: the process
Goldstein, F. J.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2003

The emerging concept of the osteopathic lesion. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2004

Latex allergy: a primary care primer
Mahmoudi, M., Hunt, L. W.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2005

Inhaled corticosteroid-induced bone loss and preventive strategies
Singh, R. F., Muskelly, C. C.
The Journal of the American Osteopathic Association, 2000/07
Free full text


2007

Osteopathic practice. 1903
Bernard, H. E.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2008

Rural osteopathic family physician supply: past and present
Tooke-Rawlins, D.
The Journal of Rural Health, 2000/06

2009

From the Archives: Prenatal Care
Grow, O. P.
The AAO Journal, 2000/06
Free full text

2010

Cardiovascular disease and obstructive sleep apnea: implications for physicians
Foresman, B. H., Gwirtz, P. A., McMahon, J. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2011

The compensatory pattern, as seen in art and osteopathy
Quinn, A.
The AAO Journal, 2000/06
Free full text

2012

Palpatory diagnosis. 1932
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2013

A glimpse of Dr. Still's art. 1917
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2014

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05


2016

Influenza and its osteopathic management. 1937
Ward, E. A.
The Journal of the American Osteopathic Association, 2000/05
Free full text

2017

Osteopathic success in the treatment of influenza and pneumonia. 1919
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/05
Free full text

2018

Somatic sensory impulses and vertebral lesions. 1921
Burns, L.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2019

Use of magnetic resonance imaging to diagnose common wrist disorders
DiMarcangelo, M. T., Smith, P. A.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2020

Early research: the A.T. Still Research Institute and Louisa Burns
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2021

Osteopathie - Die sanfte Chirotherapie
(Osteopathy - The gentle chirotherapy)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2000/04

2022

Research Directions From 1940-1988
Beal, M. C.
The AAO Journal, 2000/03
Free full text

2023

Advancing Osteopathic Medicine in Health Care: Integrating OMM into Osteopathic Medical Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 2000/03
Free full text

2024

The overactive bladder in multiple sclerosis
Fingerman, J. S., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 2000/03
Free full text

2025

Office evaluation of the patient with an overactive urinary bladder
Kowalczyk, J. J.
The Journal of the American Osteopathic Association, 2000/03
Free full text

2026

Surgical and medical treatment options for urge incontinence
Lonsway, J. M.
The Journal of the American Osteopathic Association, 2000/03
Free full text

2027

Manual medicine treatment of the cervical spine and whiplash injury
Bilkey, W. J., Tomski, M. A.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02

2028

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02

2029

The Comprehensive Osteopathic Medical Licensing Examination, COMLEX-USA: a new paradigm in testing and evaluation
Osborn, G. G., Meoli, F. G., Buser, B. R., Clearfield, M. B., Bruno, J. P., Sumner-Truax, L.
The Journal of the American Osteopathic Association, 2000/02
Free full text

2030

Reiter's syndrome and reactive arthritis
Parker, C. T., Thomas, D.
The Journal of the American Osteopathic Association, 2000/02

2031

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02

2032

The economic burden of back pain in the UK
Maniadakis, N., Gray, A.
Pain, 2000/01

2033

Management of osteoporosis in the new millennium
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2000/01

2034

Osteoporosis: a new understanding of its impact and pathogenesis
Chopra, A.
The Journal of the American Osteopathic Association, 2000/01

2035

Effective strategies for the prevention of osteoporosis across the life span
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2000/01

2036

Role of antileukotriene agents in asthma therapy
Gawchik, S. M., Saccar, C. L.
The Journal of the American Osteopathic Association, 2000/01
Free full text

2037

Osteopathy an independent system co-extensive with the science and art of healing. 1901
Littlejohn, J. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text

2038

Evaluation of osteoporosis
Nichols, K. J.
The Journal of the American Osteopathic Association, 2000/01

2039

Muscle energy concepts - a need for change.
Fryer, G.
Journal of Osteopathic Medicine, 2000
Free full text

2040

What's in a name? For DOs, plenty
Guglielmo, W. J.
Medical Economics, 1999/12

2041

An overview of osteopathic medicine
Lesho, E. P.
Archives of Family Medicine, 1999/11


2043

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text

2044

Gastroesophageal reflux disease update for the primary care physician
Mitz, H. S.
Journal of Osteopathic Medicine, 1999/08
Free full text

2045

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text

2046

An osteopathic approach to asthma
Rowane, W. A., Rowane, M. P.
Journal of Osteopathic Medicine, 1999/05
Free full text

2047


2048

Visualization technology in medical education
Gorbis, S., Hallgren, R. C.
Journal of Osteopathic Medicine, 1999/04
Free full text

2049

So you want to be an ... osteopath
Hocking, J.
Nursing Times, 1999/03

2050

A century of radiology in osteopathic healthcare
Rosenbaum, R. R.
Journal of Osteopathic Medicine, 1998/12
Free full text

2051


2052

Women's health osteopathy: an alternative view
Hyne, J.
Nursing Management, 1998/12

2053

AOA continuing medical education
Rodgers, D. J.
Journal of Osteopathic Medicine, 1998/11
Free full text

2054

Osteopathic graduate medical education
Swallow, C. S., Bronersky, V. M., Falbo, P. W.
Journal of Osteopathic Medicine, 1998/11
Free full text

2055

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text

2056

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text

2057

Research programs of the AOA and their role in osteopathic medical education
McGill, S. L., Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text

2058

Income and expenditures of osteopathic medical colleges
Kowert, C.
Journal of Osteopathic Medicine, 1998/11
Free full text

2059


2060

Undergraduate osteopathic medical education
Kowert, C.
Journal of Osteopathic Medicine, 1998/11
Free full text

2061

Certification of osteopathic physicians
Glatz, L., Dolan, S.
Journal of Osteopathic Medicine, 1998/11
Free full text

2062

L'ostéopathie et la chiropraxie.
(Osteopathy and chiropractic)
Klein, P.
Revue médicale de Bruxelles, 1998/09

2063

Integrating cranial osteopathy with gnathologic orthopedics
Kennedy, J. M.
The Journal - American Academy of Gnathologic Orthopedics, 1998/09

2064

The origin and relief of common pain
Irvin, R. E.
Journal of Back and Musculoskeletal Rehabilitation, 1998/09

2065

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text

2066

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06

2067

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05

2068

Muscle energy concepts and coupled motion of the spine
Gibbons, P., Tehan, P.
Manual Therapy, 1998/05



2071

The medical school curriculum for the 21st century
Wood, D. L., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/02

2072

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02


2074

Positional release techniques in the treatment of muscle and joint dysfunction
Chaitow, L.
Clinical Bulletin of Myofascial Therapy, 1998/01

2075

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01

2076

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12

 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends