Advanced search



 
 79.5% of the records
 
 20.5 % of the records
 
 57.8 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumablack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3cability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxishair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

653 results (please see below)  Sort:    
1

Race, ethnicity, and gender discrepancies between allopathic and osteopathic otolaryngology trainees from 2015 to 2023
Minutello, K. M., Nicks, S. L., Gillette, B. T., Hasan, S., Shermetaro, C. B.
Journal of Osteopathic Medicine, 2026/01
Free full text

2

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/12
Free full text

3

Analysis of hepatitis B immunity in vaccinated medical students
Gentile, N., Aghera, C., Smith, H., Mazzoleni, S., Redden, D., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2025/12
Free full text

4

Is Research Fun? A Survey of Osteopathic Medical Students
Amendolara, A., Homan, M., Thorpe, L., Payne, A., Stacey, S. K., Small, C.
Journal of Osteopathic Medicine, 2025/12

5

Analyzing Medical Student Knowledge Regarding Nutrition
Barros, M., Weir, S.B., Bennett, A.
Journal of Osteopathic Medicine, 2025/12



8

Enhancing Transitional Support for First-Year Medical Students: An Osteopathic, Student-Centered Perspective
Hartman, T., Pookkattu, M., Dearden, S., Venkataraman, V.
Journal of Osteopathic Medicine, 2025/12

9

Bridging Communication Gaps: Exploring Medical Students’ Understanding and Experiences in Caring for Patients with Hearing Impairments and Language Barriers
Kim, A., Nolin, J. R., Bracy, H., Berko, H., Mazzorana, A., Leiber, K., Hernandez, E.
Journal of Osteopathic Medicine, 2025/12

10


11

Evaluating Student Mental Health Resource Utilization and Self-Perceived Mental Health
Muppala, M. S., Sanapala, C., Shields, E., Kemp, E., Goldsteen, R., Tano, S., Grewal, P.
Journal of Osteopathic Medicine, 2025/12

12

Bridging the Gap: A Tri-campus Survey on Student Confidence in Applying OMT in Neurological Conditions
Nallanukala, G. S., Noto-Bell, L., Nallanukala, V.
Journal of Osteopathic Medicine, 2025/12

13

Pushing into the Barrier: Investigating the Use of OMM Among 3rd and 4th Year Medical Students
Pirzadeh, N., Dona, C. G., Valencia, R., Anche, G., Liang, W. M., Chen, D., Para, R., Volokitin, M.
Journal of Osteopathic Medicine, 2025/12


15

Zink’s Fascial Patterns Among First- and Second-Year Medical Students
Rutt, G., Graham, M., Boesler, D.
Journal of Osteopathic Medicine, 2025/12

16

D.O. Podcast Increases Pre-Medical Student Knowledge and Attitudes Toward Osteopathic Medicine
Sullivan, V. E., D'Amelio, M. P., Storch, I. M., van Rooyen, D. R., Storch, N. C., Callaway, C. A., Pierce-Talsma, S. L., Hauler, J. J.
Journal of Osteopathic Medicine, 2025/12


18

Perceptions of Campus Climate and Inclusivity Among LGBTQIA+ Osteopathic Medical Students: A Cross-Sectional Study
Varin, P., Temucin, S., Reese, A., Florescu, N., Grace, C., Bettiker, R., Sonneville, K., Fiscus, V., Tanaka, L.A.
Journal of Osteopathic Medicine, 2025/12

19

Factors Affecting Medical Student Participation in Student Evaluations of Teaching: A Retrospective Study
Walker, R., Tucker, S., Smith, M. L.
Journal of Osteopathic Medicine, 2025/12

20

Effect of positional asymmetry palpatory models on improvement and retention of accuracy during pelvic asymmetry assessments
Hajicek, J. M., Huhn, M. B., Thurgood, A., Isemann, E. N., Barnwell, C. B., Starks, Z., Ying-Fang Wang, M., Degenhardt, B. F.
Journal of Osteopathic Medicine, 2025/12
Free full text

21

Reclaiming the body: The mental health imperative of embodied learning in physiotherapy education
Cahyono, B. D., Rahmawati, A., Aditya, R. S., Huda, N., Aristawati, E., Amalia, R., Kartikasari, D.
International Journal of Osteopathic Medicine, 2025/12

22

Response to the letter to the editor: Reclaiming the body: The mental health imperative of embodied learning in physiotherapy education
Eccott, L., Moulson, A., Atkinson, K., Livatino, S., Lewis, J., Cairns, M.
International Journal of Osteopathic Medicine, 2025/12

23

Evaluating Research Preparedness and Skill Gaps Among Osteopathic Medical Students Pursuing Surgical Specialties
Beerman, S. A., Stucki, B., Wong, R., Alexander, V. S., Vogel, A., Heard, M. A., Wallen, T. J.
Cureus, 2025/12
Free full text

24

Enhancing the Awareness of Osteopathic Learning Opportunities Through a Newsletter
Eilerman, A., Benton, A., Shneker, N., Abdo, M., Mar, D., Faherty, M., Reynolds, R.
AAO Journal, 2025/12

25

Medical Student Perspectives on Abortion Education in US Osteopathic Medical School Curricula
Steffes, R., Thakur, P., Cox, S., Adams, C., Creamer, B. A., Dennis, J. F.
Perspectives on Sex and Reproductive Health, 2025/12

26

Geographical distribution of osteopathic urology residents and match trends in the United States
Wong, R., Eke, B., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/11
Free full text

27

A quantitative analysis comparing pre-clinical volunteering hours with third-year medical students' preceptor evaluations
Ranta, E. K., Ranta, J. C., Redden, D., Stoner, A. M.
Journal of Osteopathic Medicine, 2025/11
Free full text


29

Assessing fundamental clinical skills of osteopathic medical students
Boulet, J. R., Sandella, J. M., Gimpel, J., LaBaere, R.
Journal of Osteopathic Medicine, 2025/10
Free full text

30

Affirmative Action Repeal and Racial and Ethnic Diversity in US Medical School Admissions
Florescu, N., Lin, A., Temucin, S., Rae, L.
JAMA Network Open, 2025/10
Free full text

31

From Simulation to Surgery: Gauging Surgical Interest in Osteopathic Medical Students Through Cadaveric Simulation: A Pilot Study
Paladichuk, S., Chase, T., Downs, A., Heck, C., Cortner, M., Cornwell, H., Shang, T., Brennan, Z., Walser, R. F., Kerber, K., Wallen, T.
Journal of Medical Education and Curricular Development, 2025/10
Free full text

32

Predicting COMLEX-USA Level 2-CE using medical school performance and use for student advising
Wang, S., Basehore, P.
Journal of Osteopathic Medicine, 2025/10
Free full text

33

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/10
Free full text


35

Preceptor-Ranked Competencies in Osteopathic Medical Students: A Comparison of General Surgery and Surgical Subspecialties
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Garg, R., Thacker, R. R., Roach, S. L.
Cureus, 2025/10
Free full text


37

Corrigendum to: The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T.H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/09
Free full text

38

A proven template for providing streamlined, scalable, cost-effective clinical research opportunities in osteopathic medical schools
Greek, J. N., Greek, A. P., Hopper, M., Arnce, R.
Journal of Osteopathic Medicine, 2025/09
Free full text

39

Medical student perceptions of psychiatric conditions and the impact of stigmatizing language
Monahan, Z., Stevens, V., Hartwell, M., Ford, A. I.
Journal of Osteopathic Medicine, 2025/09
Free full text

40

Why is identification with osteopathy decreasing in medical students?
Kauffman, Z. S., Harper, T., Augustyniak, R. A., Ruff, C.
Journal of Osteopathic Medicine, 2025/09
Free full text

41

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/09

42

Abstracts From the Third Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 13, 2025
Akenami, F. O., Ismail, R., Obando Solano, C. P., Amalfitano, A.
Spartan Medical Research Journal, 2025/09
Free full text



45

Dermatology match disparities: analyzing osteopathic vs. allopathic student outcomes post-ACGME/AOA single accreditation system (2020-2024)
Wan, L., Bawa, K., Park, A., Kadri, H., Cusick, A., Trotter, S. C.
Journal of Osteopathic Medicine, 2025/09

46

Osteopathic Manipulative Treatment (OMT) Protocol on Sleep Quality in Medical Students as Measured by the Fitbit Smart Watch: A Pilot Study
Radigan, R., Finkelstein, A., Lee, B., George, E., Bhushan, P., Sousa, A., Yao, S. C.
The AAO Journal, 2025/09




50

Impact of osteopathic tests on heart rate and heart rate variability: an observational study on osteopathic students
Gillet, F., Gault, M., Dussault, V., Cheggour, S., Grinand, M., Martinez, P.
Journal of Osteopathic Medicine, 2025/08
Free full text

51

The impact of a summer research internship program on research engagement of osteopathic medical students
Bishayee, A., Wallace, M. A., Bobak, A. K., Sasher, T. L., Alvarez, L. A., Flink, T. S.
Journal of Osteopathic Medicine, 2025/07
Free full text

52

Exploring the Characteristics and Competencies of Successful Osteopathic Medical Students on General Surgery Clerkship
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Thacker, R. R., Roach, S. L.
Cureus, 2025/07
Free full text

53

A Pilot Study of Orthopedic Applicants Regarding Sub-internship Number, Cost, and Preferences
Schultz, M. J., Riebesell, S., Lutz, R. W., McCahon, J., Suarez, J. D., Purtill, J., Daniel, J.
Cureus, 2025/07
Free full text

54

Predicting First-Semester Performance of First-Year Medical Students in a Changing Landscape
Walker, M., George, A., Mohsin, S., Nichani, R., Garg, R., Chosie, K., Kennedy, C.
Cureus, 2025/07

55

Enabling Exploration: Examining the Availability and Adequacy of Conference Funding for Medical Students
Allison, S. G., Soltani, H., Chwa, E. S., Shuaibi, D. W., Allison, K. R., Gosain, A. K.
Plastic and Reconstructive Surgery-Global Open, 2025/07
Free full text

56

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text

57

The effectiveness of training student physicians in culturally sensitive patient care using an interprofessional culturally competent curriculum
Aminpour, A., Gelvin, M., Smurzynski, A., Gardner, F., Gardere, J.
Journal of Osteopathic Medicine, 2025/07
Free full text

58

Building Community With Community: Collaborative Reflections on the Rural and Urban Community Orienting Experience (RUCOE)
Casapulla, S., Kropf, K., Kalout, S., Lingerak, S.
Teaching and Learning in Medicine, 2025/07

59

A survey of sexual harassment and assault in osteopathic medical schools
Chiriboga, K., Zeller, M., LaPlante, M., Prasad, C.
BMC Medical Education, 2025/07
Free full text

60

Lessons learned from the digital transformation of physiotherapy education: A phenomenological study
Eccott, L., Moulson, A., Atkinson, K., Livatino, S., Lewis, J., Cairns, M.
International Journal of Osteopathic Medicine, 2025/06
Free full text


62

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06

63

Gender Sensitivity in Osteopathy: The Challenge of Diagnosing Pubic Symphysis Somatic Dysfunctions
Velasquez, L., Walker-Elders, A., Feygin, H., Hahn, D., Lee, D., Volokitin, M.
The AAO Journal, 2025/06


65

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/06
Free full text




69

Recent and future trends in osteopathic orthopedic surgery residency match rates following the transition to a single accreditation system
Turnow, M., Nemani, M. G., Gupta, N., Hartman, H., Manes, T., Williamson, T., Gianakos, A.
Journal of Osteopathic Medicine, 2025/05
Free full text

70

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2025/05
Free full text

71

International medical graduate orthopaedic residents show higher research productivity than United States graduate peers before and during residency
MacLeod, J. S., Jacome, F., Mansour, H., Lee, M. S., Akwuole, F., Cho, S., Lee, J., Lema, O., Chopra, A., Bakaes, Y., Painter, S., Baker, H., Mejia, A.
International Orthopaedics, 2025/05

72

Residency Program Characteristics Associated With Osteopathic Resident Representation
Nikolla, D. A., Sachdeva, V., Distefano, A., Bryan, A., Mudrakola, V., Milliron, M. L., Bowers, K. M.
Cureus, 2025/04
Free full text

73

“Transition to Clinical Years“ Podcast Series: A Pilot Project to Support Rising Third-Year Students
Price, K. W., Bhagtani, H., Abraham-Hardee, S., Yeager, D., Anandakrishnan, R.
Cureus, 2025/04
Free full text

74

Does Malpractice Risk Deter Medical Students From Pursuing Obstetrics and Gynecology?
Thai, A., Huynh, K., Pickering, T., Maron, A., Wang, L., Stohl, H.
Cureus, 2025/04
Free full text

75

A cross-sectional study of newly established medical schools in the United States: student body diversity remains an unmet challenge
Oyoun Alsoud, L., West, K., Sorrell, S., Andolsek, K. M., Al Hageh, C., Ibrahim, H.
Medical Education Online, 2025/04
Free full text

76

An Investigation of Second-Year Medical Students' Use of Outside Resources at Two Institutions
Berry, A., Campbell, A., Li, D., Bay, C., Ikonne, U.
Medical Science Educator, 2025/04
Free full text

77

A comprehensive review of clinical experiences and extracurricular activities for US premedical students applying to osteopathic medical schools
Kadavakollu, S., Dang, T., Bains, J., Ham-Ying, J., Boyanovsky, B., Qureshi, M., Graneto, J., Richards, S.
Journal of Osteopathic Medicine, 2025/04
Free full text



80

Addressing confounding factors in the match disparities between DO and MD seniors
Bohler, F.
Journal of Osteopathic Medicine, 2025/03
Free full text


82

Assigning Commercial Off-The-Shelf (COTS)-Based Board-Style Pharmacology Practice Questions to Medical Students
Ghayur, M. N., Ghayur, A.
The Journal of Pharmacology and Experimental Therapeutics, 2025/03



85

Determining the effects of social media engagement on surgery residents within the American College of Osteopathic Surgeons
Alexander, V. S., Eke, B., Xu, A., Wong, R., Greek, A., Ernst, M., Roberts, H., Ariwodo, O., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/02
Free full text


87

Development and Implementation of the “Exercise is Medicine“ Elective at an Osteopathic Medical School
Mitchell, C., DeMartino, S., Ivers, L., Brown, A., Maccabee, E., Griffith, B., Pankey, C. L.
Medical Science Educator, 2025/02
Free full text

88

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text


90

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01


92

The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T. H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/01
Free full text


94

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text

95

A call to include intersectionality on board examinations
Dozier, D. R., Rodríguez, J. E.
Journal of Osteopathic Medicine, 2024/12
Free full text

96

Making the Cut: A Six-Year “Bone-afide“ Membership Trend From Student to Surgeon
Nemani, M. G., Barham, E., Sees, J. P.
Cureus, 2024/12
Free full text

97

Student perception of Case Based Learning at a medical school in New York before and during the COVID-19 pandemic
Bhurtyal, K. K., Kung-Lau, S., Pino, M. A.
Journal of Osteopathic Medicine, 2024/12

98

Institutional Funding of Medical Students for Research Conferences: Is There a Benefit for the NRMP?
Dennis, J. F., Khan, H., Papatheofanis, C., Agollari, K., Marino, R., Schumann, T., Woolhiser, E.
Journal of Osteopathic Medicine, 2024/12

99

Effectiveness of Prematriculation Programs for Student Success in Medical School
Frontz, A., Sheridan, L., Davidson, K., Gundler, C.
Journal of Osteopathic Medicine, 2024/12

100

Outreach Education led by Osteopathic Medical Students on Substance Use Prevention for Sustainable Health Literacy in Underserved Youth Communities
Garg, E., Gogineni, K., Mahimkar, S., Jambunathan, V., Jamal, L., Nazaroff, C., Restini, C.
Journal of Osteopathic Medicine, 2024/12


102

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12


104

Building Disability Competency in Osteopathic Medical Students in Rural Ohio Pilot Study
Hughes, A., Barrett, J., Dillman, O.
Journal of Osteopathic Medicine, 2024/12




108

Osteopathic Medical Student Experiences with Assessing Red-Reflex in Different Skin Tones
Shah, P., Curran, S.
Journal of Osteopathic Medicine, 2024/12

109

Evaluation of the Use of 3D Printed Spinal Models to Educate and Assess Osteopathic Medical Students
Valdés, D., Zarandy, J., Sherrington, M., Cohen, M., Matechak, J.
Journal of Osteopathic Medicine, 2024/12

110

Third-year medical students' perceptions of confidence and readiness to perform EFAST after training
Rocic, P., Garrison, R., Stitle, K., Reynolds, A., Andrews-Dickert, R.
BMC Medical Education, 2024/12
Free full text

111

Concerns of osteopathic medical students during the COVID-19 pandemic
Hanna, O., Vinyard, C. J., Casapulla, S.
Journal of Osteopathic Medicine, 2024/11
Free full text

112

Unpacking ABSITE Performance: Evaluating International vs Domestic Medical Graduates and DO vs MD Trainees in a Joint Residency Program
Rahimpour, A., Baxter, J. D., Fox, D. W. N., Morrison, M., Denning, D. A., Ray, P. D., Barry, R.
Journal of the American College of Surgeons, 2024/11

113

Feasibility of a cinematic-virtual reality training program about opioid use disorder for osteopathic medical students: a single-arm pre–post study
Rehl, D., Mangapora, M., Love, M., Love, C., Shaw, K., McCarthy, J., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/11
Free full text

114

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text

115

Students with prior anatomy experience start out stronger in medical school gross anatomy
Louro, M. D., Meegan, G., Rudin, L. R., Granatosky, M. C., Thompson, N. E.
Anatomical Sciences Education, 2024/10

116

Response to “Fostering a research culture in osteopathic medical education”
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2024/10
Free full text

117

Fostering a research culture in osteopathic medical education
Kadavakollu, S., Dang, T., Richards, S.
Journal of Osteopathic Medicine, 2024/10
Free full text

118

Assessing nutrition literacy and nutrition counseling proficiency following an interdisciplinary culinary medicine elective
Kirby, A. N., DeBellis, J., Wolter, K., Mount, G., Wang, C.H., Bishop, J., Barkhouse, J., Wirth, K., Nguyen, N., Cacciatore, C., Kraus, K.
Journal of Osteopathic Medicine, 2024/10
Free full text

119

Improving learning experience through implementing standardized team-based learning process in undergraduate medical education
Andrews-Dickert, R., Nagaraj, R., Zhan, L., Knittig, L., Zhao, Y.
BMC Medical Education, 2024/10
Free full text



122

Integrating nutrition and culinary medicine into preclinical medical training
Johnston, E. A., Torres, M., Goldgraben, S., Burns, C. M.
BMC Medical Education, 2024/09
Free full text



125

Geographical Distribution of Osteopathic Neurosurgery Residents
Ariwodo, O., Greek, A., Wong, R., Alexander, V. S., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Cureus, 2024/09
Free full text

126

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text

127

An osteopathic orientation to interprofessional education
Martinez, E. S., Redding, D.
Journal of Osteopathic Medicine, 2024/09
Free full text

128

Professional skill priorities: Comparison views of osteopathy industry professionals and osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2024/09
Free full text

129

Changes in the Affective Empathy of Osteopathic Students: a Longitudinal Study
Newton, B. W., Vaskalis, Z. T.
Medical Science Educator, 2024/08

130

The WELLMESS Project (Move Well, Eat Well, Sleep Well, Stress Well)
Machireddy, D. R., Reid, C. G., Hollingsworth, J. C., Redden, D.
Cureus, 2024/08
Free full text

131

On-site peer mentorship’s effect on personal and professional development, stress reduction, and ease of transition into the medical education system
Whitfield, S., Hazard, C., Haynes, B., Coffey, T., Lynch, L., Davis, S.
Journal of Osteopathic Medicine, 2024/08


133

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text

134

The hindrance of matching into neurosurgery from doctors of osteopathic-medicine perspective
Kashif, M., Muthana, A., Al-Qudah, A. M., Hoz, S. S.
Surgical Neurology International, 2024/07
Free full text

135

Interest in Cardiothoracic Surgery Among the American College of Osteopathic Surgeons’ Medical Students
Vogel, A. D., Wynn, A. B., Richards, M. C., Sindoni, M., Brennan, Z., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2024/07

136

Evidence of anchoring bias in novice (first year) osteopathic French students in the context of the primary respiratory mechanism: A randomized-experimental study
Driaï-Allègre, C., Coste, F., Olmière, C., Grinand, M., Le Nohaïc, A., Romanet, F., Gourjon, G.
International Journal of Osteopathic Medicine, 2024/06

137

Somatic Dysfunction and Behavior Correlates in Medical Students
LaFontano, C. M., Huzij, T., Garlock, M., Speth, M., Ko, K., Crouch, N., McDaniel, R., McEchron, M.
The AAO Journal, 2024/06

138

Counterstrain Point Frequency and Treatment in Osteopathic Medical Students
Arnold, C., Quackenbush, D., Fahim, A., Quackenbush, G., Navarro, A., Edwards, C.
The AAO Journal, 2024/06

139

Exploring the Evolution of the Mind-Body Connection as First-Year Osteopathic Medical Students Learn about Common Osteopathic Dysfunctions
Krauss, A., Normil, N., Mosley, B., George, S., Volokitin, M., Milani, S., Henshaw, M.
The AAO Journal, 2024/06

140

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06

141

Learning Mindsets and Well-Being and Ill-Being Among Osteopathic Medical Students
Tibbetts, Y., Himmelberger, Z. M., Barron, K. E., Speicher, M. R., Hulleman, C. S.
JAMA Network Open, 2024/06
Free full text

142

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06


144

Research integrity and academic medicine: the pressure to publish and research misconduct
Kearney, M., Downing, M., Gignac, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text


146

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text

147

Interventions to promote medical student well-being: an overview of systematic reviews
Bennett-Weston, A., Keshtkar, L., Jones, M., Sanders, C., Lewis, C., Nockels, K., Solomon, J., Howick, J.
BMJ Open, 2024/05
Free full text


149

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text


151

Overcoming barriers to equality, diversity, inclusivity, and sense of belonging in healthcare education: the Underrepresented Groups' Experiences in Osteopathic Training (UrGEnT) mixed methods study
Draper-Rodi, J., Abbey, H., Hammond, J., Thomson, O. T., Brownhill, K., MacMillan, A., Fabusuyi, Y., Vogel, S.
BMC Medical Education, 2024/04
Free full text

152

The Academic Medicine and Leadership Track for Medical Students
Glaser, K., McEchron, M., Jensen, C., Park, D.
Medical Science Educator, 2024/04
Free full text

153

The Impact of Financial Education on Stress Among Orthopaedic Surgeons
Higginbotham, D. O., Nham, F. H., Cavazos, D. R., Chen, C., Stoker, S. K.
Cureus, 2024/04
Free full text

154

Effect of COVID-19 Curriculum Changes on Medical Student Exam Performance: A Case Series
Ho, J., Levy, J., Afshari, N., Patel, D., Andersen, S., Simanton, E., Linton, M.
Cureus, 2024/04
Free full text

155

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text

156

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03

157

A tailored training based on students’ and teachers’ needs to improve palpation skills: A quantitative part of a mixed-method study
Lavazza, C., Zangoni, G., Sozzi, F., Abenavoli, A., Barenghi, M.
International Journal of Osteopathic Medicine, 2024/03

158

Expansion of osteopathic medicine practitioner education on substance use disorders
Petrides, J., Jha, S., Kowalski, A., Hosein, S., Collins, P. B., Coren, J.
Journal of Osteopathic Medicine, 2024/03
Free full text

159

Medical Students' Knowledge, Attitudes Toward, and Identification of Adverse Childhood Experiences and Trauma-Informed Care
Piszczor, R., Barry, C., Gundacker, C., Wallace, C., Shibuya, J., Perle, J.
The Permanente Journal, 2024/03
Free full text

160

Cross-Sectional Analysis of the Effect of Physical Activity, Nutrition, and Lifestyle Factors on Medical Students' Academic Achievement
Neuman, J., Ina, E. A., Huq, S. O., Blanca, A., Petrosky, S. N.
Cureus, 2024/03
Free full text

161

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03

162

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text

163

Identified strategies to mitigate medical student mental health and burnout symptoms
Ozan, K. G., McGough, J. E. G., Gabel, J., Snow, M., Michel, N., Cooper, L., Robinson, K.
Journal of Osteopathic Medicine, 2024/02
Free full text

164

An assessment of surgery core rotation quality at osteopathic medical schools
Casey, T., Brennan, Z., Pereira, K., Young, G., Paluri, S. N., Gudakunst, C.
Journal of Osteopathic Medicine, 2024/02
Free full text

165

The clinical anatomy fellowship: A participants' perspective
Thiel, G. E., Murtha, C. M., Dennis, J. F., Hopper, M.
Anatomical Sciences Education, 2024/02

166

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text

167

Visual Health Impact of Online Learning During COVID-19 in Osteopathic Medical Students
Syed, Z., Quadri, S.
Journal of Osteopathic Medicine, 2023/12

168


169

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12

170

A Student-Driven Mindfulness Curriculum for First-Year Osteopathic Medical Students: A Pilot Study
Nielsen, C., Katz, S., Parker, M., Trefsgar, J., Bcharah, H., Kalin, J., Delavary, D., Brunk-Grady, M., Jaqua, B.
Journal of Osteopathic Medicine, 2023/12
Free full text

171

Osteopathic Medical Students’ Preferences for Viewing Lectures at a Multi-Campus Medical School
King, L., Rodgers, J., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12

172

The Effect of Osteopathic Medical Students’ Age on Desired Specialty
Raidah, A., Huang, P., Tariq, N., Wong, H., Hildreth, L., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12

173

Examining Osteopathic Medical Students’ Experiences with Distance Learning and Social Connectedness
Rodgers, J., King, L., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12


175

Building Interest in the Primary Care Specialty Through Enhanced Global Health Experience
Hernandez, M., Ibiwoye, M. O., Ledbetter, M., Thacker, R., Diaz, S.
Cureus, 2023/12
Free full text

176

Mental health differences in medical students based on curriculum and gender
Jestin, M., Sharma, S., Jhaveri, D., Mitchell, B., Micciche, D., Venkataraman, V., Lambert, K.
BMC Medical Education, 2023/12
Free full text

177

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text

178

Improving Transparency in the Residency Application Process: Survey Study
Ulin, L., Bernstein, S. A., Nunes, J. C., Gu, A., Hammoud, M. M., Gold, J. A., Mirza, K. M.
JMIR Formative Research, 2023/12
Free full text

179

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12

180

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/12
Free full text


182

Empathy Fatigue in Osteopathic Medical Students
Gernert, E., Malaker, P., Nguyen, T., Uptegrove, L., Nagireddi, S.
Journal of Osteopathic Medicine, 2023/12

183

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12


185

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12

186

Efficacy of Virtual Reality Programs versus Traditional Lectures on Osteopathic Medicine Information Retention
Jacob, T. J., Jose, R. M., Abraham, A., Syed, F., Tran, T.
Journal of Osteopathic Medicine, 2023/12


188

Assessing the Quality and Quantity of Research Among Incoming First-Year Osteopathic Medical Students
Lynch, S., Byrne, J., Sharieff, K.
Journal of Osteopathic Medicine, 2023/12

189

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12



192

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12

193

Ultrasound-assisted bony landmark palpation in untrained palpators
Nichols, J. W., Schmidt, C., Raghuraman, D., Turner, D.
Journal of Osteopathic Medicine, 2023/11
Free full text

194

A Pilot Study of Symptoms of Major Depressive Disorder in Medical Students at an Osteopathic Medical School Before and After High-Stakes Examinations
Arabatzis, T. J., Doroshenko, J., Ashraf, M. A., Smith, R. M.
Advances in Medical Education and Practice, 2023/11
Free full text

195

Building Interest in Cardiothoracic Surgery at an Osteopathic Medical School: Results of an Institutional Study and a Guide for Medical Schools
Vogel, A. D., Wynn, A., Sindoni, M., Richards, M. C., Eppler, A. R., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2023/11
Free full text

196

Enhancing Future Healthcare Professional Education Surrounding Substance Use Disorders
Riccio, K. K. C., Hales, K., Whittaker, A.
Journal of Addiction Medicine, 2023/10

197

Effects of a focused training on first-year osteopathic medical students' ability to incorporate point-of-care ultrasound in assessment of the anterior knee
Weaver, C., Heath, D. M., Makin, I. R. S., Hanamaika'i, K., Kanumalla, R., Matsushita, S., Chatta, P., Adhikari, S.
Journal of Osteopathic Medicine, 2023/10
Free full text

198

Assessing interest in cardiothoracic surgery at an osteopathic medical school: Results of an institutional survey
Vogel, A. D., Wynn, A., Richards, M. C., Sindoni, M., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
JTCVS Open, 2023/09

199

Equal but Separate: The Slow Assimilation of Osteopathic Surgery Residents Two Years After the Unified Match
Bello, G., Lyles, E., Owens, S., Wilson, A. S., Westby, R. W., Evans, W., Edmondson, E., Lindsey, T. G. II., Falcone, J. L., Boyev, A.
Journal of Surgical Education, 2023/09


201

The Evaluation of a Digital Health Intervention to Improve Human Papillomavirus Vaccine Recommendation Practices of Medical Students
Richman, A. R., Torres, E., Wu, Q., Eldridge, D., Lawson, L.
Journal of Cancer Education, 2023/08

202

Diversity Differences Among Cardiovascular Fellowships Across Five Geographic Regions in the United States
Dye, M., Saeed, A., Nguyen, T. Q., Yu, S., Bey, J., Hefner, D., Walk, C. T., Lantz, R.
Cureus, 2023/08
Free full text

203

Awareness and interest in osteopathic manipulative treatment in allopathic medical students
Darby, A., Parascando, J. A., Lipinski, M., Lipinski, C., Mendez-Miller, M., Berg, A., Rabago, D., Oser, T. K.
Journal of Osteopathic Medicine, 2023/08
Free full text

204

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/07

205

Integrating A Student Co-Created Health Systems Science Curriculum Within UME
Ethridge, B., Steadman, M., Crews, B.
Southern Medical Journal, 2023/07

206

Assessing Differences in Palpation Pressure between Osteopathic Medical Students and Osteopathic Physicians
Jacob, T., Khalid, A., Syed, F., Jose, R., Nikprelaj, K., Frankini, E., Yao, S., Toma, M.
The AAO Journal, 2023/06
Free full text


208

The Planetary Benefit of Suspending USMLE Step 2 CS: Estimating Carbon Emissions Associated with US Medical Students' Travel to Testing Centers
Sherpa, J. R., Donahue, L., Tsai, J., Nguemeni Tiako, M. J.
The Yale Journal of Biology and Medicine, 2023/06
Free full text


210

Assessing Clinical Reasoning in Medical Students Using a Virtual Patient Simulator
Abdulnour, R., O'Rourke, M., Smith, T.
Diagnosis, 2023/05

211

Virtual Deliberate Practice: Assessing Clinical Reasoning Using an Illness Script-based Simulator
Abdulnour, R. E., Furfaro, D., Sternschein, R., Smith, T. M., Drazen, J. M.
American Journal of Respiratory and Critical Care Medicine, 2023/05

212

Allopathic and Osteopathic Residents Perform Similarly on the Orthopedic In-Training Examination (OITE)
Gomez, C., Ranson, R., Gianakos, A., Miskimin, C., Mulcahey, M. K.
Journal of Surgical Education, 2023/05
Free full text

213

Establishing a baseline for multilingual capabilities of medical students at the Michigan State University College of Osteopathic Medicine
Tripathi, V., Wisniewski, S. J., Rowan, J., Ruger, K.
Journal of Osteopathic Medicine, 2023/05
Free full text




217

Barriers to research opportunities among osteopathic medical students
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2023/04
Free full text

218

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text

219

Evaluating the impact of a curriculum intervention using an assessment rubric for communication skill development of osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2023/03

220

Impact of COVID-19 on Rocky Vista University medical students' mental health: A cross-sectional survey
Paz, D. C., Bains, M. S., Zueger, M. L., Bandi, V. R., Kuo, V. Y., Payton, M., Ryznar, R. J.
Frontiers in Psychology, 2023/02
Free full text

221

Factors Leading to Successful Performance on U.S. National Licensure Exams for Medical Students: A Scoping Review
Jeyaraju, M., Linford, H., Bosco Mendes, T., Caufield-Noll, C., Tackett, S.
Academic Medicine, 2023/01


223

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12

224

Gender Differences in Stress, Anxiety, and Depression Perceived by Osteopathic Medical Students Within the Context of the COVID-19 Pandemic
Herr, V., Emanuel, J., Farid, A., Morris, A., Balentine, J., Blazey, W., Krishnamachari, B.
Journal of Osteopathic Medicine, 2022/12

225

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12

226

Student performance in medical biochemistry and genetics: comparing campus-based versus zoom-based lecture delivery
Faner, M. A., Ritchie, R. P., Ruger, K. M., Waarala, K. L., Wilkins, C. A.
BMC Medical Education, 2022/11
Free full text

227

Podiatric Medical Resident Wellness: A Group Survey Study
Deheer, P. A., Wolfe, W., Nichols, J. A., Badell, B. J., Patel, N. A.
Journal of the American Podiatric Medical Association, 2022/11

228

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match
McCormick, M. E., Seideman, C. A.
The Journal of Urology, 2022/09

229

Osteopathic Medical Students’ Subjective Preparedness for LGBTQ+ Patient Care and Influencing Factors: A Multi-Institutional Survey Study
Morimoto, K., Uy, J. C., Blair, L., Barab, H., Wu, W., Oosterbaan, C., Ozdowski, L., Guenther, E.
The AAO Journal, 2022/09
Free full text

230

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/09

231

Student Attitudes About Osteopathic Medical Schools: Increasing Student Willingness to Apply
Mattiace, S. M.
Unpublished Dissertation, 2022/08
Free full text

232

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text

233

Reported completion of the USMLE Step 1 and match outcomes among senior osteopathic students in 2020
Nikolla, D. A., Stratford, C. V., Bowers, K. M.
Journal of Osteopathic Medicine, 2022/07
Free full text

234

Osteopathic medical students’ understanding of race-based medicine
Jivens, M., Okafor, I., Beverly, E. A.
Journal of Osteopathic Medicine, 2022/06
Free full text

235

Effect of Physique on Medical Students’ Perceived Physical Ability to Perform Osteopathic Manipulative Treatment (OMT)
Than, S., Santos, L., Lin, X., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text

236

The Effects of a Novel Virtual Reality Osteopathic Manipulative Medicine Program on First Year Practical Exam Scores
Ahmed, E., Jose, J., Stout, R., Yao, S. C.
The AAO Journal, 2022/06
Free full text

237

Trauma-Informed Care Program Implementation for Osteopathic Medical Students
Boudreau, R., Hathaway, A.M., Harp, T., Chong, H., Modirian, F., Boghean, K., Bouquet, J.
The AAO Journal, 2022/06
Free full text

238

Blended Learning: Evaluating the effectiveness of various instructional methods
Garo, J. A., Dasar, Y., Nichols, M., Goering, E., Blumer, J.
The AAO Journal, 2022/06
Free full text

239

Native American Student Perspectives on Culturally Integrated Education at a Tribal College of Osteopathic Medicine
Gatewood, A., Terry, R., Bray, N., Hartwell, M.
The AAO Journal, 2022/06
Free full text

240

Effect of Medical School Experiences on Perceived Likelihood of Performing Osteopathic Manipulative Treatment (OMT) in Future Practice
Lin, X., Santos, L., Than, S., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text



243

Osteopathic student training on preventing domestic violence
Downing-Larick, C., Moore, M., Dreher, M., Stoner, A., Fadel, N., Cheng, N.
Osteopathic Family Physician, 2022/05
Free full text

244

The Effect of Clinical Anatomy Integration on Medical Student Academic Performance and Learning Approach
Stoudemire, Claire, Terrell, Mark, McCarthy, Sarah, Gulati, Raj, Fonner, Christopher, Kulesza, Randy
FASEB journal, 2022/05
Free full text

245

Cost of medical student virtual conference registration in ophthalmology and urology during the COVID-19 pandemic
Bradshaw, J. T., Parker, L. M., Wong, W. J., Gawrys, S. P.
Journal of Osteopathic Medicine, 2022/05
Free full text


247

Attracting Medical Students to Family Medicine: An Historical View
Young, R. A., Tinger, S.
Family Medicine, 2022/04
Free full text


249

Student Perception of an OMM Virtual Practical Examination: In the Setting of Social Distancing
Berenbeim, G., Metzler, I., Lewis, D., Jie, C.
The AAO Journal, 2022/03
Free full text



252

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text

253

The effectiveness of the metabolic map in promoting meaningful learning
Gromley, Z., Agwuncha, C., Nahar, V. K., Gromley, A.
Journal of Osteopathic Medicine, 2022/01
Free full text

254

Undergraduate pre-requisite coursework: Six important tips for pre-medical students considering Osteopathic Medical school in the USA
Kadavakollu, S., Moullet, Z., Yoshida, M., Qureshi, M., Graneto, J., Boyanovsky, B.
International Journal of Osteopathic Medicine, 2021/12

255

Parkinson's Disease Medication Administration During a Care Transition: The Impact of Interprofessional Team Simulation on Student Competency, Comfort, and Knowledge
Ellis, D. M., Hickey, S., Prieto, P., McLaughlin, C., Felgoise, S. H., Becker, M., O'Connor, M., Puleo, M., Reddy, T., Markey, D., Kim, L., Bernhardt, P. W.
Nursing Education Perspectives, 2021/12

256

Perceptions of COVID-19 vaccines among osteopathic medical students (OMS)
Al Janabi, T., Chinsky, R., Pino, M. A.
International Journal of Osteopathic Medicine, 2021/12

257

Pain knowledge and fear-avoidance beliefs of French osteopathy students and educators towards chronic low back pain: An osteopathic educational institution-based cross-sectional survey
Mhadhbi, H., Thierry-Hildenbrand, B., Draper-Rodi, J., Esteves, J. E., Ménard, M.
International Journal of Osteopathic Medicine, 2021/12

258

Adaptation and validation of the SEGUE checklist to assess osteopathy students' clinical communication skills
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2021/12

259

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

260

Factors Influencing Osteopathic Medical Students’ Decision to Pursue a Surgical Specialty
Keever, K., Kiernan, R. N., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12

261

Factors Affecting Osteopathic Medical Students’ Specialty Choice in Light of a Future Pass/Fail COMLEX Level 1 and USMLE Step 1
Kiernan, R. N., Keever, K., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12

262

Understanding medical student perspectives in virtual osteopathic manipulative medicine education during the COVID pandemic
Liu, T., Torrents, M., Sharma, S., Burke, D., Giovanis, A.
Journal of Osteopathic Medicine, 2021/12

263

A Pilot Study to Examine Medical Students’ Perception of their Osteopathic Manipulative Therapy Education
Mazzi, J., Leavitt, N., Kisby, G.
Journal of Osteopathic Medicine, 2021/12

264

Improving Upon Osteopathic Palpatory Skills using a 3D Printed Rotational Lumbar Spine Model
Rey, T., Thomas, A., Nolin, J., Sanders, J. G., Cedoz, K., Berwick, R.
Journal of Osteopathic Medicine, 2021/12

265

The Importance of Dermatology Education During Osteopathic Preclerkship Curriculum
Tan, V., Schukow, C., Vitale, V., Restini, C.
Journal of Osteopathic Medicine, 2021/12

266

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text


268

Comprehensive Reform and Greater Equity in Applying to Residency-Trainees' Mixed Responses to a Pass/Fail USMLE Step 1
Ganesh Kumar, N., Pontell, M. E., Makhoul, A. T., Drolet, B. C.
Journal of Graduate Medical Education, 2021/10
Free full text

269

The pandemic silver lining: preparing osteopathic learners to address healthcare needs using telehealth
Taylor, J., Wright, A., Summers, M.
Journal of Osteopathic Medicine, 2021/10
Free full text

270

Embracing industry sponsored research to expand osteopathic medical student research experiences
Morehouse, Z. P., Nash, R. J.
Journal of Osteopathic Medicine, 2021/09
Free full text

271

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09

272

Resident opinions of diabetes management in training: a survey
Healy, A. M., Uhrig, J. L., Shubrook, J. H., Aung, N. L., Sadhu, A. R.
Journal of Osteopathic Medicine, 2021/09
Free full text


274







280

Efficacy of implementing intermittent STOP THE BLEED® reviews on long term retention of hemorrhage control skills of first year medical students
Sainbayar, E., Holt, N., Jacobson, A., Bhatia, S., Weaver, C.
Journal of Osteopathic Medicine, 2021/06
Free full text

281

Effect of a standardized patient encounter on first year medical student confidence and satisfaction with telemedicine
Unrue, E. L., White, G., Cheng, N., Lindsey, T.
Journal of Osteopathic Medicine, 2021/06
Free full text


283

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06

284

Scholar 12: Beta Trial of an Osteopathic Research Cultural Development Computer Application
Rowane, M.J., Hellmann, D. E., Branning, R. A., Cola, H. M., Fahoum, J. M., Snyder, B. M., Healy, A. M., Qi-Lytle, X., Rowane, M. P., Terrell, M. A., Hostoffer, R. W.
The AAO Journal, 2021/06
Free full text


286

Osteopathic students and graduates matching into pathology residency, 2011–2020
Jajosky, R. P., Coulson, H. C., Rosengrant, A. J., Jajosky, A. N., Jajosky, P. G.
Journal of Osteopathic Medicine, 2021/02
Free full text

287

Should Osteopathic Medical Students Take the USMLE?
Lenchus, J.
Academic Medicine, 2021/02
Free full text

288

Education, Perceptions, and Delivery: Factors Shaping the Perceived Role in the Pre-Exposure Prophylaxis (PrEP) Care Continuum Among a Sample of Osteopathic Medical Students
O'Neil, A. M., Meyers, H. J., DeBoy, K. R., Stowe, M., Hamrick, J., Giano, Z., Hubach, R. D.
AIDS Education and Prevention, 2021/02

289

Associations between stress, anxiety, depression, and emotional intelligence among osteopathic medical students
Doyle, N. A., Davis, R. E., Quadri, S. S. A., Mann, J. R., Sharma, M., Wardrop, R. M., Nahar, V. K.
Journal of Osteopathic Medicine, 2021/02
Free full text


291

Undergraduate Knowledge of Osteopathic Medicine: What Premedical Students Know About Osteopathic Medicine and Its Effect on Burnout
Collins, P. B., Collins, L., Darrow, G. B., Sepede, J.
The Journal of the American Osteopathic Association, 2020/12
Free full text

292

Motivating High School Students From Rural Areas to Attend College and Pursue Careers as Osteopathic Physicians
Kadavakollu, S., Shindi, R. S., Nummerdor, H. R., Singh, V. K., Pillai, S. B., Ontiveros, S. J., Boyanovsky, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

293

Training Osteopathic Medical Students for Drastic 2021 Health Record Documentation Policy Changes
Bains, R., Gill, A., Singh, J., Antos, A., Lim, S., Molga, H., Malik, A., St. Pierre, S., Davis, G., Warner, M.
The Journal of the American Osteopathic Association, 2020/12

294

Effects of the COVID-19 Pandemic on Osteopathic Medical Students’ Screen Time
Edimo, C. O., Espares, J. K., Falus, N. A., Bupathi, S. K., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12

295

Prevalence of Computer Vision Syndrome (CVS) Symptoms on Osteopathic Medical Students
Espares, J. K., Edimo, C. O., Bupathi, S. K., Falus, N. A., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12

296

Burn-out in Osteopathic Medical Students: The Effects of Meditation Before and After the Arrival of the COVID-19 Pandemic
Krishnamachari, B., Morris, A., Chinsky, R., Pendyala, R., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2020/12

297

Levels of Resilience & Coping of Osteopathic Medical Students during COVID-19: Implications for Mental Health Innovations for Physicians in Training
Lanspa, M. E., Jacobs, R. J., Patel, K. C.
The Journal of the American Osteopathic Association, 2020/12

298

Toward Resilience: Medical Students' Perception of Social Support
Casapulla, S., Rodriguez, J., Nandyal, S., Chavan, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

299

New investigator editorial: the osteopathic medical student perspective on research
Persand, D., Maddie, N.
American Journal of Physiology. Heart and Circulatory Physiology, 2020/10
Free full text


301

48-Hour Hospice Home Immersion Encourages Osteopathic Medical Students to Broaden Their Views on Dying and Death
Gugliucci, M. R., Padmanabhan, D. L., Silberstein, E. B.
The Journal of the American Osteopathic Association, 2020/08
Free full text

302

Empathy in Medicine Self and Other in Medical Education: Initial Emotional Intelligence Trend Analysis Widens the Lens Around Empathy and Burnout
Singer-Chang, G., Dong, F., Seffinger, M., Nevins, N., Blumer, J., Musharbash, H., Helf, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

303

Lumbar Diagnosis and Pressure Difference Variance
Voleti, N., Gaspari, M. A., George, E., Angelo, N., Yao, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

304

Influence of Research on Osteopathic Medical Student Residency Match Success
Lowery, J. W., Hum, J. M., Obeime, I., Zahl, S., Parr, C. P., Larsen, B., King, T., Kisby, G.
The Journal of the American Osteopathic Association, 2020/06
Free full text

305

Transitions in Undergraduate Medical Education
Baker, J., Wright, A.
The Journal of the American Osteopathic Association, 2020/05


307

Helping Students Navigate the Single Graduate Medical Education Accreditation System
Díaz, S. R., Baker, S. D., Medio, F. J.
The Journal of the American Osteopathic Association, 2020/04
Free full text

308

Developing Neuraxial and Regional Pain Procedural Skills Through Innovative 3-Dimensional Printing Technology
Headman, Z. C., Matson, M. C., Schneider, R. P., Potter, J. L., Loguda-Summers, D. L., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2020/04
Free full text

309

Relationship of Clinical Skills Performance in Medical School With COMLEX-USA Level 2-Performance Evaluation
Wang, S., Basehore, P.
The Journal of the American Osteopathic Association, 2020/04
Free full text

310

Assessment of the Research Interests and Perceptions of First-Year Medical Students at 4 Colleges of Osteopathic Medicine
Nguyen, V., Kaneshiro, K., Nallamala, H., Kirby, C., Cho, T., Messer, K., Zahl, S., Hum, J., Modrzakowski, M., Atchley, D., Ziegler, D., Pipitone, O., Lowery, J. W., Kisby, G.
The Journal of the American Osteopathic Association, 2020/04
Free full text

311

Interprofessional Education on Medication Adherence: Peer-to-Peer Teaching of Osteopathic Medical Students
Chan, E., Doroudgar, S., Huang, J., Ip, E. J.
The Journal of the American Osteopathic Association, 2020/04
Free full text

312


313

Burnout, Perceived Stress, Sleep Quality, and Smartphone Use: A Survey of Osteopathic Medical Students
Brubaker, J. R., Beverly, E. A.
The Journal of the American Osteopathic Association, 2020/01
Free full text

314

Influence of Future Prescribers’ Personal and Clinical Experiences With Opioids on Plans to Treat Patients With Opioid Use Disorder
Mort, S. C., Díaz, S. R., Miller, C., Bowlby, M., Henderson, D., Beverly, E. A.
The Journal of the American Osteopathic Association, 2019/12
Free full text

315

Self-directed learning and practice of Italian osteopathic students during summer break: a cross-sectional survey
D'Alessandro, G., Consorti, G., Cerritelli, F.
BMC Complementary and Alternative Medicine, 2019/12
Free full text

316

Implementing a clinical-educator curriculum to enrich internal medicine residents' teaching capacity
Habboush, Y., Stoner, A., Torres, C., Beidas, S.
BMC Medical Education, 2019/12
Free full text


318

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12

319

Perceptions and Awareness of Osteopathic Medicine Among Students in Other Health Professions
Dyches, R. P., Ruck, L. D., Stein, A. B., Gailius, G. C., Worden, K.
The Journal of the American Osteopathic Association, 2019/12

320

Meditation and Empathy in Osteopathic Medical Students: A Longitudinal Randomized Controlled Trial
Krishnamachari, B., Ramya, P., Shermon, S., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2019/12

321

Osteopathic Medical Students: Promoting Physical Activity
Law, A., Hollar, L., Sklar, E., Sprague, P.
The Journal of the American Osteopathic Association, 2019/12

322

The Efficacy of Treating Thoracic Cage Counterstrain Tender Points With Varied Mobile Point Time Durations in a Classroom Setting
Smith, J. M., Docherty, J., Kooyman, P., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12

323

Experience with and perception of research among first year osteopathic medical students
Jackson, K., Ogunbekun, O., Zahl, S., Lowery, J.
Poster presentation, 2019/11


325

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09

326

Enhancing Culturally Sensitive Curriculum in an Osteopathic Medical School
Lopez-Hernandez, G. Y.
Missouri Medicine, 2019/09
Free full text

327

Introduction to Clerkship: Bridging the Gap Between Preclinical and Clinical Medical Education
Butts, C. A., Speer, J. J., Brady, J. J., Stephenson, R. J., Langenau, E., DiTomasso, R., Fresa, K., Becker, M., Sesso, A.
The Journal of the American Osteopathic Association, 2019/09

328

Using the Multitheory Model to Predict Initiation and Sustenance of Physical Activity Behavior Among Osteopathic Medical Students
Nahar, V. K., Wilkerson, A. H., Stephens, P. M., Kim, R. W., Sharma, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

329

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

330

Influence of Osteopathic Medical Students’ Personal Health on Attitudes Toward Counseling Obese Pediatric Patients
Whipps, J., Mort, S. C., Beverly, E. A., Guseman, E. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text

331

Student academic performance factors affecting matching into first-choice residency and competitive specialties
Mitsouras, K., Dong, F., Safaoui, M. N., Helf, S. C.
BMC Medical Education, 2019/07
Free full text

332

Learning and teaching of patient-centred communication skills in allied healthcare manual therapy students: A systematic review
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2019/06

333

Survey of Osteopathic Medical Students Regarding Physician Shadowing Experiences Before and During Medical School Training
Langenau, E., Frank, S. B., Calardo, S. J., Roberts, M. B.
Journal of Medical Education and Curricular Development, 2019/05
Free full text

334

Can Osteopathic Medical Students Accurately Measure Abdominal Aortic Dimensions Using Handheld Ultrasonography Devices in the Primary Care Setting?
Hower, K., Young, C. F., Wagner, A., Thorsen, D., Dugan, J.
The Journal of the American Osteopathic Association, 2019/05
Free full text

335

Comprehensive Medical College Admission Test Preparatory Course as a Strategy to Encourage Premedical Students to Pursue Osteopathic Medicine in Rural Areas
Shipley, T. W., Phu, N., Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2019/04
Free full text

336

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text

337

Just Say Know to Drugs! A High School Pharmacology Enrichment Program for a Rural Population
Hamrick, L. A., Harter, S. R., Fox, C. L., Dhir, M., Carrier, R. L.
The Journal of the American Osteopathic Association, 2019/02
Free full text


339

Investigating interpretation of ACC claims in an osteopathy teaching clinic
Urgert, C.
Unpublished MSc thesis, 2019/01
Free full text

340

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text

341

The Influence of Medical School Debt on Specialty Choice: An Analysis of Colleges of Osteopathic Medicine
Dyches, R. P., Speicher, M. R.
The Journal of the American Osteopathic Association, 2018/11

342

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

343

Current Trends in COMLEX-USA Level 1 and Level 2-CE Study Resources
McMurray, M., Bires, S.
The Journal of the American Osteopathic Association, 2018/11

344

Structure and Function in Medical Education: Trend Analysis of Osteopathic Medical Student Emotional Intelligence (EI) Suggests Curricular Modifications May Improve Functional Traits
Singer-Chang, G., Dong, F., Nevins, N., Seffinger, M., Blumer, J., Darmani, N., Helf, S.
The Journal of the American Osteopathic Association, 2018/11

345

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11

346

Health literacy across all year levels of a cohort of Australian osteopathy students
Mulcahy, J., Vaughan, B.
Quality of Life Research, 2018/10

347

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text

348

Empathy and Osteopathic Manipulative Medicine: Is It All in the Hands?
Rizkalla, M. N., Henderson, K. K.
The Journal of the American Osteopathic Association, 2018/09
Free full text


350

Association of Mindfulness With Residency Preference and Curriculum Selection in Preclinical Osteopathic Medical Students
Nayyar, N., Saggio, G., Plummer, M., Jung, M. K., Kappenberg, J.
The Journal of the American Osteopathic Association, 2018/09
Free full text

351

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text

352

Medical Students' Knowledge, Attitudes, and Behaviors With Regard to Skin Cancer and Sun-Protective Behaviors
Ivanov, N. N., Swan, A., Guseman, E. H., Whipps, J., Jensen, L. L., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text

353

Die Gesundheit in der Osteopathieausbildung
(Health in osteopathic education)
Bock, N.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07

354

First-Year Osteopathic Medical Students' Knowledge of and Attitudes Toward Physical Activity
Guseman, E. H., Whipps, J., Howe, C. A., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/06
Free full text

355

Musculoskeletal Education in Medical Schools: A Survey of Allopathic and Osteopathic Medical Students
Sabesan, V. J., Schrotenboer, A., Habeck, J., Lombardo, D., Stine, S., Jildeh, T. R., Meiyappan, A.
Journal of the American Academy of Orthopaedic Surgeons. Global research & reviews, 2018/06
Free full text

356

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

357

Factors Associated With Osteopathic Primary Care Residency Choice Decisions
Dogbey, G. Y., Collins, K., Russ, R., Brannan, G. D., Mivsek, M., Sewell, S.
The Journal of the American Osteopathic Association, 2018/04
Free full text


359

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text

360

Increasing Self-Awareness of Medical Students Through the Use of Ultrasonography
Sandefur, K., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text

361

Tool for Predicting Medical Student Burnout From Sustained Stress Levels: Factor Analysis of the Medical Education Hassles Scale-R
Johnson, J. C., Degenhardt, B. F., Smith, C. K., Wolf, T. M., Peterson, D. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text

362

A Mokken scale analysis of the peer physical examination questionnaire
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2018/03
Free full text

363

Physician-Mentored Patient Rounds to Observe and Assess Entrustable Professional Activities 1 and 2 in Preclinical Medical Students
Chamberlain, N. R., Sexton, P. S., Hardee, M. R., Baer, R. W.
The Journal of the American Osteopathic Association, 2018/03
Free full text

364

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

365

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text

366

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text

367

Chronic Pain Management: Perspective of an Osteopathic Medical Student in New Mexico
Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text

368

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text

369

Gross Anatomy Education Today: The Integration of Traditional and Innovative Methodologies
Houser, J. J., Kondrashov, P.
Missouri Medicine, 2018/01
Free full text


371

Medical Student Decision-Making: Standard Surgical Excision or Mohs Micrographic Surgery to Manage Basal Cell Carcinoma
Mancuso, C., Morris, J. B., Hernandez, N., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2018/01
Free full text

372

Predictors of Osteopathic Medical Students' Readiness to Use Health Information Technology
Jacobs, R. J., Iqbal, H., Rana, A. M., Rana, Z., Kane, M. N.
The Journal of the American Osteopathic Association, 2017/12
Free full text


374

Effects of Group Fitness Classes on Stress and Quality of Life of Medical Students
Yorks, D. M., Frothingham, C. A., Schuenke, M. D.
The Journal of the American Osteopathic Association, 2017/11
Free full text

375

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2017/11

376

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11


378

Empathy in Residency Years
Impens, A. J., Henderson, K., Rizkalla, M. N., Ivlovic, K.
The Journal of the American Osteopathic Association, 2017/11

379

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
The Journal of the American Osteopathic Association, 2017/11

380

Evolving Practice Settings for Osteopathic Graduates: How Debt Influences Anticipated Career Path
Kunz, M., Richards, J., Scheckel, C., Newman, J., Poole, K., Mi, L.
The Journal of the American Osteopathic Association, 2017/11

381

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text

382

Assessment of Nutrition Knowledge and Attitudes in Preclinical Osteopathic Medical Students
Hargrove, E. J., Berryman, D. E., Yoder, J. M., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/10
Free full text

383

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text

384

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text

385

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text

386

Fundamentals for an Osteopathic Obesity Designed Study: The Effects of Education on Osteopathic Medical Students' Attitudes Regarding Obesity
Gayer, G. G., Weiss, J., Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

387

Assessment of Research Interests of First-Year Osteopathic Medical Students
Carter, L., McClellan, N., McFaul, D., Massey, B., Guenther, E., Kisby, G.
The Journal of the American Osteopathic Association, 2017/07
Free full text

388

Osteopathic medical students entering family medicine and attitudes regarding osteopathic manipulative treatment: Preliminary findings of differences by sex
Baker, H. H., Linsenmeyer, M., Ridpath, L. C., Bauer, L. J., Foster, R. W.
The Journal of the American Osteopathic Association, 2017/06
Free full text

389

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

390

Osteopathic Medical Student Practice of Osteopathic Manipulative Treatment During School Break
Pierce-Talsma, S., Hiserote, R. M., Lund, G.
The Journal of the American Osteopathic Association, 2017/03
Free full text

391

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text

392

Correlation Between United States Medical Licensing Examination and Comprehensive Osteopathic Medical Licensing Examination Scores for Applicants to a Dually Approved Emergency Medicine Residency
Kane, K. E., Yenser, D., Weaver, K. R., Barr, G. C. Jr., Goyke, T. E., Quinn, S. M., Worrilow, C. C., Burckhart, A. J., Leonetti, A. L., Yoshioka, I. E., Dusza, S. W., Kane, B. G.
The Journal of Emergency Medicine, 2017/02

393

Osteopathic Philosophy and Manipulation Enhancement Program: Influence on Osteopathic Medical Students' Interest in Osteopathic Manipulative Medicine
Volokitin, M., Ganapathiraju, P. V.
The Journal of the American Osteopathic Association, 2017/01
Free full text

394

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text


396

Examining Health Care Students' Attitudes toward E-Professionalism
Gettig, J. P., Noronha, S., Graneto, J., Obucina, L., Christensen, K. J., Fjortoft, N. F.
American Journal of Pharmaceutical Education, 2016/12
Free full text

397

Does replacing live demonstration with instructional videos improve student satisfaction and osteopathic manipulative treatment examination performance?
Seals, R., Gustowski, S. M., Kominski, C., Li, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text

398

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text

399

Effect of Medical Education on Empathy in Osteopathic Medical Students
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text

400

Correlation Between Standardize Patients' Perceptions of Osteopathic Medical Students and Students' Self-Rated Empathy
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text

401

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text

402

The use of critical reflection to foster reflective practice in student osteopaths
McLeod, G. A.
Unpublished PhD thesis, 2016/09
Free full text


404

Quantitative Description of Medical Student Interest in Neurology and Psychiatry
Ramos, R. L., Cuoco, J. A., Guercio, E., Levitan, T.
The Journal of the American Osteopathic Association, 2016/07
Free full text

405

The Use of COMLEX-USA and USMLE for Residency Applicant Selection
Sandella, J. M., Gimpel, J. R., Smith, L. L., Boulet, J. R.
Journal of Graduate Medical Education, 2016/07
Free full text

406

Perception of peer physical examination in two Australian osteopathy programs
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2016/07
Free full text


408

Osteopathic medical students' perception of teaching effectiveness of their primary care clinical preceptors
Ojano Sheehan, O., Brannan, G., Dogbey, G.
International Journal of Osteopathic Medicine, 2016/06

409

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

410

Premedical Students’ Attitudes Toward Primary Care Medicine
Beverly, E. A., Wietecha, D. A., Nottingham, K., Rush, L. J., Law, T. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

411

Preparation Strategies of Osteopathic Medical Students for the COMLEX-USA Level 2-PE
Sandella, J. M., Peters, A., Smith, L. L., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text

412

Advising Needs of Osteopathic Medical Students Preparing for the Match
Speicher, M. R., Pradhan, S. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text

413

Effect of a Mandatory Third-Year Osteopathic Manipulative Treatment Course on Student Attitudes
Heineman, K. L., Lewis, D. D., Finnerty, E. P., Crout, S. V., Canby, C.
The Journal of the American Osteopathic Association, 2016/04
Free full text

414

Perceptions of US and Australian Medical Students and Instructors About Clinical Professional Attire: LAPEL Study
Bramstedt, K. A., Colaco, C. M. G., de Silva, E., Rehfield, P. L., Blumenthal-Barby, J. S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

415

Factors Modifying Burnout in Osteopathic Medical Students
Lapinski, J., Yost, M., Sexton, P., LaBaere, R. J.
Academic Psychiatry, 2016/02


417

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text

418

GME Graduate Retention Rates: A Single Institution Study
Frieswyk, T. J.
Unpublished PhD thesis, 2015/12
Free full text


420

Development of Peer Tutoring Services to Support Osteopathic Medical Students’ Academic Success
Swindle, N., Wimsatt, L.
The Journal of the American Osteopathic Association, 2015/11
Free full text

421

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11

422

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text

423

Effect of Table Trainer-to-Student Ratios on Outcome in Student Assessments of Cervical Muscle Energy Techniques
Snider, K. T., Dowling, D. J., Seffinger, M. A., Channell, M. K., Yao, S. C., Gustowski, S. M., Johnson, J. C., Pryor, M. J.
The Journal of the American Osteopathic Association, 2015/09
Free full text

424

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text

425

Oral cancer knowledge, behavior, and attitude among osteopathic medical students
McCready, Z. R., Kanjirath, P., Jham, B. C.
Journal of Cancer Education, 2015/06

426

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text

427

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05

428

Student perceptions of gamified audience response system interactions in large group lectures and via lecture capture technology
Pettit, R. K., McCoy, L., Kinney, M., Schwartz, F. N.
BMC Medical Education, 2015/05
Free full text

429

Comparison of COMLEX-USA scores, medical school performance, and preadmission variables between women and men
Dixon, D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

430

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text

431

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

432

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text

433

Osteopathic medical students' understanding of the Patient Protection and Affordable Care Act: a first step toward a policy-informed curriculum
Beverly, E. A., Skinner, D., Bianco, J. A., Ice, G. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text

434

Osteopathic manipulative treatment for self-reported fatigue, stress, and depression in first-year osteopathic medical students
Wiegand, S., Bianchi, W., Quinn, T. A., Best, M., Fotopoulos, T.
The Journal of the American Osteopathic Association, 2015/02
Free full text

435

Use of a novel assay to measure pre- to posttraining palpatory skills of first-year osteopathic medical students
Loh, M. S., Gevitz, N., Gilliar, W. G., Iacono, L. M., Jung, M. K., Krishnamachari, B., Amsler, K.
The Journal of the American Osteopathic Association, 2015/01
Free full text

436

Use of real-time physiologic parameter assessment to augment osteopathic manipulative treatment training for first-year osteopathic medical students
Heath, D. M., Makin, I. R., Pedapati, C., Kirsch, J.
The Journal of the American Osteopathic Association, 2014/12
Free full text

437

Experiential Learning: An Irreplaceable Tool in Osteopathic Student Education
Bikman, T. J., Ford, J., Schmidt, D., Ridpath, L.
The Journal of the American Osteopathic Association, 2014/12

438

Effects of Osteopathic Manipulative Treatment (OMT) in Lowering Perceived Stress in Medical, Dental, and Pharmacy Student Populations
Frye, K. L., Williams, C. J., Johnson, B. N., Quinn, T. A., Fotopoulos, T. J.
The AAO Journal, 2014/11
Free full text

439

Professionalism score and academic performance in osteopathic medical students
Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text

440

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

441

Nonmedical Use of Stimulants Among Medical Students
Wasserman, J. A., Fitzgerald, J. E., Sunny, M. A., Cole, M., Suminski, R. R., Dougherty, J. J.
The Journal of the American Osteopathic Association, 2014/08
Free full text

442

Multitasking behaviors of osteopathic medical students
Shah, A. V., Mullens, D. J., Van Duyn, L. J., Januchowski, R. P.
The Journal of the American Osteopathic Association, 2014/08
Free full text

443

Association between cervical and thoracic somatic dysfunction among second-year osteopathic medical students
Brindise, J. P., Nelson, K. E., Kappler, R. E.
The Journal of the American Osteopathic Association, 2014/07
Free full text

444

Perception-based effects of clinical exposure to osteopathic manipulative treatment on first- and second-year osteopathic medical students
Vazzana, K. M., Yao, S. C., Jung, M. K., Terzella, M. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text

445

Assessing palpation thresholds of osteopathic medical students using static models of the lumbar spine
Snider, E. J., Pamperin, K., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/06
Free full text




449

The DREEM, part 2: psychometric properties in an osteopathic student population
Vaughan, B., Mulcahy, J., McLaughlin, P.
BMC Medical Education, 2014/05
Free full text

450

The DREEM, part 1: measurement of the educational environment in an osteopathy teaching program
Vaughan, B., Carter, A., Macfarlane, C., Morrison, T.
BMC Medical Education, 2014/05
Free full text


452

Student- and faculty-reported importance of science prerequisites for osteopathic medical school: a survey-based study
Binstock, J., Junsanto-Bahri, T.
The Journal of the American Osteopathic Association, 2014/04
Free full text

453

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text

454

Osteopathic student satisfaction and preparedness to practice: A comparative study
Luciani, E., Cerritelli, F., Waters, M., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/03

455

Factors important to applicants to osteopathic versus allopathic emergency medicine residency programs
St Amour, B. A.
Western Journal of Emergency Medicine, 2014/03
Free full text

456

Mini-medical school programs are an effective tool to introduce students to osteopathic medicine
Kaye, K. E., Berns, A. L., Cress, L. R., Nazar, A. M.
The Journal of the American Osteopathic Association, 2014/02
Free full text

457

No place like HOME
Pham, J. T.
The Journal of the American Osteopathic Association, 2014/01
Free full text

458

Patterns of misrepresentation of clinical findings on patient notes during the COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Gallagher, L. A., Langenau, E. E.
The Journal of the American Osteopathic Association, 2014/01
Free full text


460

Script concordance test: Insights from the literature and early stages of its implementation in osteopathy
Esteves, J. E., Bennison, M., Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12

461

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12

462

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12

463

Preventive osteopathic manipulative treatment and stress fracture incidence among collegiate cross-country athletes
Brumm, L. F., Janiski, C., Balawender, J. L., Feinstein, A.
The Journal of the American Osteopathic Association, 2013/12
Free full text

464

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text

465

Frequency of counterstrain tender points in osteopathic medical students
Snider, K. T., Glover, J. C., Rennie, P. R., Ferrill, H. P., Morris, W. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text

466

Evaluation of the acceptability of Peer Physical Examination (PPE) in medical and osteopathic students: a cross sectional survey
Consorti, F., Mancuso, R., Piccolo, A., Consorti, G., Zurlo, J.
BMC Medical Education, 2013/08
Free full text

467

Effects of Osteopathic Manipulative Treatment on Self-Perceived Stress in First-Year Osteopathic Medical Students
Bianchi, W., Cooper, M., Roberts, C., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

468

Reducing Medical Student Fatigue With Osteopathic Manipulative Treatment
Wiegand, S., Jordan, L., Van Tiem, M., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

469

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text

470

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text



473

Predictors of scoring at least 600 on COMLEX-USA Level 1: successful preparation strategies
Vora, A., Maltezos, N., Alfonzo, L., Hernandez, N., Calix, E., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2013/02
Free full text

474

2012 student research abstracts and poster competitions
Neufeld, K. S.
The Journal of the American Osteopathic Association, 2013/01
Free full text

475

Assessing the effectiveness of OMT provided by predoctoral teaching fellows as measured by a visual analog pain scale
Sarkaria, J. A., Render, R. M., Lerma, C. M., Henley, N., Seffinger, M. A., Hruby, R. J.
The AAO Journal, 2012/09
Free full text


477

Assessing Palpation Thresholds Using Static Lumbar Spine Models
Snider, E. J., Pamperin, K. L., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2012/08

478

Burnout Among Osteopathic Otolaryngology Residents: Identification, Prevention, and Treatment During Formative Training Years
Yost, M., Johnson, J. C., Burchett, K.
The Journal of the American Osteopathic Association, 2012/08


480

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text

481

Empathy in osteopathic medical students: a cross-sectional analysis
Kimmelman, M., Giacobbe, J., Faden, J., Kumar, G., Pinckney, C. C., Steer, R.
The Journal of the American Osteopathic Association, 2012/06
Free full text

482

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text





487

Osteopathic medical student learning competency
Bell, H., Donohue, W., Liang, Y. J., Kim, J., Cettin, M.
Family Medicine, 2012/03

488

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the United States Medical Licensing Examination
Hasty, R. T., Snyder, S., Suciu, G. P., Moskow, J. M.
The Journal of the American Osteopathic Association, 2012/02
Free full text

489

Oral health awareness for osteopathic medical students--a medical and dental collaborative effort
Rosenheck, A. H., Scott, G. J., Dombrowski, H. T., Cohen, H. V., York, J. A., Kleiman, A., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/02
Free full text



492

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text

493

What Drew You to Osteopathic Medicine? A Survey of Osteopathic Medical Students From 10 Schools
Draper, B. B., Johnson, J. C., Chamberlain, N.
The Journal of the American Osteopathic Association, 2011/08

494

Osteopathic Medical Students' Attitude Toward Complementary and Alternative Medicine
Shubrook, J. H., Kanadiya, M. K.
The Journal of the American Osteopathic Association, 2011/08

495

Improving Resident Research Projects by Providing a Focused Research Infrastructure and Training on Evidence-Based Practice
Weiss, L. B., Filipetto, F. A., Zipp, C. P., Gupta, A. K., Switala, C. A.
The Journal of the American Osteopathic Association, 2011/08

496

An investigation into the transition from student to practising osteopath
Davidson, Y. M.
Unpublished MSc thesis, 2011/07
Free full text


498

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

499

Understanding osteopathic medical school applicants and the class of 2014
Ramos, R. L., Zhou, C., Hasan, M., Herrera, S. J., Bono, N. A., Hallas, B. H.
The Journal of the American Osteopathic Association, 2011/04
Free full text

500

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text

501

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

502

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text

503

Impact of osteopathic manipulative treatment on secretory immunoglobulin a levels in a stressed population
Saggio, G., Docimo, S., Pilc, J., Norton, J., Gilliar, W.
The Journal of the American Osteopathic Association, 2011/03
Free full text

504

Student abstracts and poster competitions: encouraging research
Prinsen, J. K.
The Journal of the American Osteopathic Association, 2011/01
Free full text

505

“D.O. or die“: identity negotiation among osteopathic medical students
Norander, S., Mazer, J. P., Bates, B. R.
Health Communication, 2011/01
Free full text



508

COMLEX Level 2-PE Performance Differences between Left-handed and Right-handed Candidates
Langenau, E. E., Dyer, C.
The Journal of the American Osteopathic Association, 2010/08

509

Learning outcomes from a biomedical research course for second year osteopathic medical students
Cruser d, A., Brown, S. K., Ingram, J. R., Podawiltz, A. L., Dubin, B. D., Colston, J. S., Bulik, R. J.
Osteopathic Medicine and Primary Care, 2010/07
Free full text

510

The Effect of Early Clinical Exposure on Future OMT Use
Dalprat, J., Thompson, C., Hruby, R.
The AAO Journal, 2010/03
Free full text


512

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

513

Relationship between COMLEX and USMLE scores among osteopathic medical students who take both examinations
Chick, D. A., Friedman, H. P., Young, V. B., Solomon, D.
Teaching and Learning in Medicine, 2010/01

514

The Efficacy of OMT by Osteopathic Medical Students on Musculoskeletal Pain and Somatic Findings
Hallas, S. J., Seffinger, M., Hurwitz, E.
The Journal of the American Osteopathic Association, 2010/01

515

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text

516

Personality types and performance: COMLEX-USA Level 2-CE
Getz, R., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2009/10
Free full text

517

Interest in rural medicine among osteopathic residents and medical students
Colegrove, D. J., Whitacre, B. E.
Rural and Remote Health, 2009/09

518

Spiritual and Religious Characteristics of Osteopathic Medical Students
Workman, G. M., Lee, M. M., Nichols, K. J., Workman, D. E., Christian, V. L., Orlinsky, D. E.
The Journal of the American Osteopathic Association, 2009/08

519

Cranial palpation pressures used by osteopathy students
Kary, D.
The Journal of the American Osteopathic Association, 2009/07
Free full text

520

The appropriate amount of force used must always be individualized for each patient during each treatment session
Abu-Sbaih, R.
The Journal of the American Osteopathic Association, 2009/07
Free full text

521

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text

522

Factors affecting specialty choice among osteopathic medical students
Teitelbaum, H. S., Ehrlich, N., Travis, L.
Academic Medicine, 2009/06
Free full text


524

Classroom lectures - where are the students and don't they care?
Reed, K.
Iowa Medicine: Journal of the Iowa Medical Society, 2009/03-04


526

Collaboration and excellence in osteopathic medical research
Manion, K. M.
The Journal of the American Osteopathic Association, 2009/01
Free full text

527

An Analysis of the Use of Web-Based Materials by Medical Students and its Relationship to Learning Style
Halbert, C., Fresa-Dillon, K., Kriebel, R., Coughlin, P., Cuzzolino, R.
The Journal of the American Osteopathic Association, 2009/01

528

Performing Preclerkship Pelvic Examinations Improves Student Perceptions of Clerkship Preparedness
Lievens, A. M., May, L. E.
The Journal of the American Osteopathic Association, 2009/01

529

Use of Ultrasonography in the Preclinical Education of Osteopathic Medical Students: A Pilot Study
Syperda, V. A., Trivedi, P. N., Melo, L. C., Freeman, M. L., Ledermann, E. J., Smith, T. M., Alben, J. O.
The Journal of the American Osteopathic Association, 2008/08

530

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text

531

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text



534

Attitudes and Confidence Levels of Second-Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T. A., Fotopoulos, T. J., Best, M. A.
The AAO Journal, 2007/12
Free full text

535



537


538

Three Shortcomings of Current Osteopathic Medical Education Curricula, a Student Perspective
Alvarez, R. A., Feitell, S., Jones, A. C., Landry, B. W., Mapley, A. C., Mason, C. R., Sarmiento, P. A., Schrick-Senasac, S. L.
Journal of Osteopathic Medicine, 2007/08

539

Awareness of Health Disparities in Organ Donation among Osteopathic Medical Students
Burch, D. M., Gordon, A. R., Burnett, P. A.
The Journal of the American Osteopathic Association, 2007/08

540

Attitudes towards Osteopathic Manipulation in Career Choices (ATOMICC)
Dunbar, B. D., Desai, G. J.
The Journal of the American Osteopathic Association, 2007/08

541

Measuring pressures used by physicians and students for cervical diagnosis of segmental somatic dysfunction using the Iso-TOUCH® Palpation Monitor System
Jean, N. T., Kuchera, M. L., Schoenfeldt, B., Dombrowski, R. T., Vardy, T., Williams, L.
The Journal of the American Osteopathic Association, 2007/08

542

Teaching Palpatory Force to Osteopathic Medical Students
Marchioni, R. M., Badoolah, A. H., Caban-Martinez, A., Patterson, M. M.
The Journal of the American Osteopathic Association, 2007/08



545

Interests in research electives among osteopathic medical students
Pheley, A. M., Lois, H., Strobl, J.
The Journal of the American Osteopathic Association, 2006/11
Free full text

546

A problem-based learning pathway for medical students: Improving the process through action research
Chegwidden, W. R.
Annals of the Academy of Medicine Singapore, 2006/09
Free full text

547

Computer-assisted instruction: a survey on the attitudes of osteopathic medical students
Forman, L. J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text

548

Survey on the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, J. R., Weidner, A. C.
The Journal of the American Osteopathic Association, 2006/05
Free full text

549

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text

550

Computer animation and improved student comprehension of basic science concepts
Thatcher, J. D.
The Journal of the American Osteopathic Association, 2006/01
Free full text


552

Navigation in neurologic localization: web site launch
Hoegerl, C.
The Journal of the American Osteopathic Association, 2006/01
Free full text

553

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text

554

Medical students' perceptions of medical education research and their roles as participants
Forester, J. P., McWhorter, D. L.
Academic Medicine, 2005/08
Free full text

555

CV4 technique as a tool to decrease psychological stress in osteopathic medical students
Shah, A., Donaldson, N., Campomanes, C., Barragan, H., Menini, T., Binkerd, J.
The Journal of the American Osteopathic Association, 2005/07

556

The Impact of Osteopathic Manipulative Treatment on Future Osteopathic Physicians
Williams, J., Howell, J. P.
The Journal of the American Osteopathic Association, 2005/07



559

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text

560

Assessing the ability of medical students to perform osteopathic manipulative treatment techniques
Boulet, J. R., Gimpel, J. R., Dowling, D. J., Finley, M.
The Journal of the American Osteopathic Association, 2004/05
Free full text

561

Interdisciplinary approach to teaching medication adherence to pharmacy and osteopathic medical students
Singla, D. L., MacKinnon, G. E., 3rd, MacKinnon, K. J., Younis, W., Field
The Journal of the American Osteopathic Association, 2004/03
Free full text

562

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text

563



565

Bridging the gap between medical education and application of OPP/OMT
Crosby, J. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text


567

Relations between academic performance by medical students and COMLEX-USA Level 2: a multisite analysis
Evans, P., Goodson, L. B., Schoffman, S. I., Baker, H. H.
The Journal of the American Osteopathic Association, 2003/11
Free full text

568

Correlation between prior exercise and present health and fitness status of entering medical students
Peterson, D. F., Degenhardt, B. F., Smith, C. M.
The Journal of the American Osteopathic Association, 2003/11
Free full text

569

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text

570

A prospective study of osteopathic medical students' attitudes toward use of osteopathic manipulative treatment in caring for patients
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2003/10
Free full text

571

Development of the Attitudes Toward Osteopathic Principles and Practice Scale (ATOPPS): preliminary results
Russo, D. P., Stoll, S. T., Shores, J. H.
The Journal of the American Osteopathic Association, 2003/09
Free full text

572

Osteopathic and Allopathic Family Practice Residents' Attitudes Toward OMT/OPP
Allee, B. A., Pollak, M. H., Malnar, K. F., Elfrink, L. D., Mulkey, L. E.
Journal of Osteopathic Medicine, 2003/08

573

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text

574

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text

575

Failure to convince osteopathic medical students of OMT's worth increases risk of subspecialization
Corbett, R. M.
The Journal of the American Osteopathic Association, 2003/02
Free full text

576

Results of a survey of inaugural class graduates of a college of osteopathic medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2003/01
Free full text



579

Clinical thinking: does your choice of university make a difference?
Harris, M.
Unpublished MSc thesis, 2003/01
Free full text


581

Improving the oral health knowledge of osteopathic medical students
Skelton, J., Smith, T. A., Betz, W. T., Heaton, L. J., Lillich, T. T.
Journal of Dental Education, 2002/11

582

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11

583

Research Interests and Motivations Among Osteopathic Medical Students: Results of a Pre-Clinical Student Survey
Licciardone, J. C., Fulda, K., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/09

584

Students', Interns' and Residents' Comfort and Confidence With Their OMT Skills
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2002/09

585

Rating interest in clinical research among osteopathic medical students
Licciardone, J. C., Fulda, K. G., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/08
Free full text

586

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text

587

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04

588

Health status and satisfaction of patients receiving ambulatory care at osteopathic training clinics
Licciardone, J. C., Brittain, P. D., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2002/04
Free full text


590

Editorial
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2002/04

591

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text

592

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

593

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text

594

Effects of backpacks on students: Measurement of cervical and shoulder posture
Chansirinukor, W., Wilson, D., Grimmer, K., Dansie, B.
Journal of Osteopathic Medicine, 2001/10

595

Development of the Attitudes Toward Osteopathic Principles and Practices Scale (ATOPPS): Preliminary Results of a Pilot Project
Russo, D. P., Stoll, S. T., Shores, J.
The Journal of the American Osteopathic Association, 2001/09

596

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text

597

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text

598

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text

599

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

600

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

601

Individualizing treatment plan and combining approaches key to pain management and holistic care: a student's perspective
Lawlor, T. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text

602

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text



605

Chiropractic and osteopathic education at Royal Melbourne Institute of Technology. A student perspective
French, S. D., Marshall, S. J., Webb, M., Tucker, C.
Australasian Chiropractic & Osteopathy, 1999/03
Free full text

606

Seize opportunity to foster osteopathic pride
Bahrami, P.
Journal of Osteopathic Medicine, 1999/03
Free full text

607

Student Movement of the Medicine/Public Health Initiative promotes nationwide preventive healthcare approach
Cardarelli, R., Pierce, T.
Journal of Osteopathic Medicine, 1998/12
Free full text


609

Osteopathic medical school applicants not allopathic medical school 'rejects'
Kasovac, M.
Journal of Osteopathic Medicine, 1998/10
Free full text


611


612

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01



615

Osteopathic manipulative treatment: student attitudes before and after intensive clinical exposure
Magnus, W. W., Gamber, R. G.
Journal of Osteopathic Medicine, 1997/02
Free full text

616

In pursuit of generalism: basic factors influencing the specialty decisions of osteopathic medical school seniors in 1995
Singer, A. M.
The Journal of the American Osteopathic Association, 1996/11
Free full text

617

Undergraduate osteopathic medical education
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

618

Female enrollment in colleges of osteopathic medicine: five years and five percentage points behind
Baker, H. H.
The Journal of the American Osteopathic Association, 1995/10
Free full text


620

A standardized form for DSM-IV review of symptoms and mental status examination for students and residents
Reeves, R. R., Bullen, J. A.
The Journal of the American Osteopathic Association, 1995/06
Free full text

621

Performance of osteopathic medical school graduates on the American Osteopathic Board of Internal Medicine certifying examinations 1985 to 1994
Slick, G. L., Dolan, S., Draba, R. E.
The Journal of the American Osteopathic Association, 1995/06
Free full text


623

DOs who train in allopathic residency programs not 'disloyal'
Wogec, J.
The Journal of the American Osteopathic Association, 1994/12
Free full text

624

Healthcare reform and practice choices: a survey of osteopathic medical students
Shubrook, J. H., Jr., Solomon, J. A., Ross-Lee
The Journal of the American Osteopathic Association, 1994/11
Free full text

625

Overview of financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1994/11
Free full text


627

Effect of clerkship training at rural sites on students' clinical skills
Brandau, D., Heun, L.
Academic Medicine, 1994/08
Free full text

628

Performance-based assessment of moral reasoning and ethical judgment among medical students
Smith, S. R., Balint, J. A., Krause, K. C., Moore-West, M., Viles, P. H.
Academic Medicine, 1994/05
Free full text

629

Performance of candidates on the American Osteopathic Board of Internal Medicine subspecialty certifying examinations 1984-1992
Slick, G. L.
The Journal of the American Osteopathic Association, 1994/03
Free full text

630

Financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1993/11
Free full text

631

An MD's note to his osteopathic medical students
Friedlander, E. R.
The Journal of the American Osteopathic Association, 1993/10
Free full text

632

Do medical students' knowledge and attitudes about health and exercise affect their physical fitness?
Liang, M. T., Dombrowski, H. T., Allen, T. W., Chang, C. O., Andriulli, J., Bastianelli, M., Davina, E., Norris, S. D.
The Journal of the American Osteopathic Association, 1993/10
Free full text

633

Lifestyle changes associated with osteopathic medical education
Crapse, F. J., Jr., Hudgins, P. M., Baker
The Journal of the American Osteopathic Association, 1993/10
Free full text

634

Promoting the health and fitness of osteopathic medical students
Licciardone, J. C.
The Journal of the American Osteopathic Association, 1993/10
Free full text

635

The HIV-infected house officer: residency training issues
Fernandez, E. S., Troutman, H. T., Herbert, B., Condoluci, D. V.
The Journal of the American Osteopathic Association, 1993/08
Free full text

636


637

Four approaches to using patients to teach and evaluate clinical skills of residents, interns, and students
Medio, F. J., Morewitz, S. J.
The Journal of the American Osteopathic Association, 1992/11
Free full text

638

Voices From the Future: what students, interns, and residents want from osteopathic graduate medical training
Kushner, D., Cooney, J.
The Journal of the American Osteopathic Association, 1992/10
Free full text

639

Training osteopathic medical students in behavioral medicine and psychiatry
Magen, J.
The Journal of the American Osteopathic Association, 1992/05
Free full text

640

The physical fitness of first-year osteopathic medical students
Licciardone, J. C., Hagan, R. D.
The Journal of the American Osteopathic Association, 1992/03
Free full text


642

Who Will Hatch Our Students?
Morey, L.
The AAO Journal, 1991/09
Free full text

643

Osteopathic vs. chiropractic education: a student perspective
McNamee, K. P., Magarian, K., Phillips, R. B., Greenman, P. E.
Journal of Manipulative and Physiological Therapeutics, 1991/09

644

Selected characteristics of graduate medical education in the United States
Rowley, B. D., Baldwin, D. C., Jr., McGuire
JAMA: The Journal of the American Medical Association, 1991/08



647

Development of an Expert System to Teach Diagnostic Skills
Elieson, S. W.
Unpublished PhD thesis, 1990/08
Free full text

648

How effectively are osteopathic medical students coping with a stressful life-style?
Kurtz, M. E., Paulsen, R. D., Ferguson, D.
The Journal of the American Osteopathic Association, 1990/07
Free full text


650

A second opinion on geriatric training programs
Toffol, G. J., Schultz, D. R., Root, K. E., Weintraub, J. R.
The Journal of the American Osteopathic Association, 1990/03
Free full text



653

The orientations of medical students to osteopathic medicine
Aho, W. R.
Unpublished PhD thesis, 1970/01

 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends