Advanced search



 
 80.1% of the records
 
 19.9 % of the records
 
 57.1 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Medically Underserved Area*Osteopathic Medicine*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademicacademic barrieracademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced trainingadvancing TBI careadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumablack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinC-tactileC-tactile afferentsC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SteeleC. WeaverC1C3cability crisiscadavercadaver dissectioncadaveric dissectioncadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCanadaCanadiancanal syndromecancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1cold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasesColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial volumecranial-sacral-motioncraniocranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational technologyeducational toolseducational valueeducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenomicsgentlenessgeodesicgeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxishair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare costhealthcare costshealthcare deliveryhealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitiesHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8Interleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra ocular pressureintra- and inter-rater reliabilityintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdle muscular dystrophylimb injurieslimb placodelimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatrix-rhythm-therapymattermaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionmediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien TettambelmembershipmembranesmemorymemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticameridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRImsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathyMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological testsneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral aversionoral cavityoral diagnosisoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered carepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disordersplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologypreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprisonprivate collegesprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsrctre-findingsre-orientation processreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspeakingspecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintsSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal brace maneuversternal manipulationsternal painsternal recoil techniquesternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

3636 results (please see below)  Sort:    
1

Strategies to prevent and manage running-related knee injuries: A systematic review of randomised controlled trials
Alexander, J., Johnston, R., Ezzat, A., Culvenor, A., Barton, C.
Journal of Science and Medicine in Sport, Nov 2022 2022-11-02



4

Evaluating the acute effect of osteopathic manipulative treatment on sprint performance in young adults
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., McKinlay, K. J., Roush, A. J., Cosgrave, C.
Journal of Osteopathic Medicine, 2025/10
Free full text

5

Diaphragm’s Role as a Systems-Connector Muscle: A Narrative Review
Bordoni, B., Morabito, B., Escher, A. R.
Cureus, 2025/10
Free full text

6

Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Bethea, J., Sharma, H., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
Cureus, 2025/10
Free full text

7

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10

8

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10


10

Why don't more physicians use osteopathic manipulative medicine? A cross-sectional study of utilization and referral barriers
Stacey, S. K., Furlano, A., Genewick, J., Westfall, E., Gordon, B., Toor, J.
Journal of Osteopathic Medicine, 2025/09
Free full text


12


13

Effect of the Spencer Technique on Glenohumeral Joint Range of Motion: A Comparative Analysis of Athletes Versus Non-athletes
Oar, D. P., Zarilla, A., DiSilvestro, D., Buchman, Z. J., Abouafech, A., Boesler, D.
Cureus, 2025/09
Free full text


15

Effect of osteopathic manipulative treatment on primary pelvic pain - A systematic review with meta-analysis
Parada, J. G., da Silva, E. B., Fernandes, A. P., Portugal, G. B.
International Journal of Osteopathic Medicine, 2025/09

16

Retrospective Study of Osteopathic Manipulative Treatment on Length of Stay and Opioid Use After Vestibular Schwannoma Resection
Chen, A. I., Golshan, S., Schwartz, M. S., Friedman, R. A.
Otology & Neurotology Open, 2025/09

17

COVID-19 mRNA vaccine immune response to the addition of osteopathic manipulative treatment with lymphatic pumps: a randomized controlled trial
Martinez, E. S., Fuchs, S., Szurmant, H., Chen, X., Comer, A., Lee, E., Hruby, R., Giusti, R., Loveless, B., Sees, J. P., Crone, P., Peek, L. J., Pestano, G., Xie, B., Zammuto, J., Hostoffer Jr., R., Sanchez Jr., J.
Virus Research, 2025/09
Free full text







24

Tipping the scale: Enhancing Neurological Recovery in TBI through Osteopathic Principles
Khanna, N., Ettlinger, H., Shugar, J. D.
The AAO Journal, 2025/09


26

Osteopathic Manipulative Treatment (OMT) as an Adjunctive Treatment in Major Depressive Disorder (MDD)
Moreno, P., Mather, M., Kinney, L., Pichot, R., Torres, R.
The AAO Journal, 2025/09

27

Osteopathic Manipulative Treatment (OMT) Protocol on Sleep Quality in Medical Students as Measured by the Fitbit Smart Watch: A Pilot Study
Radigan, R., Finkelstein, A., Lee, B., George, E., Bhushan, P., Sousa, A., Yao, S. C.
The AAO Journal, 2025/09


29

OMT as an Adjunct Therapy to Clubbed Feet: A Case Study
Tucker, A., Dorsa, I., Patel, J., Seemann, J., Hicks, K., Leggoe, S.
The AAO Journal, 2025/09







36

The effect of osteopathic manipulative treatment on length of stay and pain relief in pediatric appendectomy: a pilot non-randomized time-controlled clinical trial
Lo Piccolo, R., Cantagalli, M. M., Ferroni, T., Fracchiolla, F., Morabito, A.
Frontiers in Pediatrics, 2025/08
Free full text

37

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text

38

Feasibility of Osteopathic Manipulative Treatment for Low Back Pain in Rural Chimaltenango, Guatemala: A Pilot Study
Aspra Rubi, M., Ngo, A. L. T., Cooper, G., Nichols, J.
Cureus, 2025/08
Free full text

39

Osteopathic diagnosis and treatment of the spine in patients with chronic back pain through the lens of medical infrared thermography: A randomized controlled pilot study
Bohlen, L., Biester, A., Rapp, O., Wentzel, J., Liem, T., Cerritelli, F., Schmidt, T.
Complementary Therapies in Clinical Practice, 2025/08

40

Association of neurovascular events with cervical manual therapy: A cohort study
Fraser, J. J., Lonnemann, E.
International Journal of Osteopathic Medicine, 2025/08

41

Effect of osteopathic manipulation on neck kinematics using X-Sens motion capture in non-specific neck pain: a protocol for randomised controlled trial
Hullumani, S., Qureshi, I., Raghumahanti, R.
BMJ Open Sport and Exercise Medicine, 2025/08
Free full text

42

Specific osteopathic diagnosis of unilateral knee pain in an elite sprinter: a case report
Mattatia, J., Leplat, A., Saiz, S.
International Journal of Osteopathic Medicine, 2025/08

43

Investigating the trustworthiness of randomized controlled trials in osteopathic research: a systematic review with meta-analysis
Sénéquier, A., Draper-Rodi, J., Alvarez Bustins, G., Braithwaite, F. A., Brown, J., Corcoran, D., Forrest, L., Godsi, E., MacMillan, A., Menard, M., Roura Carvajal, S., Scocca, C., Treffel, L., Vaucher, P., Wagner, A., Soliman, N., Abbey, H., Hohenschurz-Schmidt, D.
Journal of Clinical Epidemiology, 2025/07
Free full text


45

Wurzel mit Riechfunktion
(Root with olfactory function)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07

46

Find it, find it, find it …
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07

47

Ultrasound shear wave elastography to assess neck somatic dysfunction and OMT effects
Gao, J., Lynch, E., Coleman, M., Moore, J., Park, D., Wilde, B.
Journal of Osteopathic Medicine, 2025/07
Free full text

48

A multimodal intervention of manual therapy, exercise, and psychological management for painful diabetic neuropathy: intervention development and feasibility trial protocol
Hohenschurz-Schmidt, D., Smith, S., Schmid, A. B., Bright, P., Draper-Rodi, J., Evans, M. C., Kemp, H., Esteves, N. K., Pigott, E., Scott, W., Vollert, J., Williamson, E., Pogatzki-Zahn, E. M., Vogel, S.
Pain Management, 2025/07
Free full text


50

Patience in Practice: A Nonoperative Approach to Osteochondritis Dissecans
Rodas, A. W., Gupta, P., Pan, K., Rule, R., Goddard, M.
Cureus, 2025/07
Free full text

51

Changes in Electromagnetic Activity Following Osteopathic Manipulative Treatment: A Novel Assessment Using Induction Sensors
Savla, P., Brazdzionis, J., Marino, M., Siddiqi, I., Sweiss, R., King, C., Miulli, D. E.
Cureus, 2025/07
Free full text

52

Effect of osteopathic manipulative treatment on comorbid depressive symptoms in patients with chronic low back pain: study protocol for a randomised controlled trial
Bohlen, L., Eggart, M., Müller-Oerlinghausen, B., Lorenz, J., Schleip, R., Liem, T., Cerritelli, F., Esteves, J. E., Shedden-Mora, M., Schmidt, T.
BMJ Open, 2025/07
Free full text

53

A Holistic Approach to Treatment of Rosacea During Pregnancy: A Systematic Review
Garelick, E., Hurley, M., Bell, L. N., Cubelli, S.
SKIN: Journal of Cutaneous Medicine, 2025/07
Free full text

54

Pilot study on the influence of osteopathic manual therapy on cortisol and testosterone concentrations in horses
Vokietytė-Vilėniškė, G., Babarskaitė, G., Poškienė, I., Anskienė, L., Žilaitis, V.
Acta Veterinaria Brno, 2025/07

55

Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial
Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., Arnal-Gómez, A.
International Journal of Osteopathic Medicine, 2025/06
Free full text


57

An overview of systematic reviews on the efficacy and safety of osteopathic techniques
Zipp, C. R., Semlitsch, T., Tögel, G., Krenn, C., Loder, C., Jeitler, K., Siebenhofer, A.
Journal of Bodywork and Movement Therapies, 2025/06




61

Development of Standardized Osteopathic Manipulative Treatment Tracking Forms Recording Pain and Functional Outcomes to Facilitate Osteopathic Research
Joseph, C., Mintle, L. S., Hoegerl, C., Asher, D., Adams, K., Fugler, P., McKinney, J.
International Journal of Osteopathic Medicine, 2025/06

62

Osteopathic approach to injuries of the overhead thrower’s shoulder
De Luigi, A. J., Raum, G. M., King, B. W., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/06
Free full text

63

Shaft femoral fracture secondary to osteopathic manipulation: case report and medico-legal implication
Prevot, L. B., Bolcato, V., Fozzato, S., Tronconi, L. P., Basile, G.
International Journal of Osteopathic Medicine, 2025/06

64

Acute changes in functional connectivity associated with first osteopathic manual treatment in chronic low back pain spatially overlap with opioid receptor expression
Tomaiuolo, F., Cerritelli, F., Sestieri, C., Keys, J., Paolucci, T., Sensi, S. L., Ferretti, A., Delli Pizzi, S.
Brain Research Bulletin, 2025/06
Free full text


66





70

Functional Improvement without the Surgery Referral, A Case Presentation
Candelori, W. J., Gailius, G. C.
The AAO Journal, 2025/06

71

When the Framework Fails: The Cost of Overlooking the Basics in Chest Pain
Collingsworth, M., Schaefer, M., Emmons, A.
The AAO Journal, 2025/06


73

Optimization of Abdominal Surgery and Controlling Intractable Neuropathic Pain with Peri-operative OMT
Cruz, C., Ural, E., Gailius, G. C., Neuer, K.
The AAO Journal, 2025/06

74

Resolving Deep Gluteal Syndrome with OMT
Dirusso, E., Shugar, J.
The AAO Journal, 2025/06

75

Rhabdo Resuscitation and Recovery Using Osteopathic Manipulative Treatment
Fadenrecht, H., Thorsvik, N.
The AAO Journal, 2025/06





80

OMT for acute on chronic pain in systemic scleroderma
White, M., Furlano, A.
The AAO Journal, 2025/06





85

The use of OMT in Myalgic Encephalomyelitis/Chronic Fatigue Syndrome
Brancale, D., Cooley, D.
The AAO Journal, 2025/06

86

Hand & Helmet: A Crown-to-Coccyx Approach for Positional Plagiocephaly
Enniss, A., Neuer, K., Whitaker, Z., Ural, E.
The AAO Journal, 2025/06

87

From Fatigue to Function: A Case Report of The Use of OMT in Chronic Fatigue Syndrome
Finkelstein, A., Petrillo, G., Keys, J.
The AAO Journal, 2025/06


89

Management of Chemotherapy Induced Strains in a Breast Cancer Survivor with OMT
Johnson, R., White, E., Yu, X., Aldridge, A. F., Bardowell, A.
The AAO Journal, 2025/06

90

Turning the Tie: The Impact of OMT on infant torticollis and tongue tie
Lee, D. W., Katyal, J., Faillace, R.
The AAO Journal, 2025/06


92

Clavicular Dysfunctions: An Osteopathic Approach to Neck, Shoulder, and Chest Pain
Machado Douaihi, S. J., Waters, H.
The AAO Journal, 2025/06

93

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06


95

A Viscerosomatic Discovery: Unveiling a Case of Gastroparesis Disguised as Shoulder Pain
McKenna, T., Pfeifer, K., Wallace-Ross, J.
The AAO Journal, 2025/06


97

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06

98

Evaluation of Osteopathic Manipulative Treatment Strategies in Adults with Chronic Neck Pain
Moljo, M., Sreenivasa, S., Neupane, R., Harris, Z., Potter, A.
The AAO Journal, 2025/06





103

Evaluating the Acute Effects of Osteopathic Manipulative Treatment on Sprint Times
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., Jo, K., Roush, J., Cosgrave, C.
The AAO Journal, 2025/06

104

Osteopathic Manipulative Treatment in Cervical Dystonia Patients Treated with IncobotulinumtoxinA
Décarie, P., Chouinard, S., Venne, G.
International Journal of Osteopathic Medicine, 2025/06

105

The Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Sharma, H., Bethea, J., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
The AAO Journal, 2025/06

106

Short-Lever Assessment of Spinal Side-Bending
Sudweeks, K., McClendon, M., Khalil, F., Kania, A.
The AAO Journal, 2025/06

107

Impact of Osteopathic Manipulative Treatment in Delivering Comprehensive Care in Populations with Disabilities
Villarosa, M., Bae, P., Yeam, J., Hoang, V., White, G., Blumer, J.
The AAO Journal, 2025/06

108

Management of Chronic Migraine in a 34-year-Old Obese Female
White, E., Johnson, R., Yu, X., Bardowell, A.
The AAO Journal, 2025/06

109

Osteopaths’ perspective and experiences of elite track and field athletes osteopathic treatments: A descriptive phenomenological study
Consorti, G., Fard, R., Odorisio, L., Cella, M.
Journal of Bodywork and Movement Therapies, 2025/06

110

Significant Improvement of Fibromyalgia Symptoms With Osteopathic Manipulative Treatment: A Case Report
Ansari, A. Z., Mokodanski, N. A., Ahmed, F., Fairooz, A., Hafeez, S.
Cureus, 2025/06
Free full text

111

Therapeutic efficacy of individual head orthoses in infants with positional plagiocephaly
Chhatwani, S., Degener, C., Rako, L., Kirschneck, C., Möhlhenrich, S. C., Danesh, G., Kelker, M.
Journal of Orofacial Orthopedics, 2025/06
Free full text

112

Osteopathic manipulation to increase lactation quantity: a prospective case series
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2025/06
Free full text


114

Use of osteopathic manipulation techniques for management of acute otitis media in pediatric patients: a scoping review
Kim, C. H.S., McCray, L. R., Nguyen, S. A., Shermetaro, C., Robbins, W. K.
European Archives of Oto-Rhino-Laryngology, 2025/06
Free full text


116

Osteopathic practitioner´s considerations on infertility treatment
Triay Salamanca, S.
Unpublished MSc thesis, 2025/06
Free full text






122

Efficacy and safety of musculoskeletal manipulations in elderly population with musculoskeletal disorders: a systematic review
Bagagiolo, D., Persiani, M., Cicchitti, L., Vismara, L., Bruini, I., Mauro, A., Buffone, F.
BMJ Open, 2025/06

123

Effectiveness of osteopathic treatment in women with primary dysmenorrhea: A randomised controlled trial
Plathner, M., Wolf, L.
Journal of Bodywork and Movement Therapies, 2025/06

124

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma-Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text

125

Efficiency of physical therapy and osteopathic techniques in the treatment of operated and recurrent lumbar disc herniation - a case report
Antohe, B.A., Rață, M., Rață, B., Rață, G.
Journal of Bodywork and Movement Therapies, 2025/06


127

Providing Palliative Care for Two: Managing Cancer-Related Pain During Pregnancy
Okonta, V., Kirkire, L., Schoen, M., Mesarwi, P., Skavinski, K.
Journal of Pain and Symptom Management, 2025/05

128

Effects of osteopathic treatments in a patient who underwent two cardiac surgeries - A case report
Aubin, A., Bekhazi, J., Fortin, A., Paradis, A., Morin, C.
International Journal of Osteopathic Medicine, 2025/05


130

A review of osteopathic and related manipulative treatments for improving symptoms of gastrointestinal distress in neurological disorders
Peters, J., Runnels, G., Lauinger, A., Murphy, T., Griffith, A., Slicho, T.
International Journal of Osteopathic Medicine, 2025/05

131

A Retrospective Multicenter Analysis of Osteopathic Manipulation in Academic and Community Settings
Stacey, S. K., Harmelink, B., Gordon, B., Toor, J., Furlano, A., Genewick, J., Westfall, E.
Cureus, 2025/05
Free full text

132

Effectiveness of osteopathic manual treatment in the elderly population: a scoping review of clinical evidence
Molinari, L., Mingrone, L., Novelli, E.
Journal of Osteopathic Medicine, 2025/05
Free full text

133

Chronic pain outcomes among patients treated by osteopathic vs. allopathic physicians: a 36-month follow-up study
Licciardone, J. C., Lewis, H., Dahl, K., Adams, B., Aryal, S.
Journal of Osteopathic Medicine, 2025/05
Free full text

134

The epidemiology of osteopathic diagnoses and treatments in United States emergency departments from 2018 to 2021
Distefano, A., Harris, H., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2025/05
Free full text

135

Osteopathic intervention for inflammatory conditions of the lactating breast: a case series
Engel, R., Willy, K., Fuller, E.
International Journal of Osteopathic Medicine, 2025/05

136

Potential impact of an osteopathic intervention for internationally adopted children with fetal alcohol spectrum disorder (FASD); a prospective case series
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., Aldecoa-Bilbao, V., García-Algar, Ó.
International Journal of Osteopathic Medicine, 2025/05
Free full text

137

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/05

138

Breath of Relief: Osteopathic Manipulative Treatment of Chronic Postoperative Pain in a Bilateral Lung Transplant Patient
Duggal, V., Finkelstein, A., Radigan, R., Bhushan, P.
Cureus, 2025/05
Free full text

139

Author Correction: Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., Perpetuini, D., Keys, J., Merla, A., Cardone, D.
Scientific Reports, 2025/05
Free full text

140

Exploring manual therapy in the management of irritable bowel syndrome in adults: A scoping review
Płóciennik-Korycka, N., Pani, S. M., Bruc, B., Contu, P., Wrzesińska, M.
Complementary Therapies in Medicine, 2025/05
Free full text

141

Elbow injuries in overhead throwing athletes: clinical evaluation, treatment, and osteopathic considerations
King, B. W., Raum, G. M., De Luigi, A. J., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/05
Free full text

142

Osteopathic, logopedic and psychological assessment to improve outcome in patients undergoing cardiac surgery: A randomized clinical trial (TITANIC trial)
Volpato, E., Stilo, L., Tavanelli, M., Bordoni, B., Oreni, L., Toccafondi, A., Moraschi, A., Morici, N.
European Journal of Preventive Cardiology, 2025/05


144

Patient-Practitioner-Environment Synchronization: Four-Step Process for Integrating Interprofessional and Distinctive Competencies in Osteopathic Practice-A Scoping Review with Integrative Hypothesis
Lunghi, C., Baroni, F., D'Alessandro, G., Consorti, G., Tramontano, M., Stubbe, L., Conte, J., Liem, T., Zegarra-Parodi, R.
Healthcare, 2025/04
Free full text

145

Swelling and skin changes: an osteopathic approach to pediatric lymphedema management
Jackson, S., Hussaini, A., Galan, J., Chung, T. C., Javed, B.
Journal of Osteopathic Medicine, 2025/04
Free full text

146

Corrigendum to: Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/04
Free full text




150

The role of osteopathic manipulative treatment for dystonia: a literature review
Phrathep, D. D., Abdo, Z., Tadros, M., Lewandowski, E., Evans, J.
Journal of Osteopathic Medicine, 2025/04
Free full text

151

The Effectiveness of Osteopathic Correction in the Complex Rehabilitation of Patients with Temporomandibular Joint Dysfunction
Makichyan, T., Gusakova, E., Khabadze, Z., Sarkisian, A.
Georgian Medical News, 2025/04
Free full text

152

Tradition-Dismissive vs. Tradition Reconceptualization Approaches in Musculoskeletal Care: The Example of Osteopathic Care
D&rsquo, Alessandro, G., Lunghi, C., Consorti, G., Zanon, S., Berti, F., Turinetto, M., Di Pietrantonio, L., Longobardi, M., Zegarra-Parodi, R., Baroni, F.
Applied Sciences, 2025/03
Free full text

153

Impact of osteopathic manipulative medicine training during graduate medical education and its integration into clinical practice
Kramer, J. L., Trombetti, K., De Asis, K., Mai, V., Swing, E.
Journal of Osteopathic Medicine, 2025/03
Free full text


155

Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., David, P., Jordan, K., Arcangelo, M., Daniela, C.
Scientific Reports, 2025/03
Free full text


157

Effects of a single osteopathic manipulative treatment on intraocular pressure reduction: a pilot study
King, H. H., Weinreb, R. N., Walker, E., Zangwill, L. M.
Journal of Osteopathic Medicine, 2025/03
Free full text

158

A novel simulation enhanced education for osteopathic manipulation of hospitalized patients
Eilerman, A. P., Libonate, G., Pothen, S., Rudie, M., Zardoost, S., Donaldson, B., Gable, B.
Journal of Osteopathic Medicine, 2025/03
Free full text

159

Osteopathic Manipulative Treatment of the Ankle-Foot Complex in Individuals with Limited Dorsiflexion: Study Protocol for a Randomized Crossover Clinical Trial
Loures de Paula, A., Castro, R. Q., Souza, H. C., de Castro Moreira, B., Moreira Baião, I. C., Schmitz Correa, C. P., Felício, D. C., Fonseca, D. S.
International Journal of Osteopathic Medicine, 2025/03










169

Osteopathic Manual Therapy Versus Conventional Conservative Therapy in the Management of Temporomandibular Disorders
Rahman, S.
Journal of Modern Health and Rehabilitation Sciences, 2025/03
Free full text




173

Formation of myofаscial pain syndrome and its correction in patients with tension headache
Vesnin, A. V., Tovazhnianska, O. L.
Journal of V. N. Karazin Kharkiv National University. Series 'Medicine', 2025/02

174

Efficacy of pulsed electromagnetic field therapy on pain and physical function in patients with non-specific low back pain: a systematic review
Kull, P., Keilani, M., Remer, F., Crevenna, R.
Wiener Medizinische Wochenschrift, 2025/02
Free full text

175

Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Galeazzi, Y., Houel, N., Gouaux, L., Rohan, A., Le Heiget, H., Jung, C., Housset, B., Stubbe, L.
Pain Reports, 2025/02
Free full text


177


178

“The Dark Side of Musculoskeletal Care”: Why Do Ineffective Techniques Seem to Work? A Comprehensive Review of Complementary and Alternative Therapies
Mamud-Meroni, L., Tarcaya, G. E., Carrasco-Uribarren, A., Rossettini, G., Flores-Cortes, M., Ceballos-Laita, L.
Biomedicines, 2025/02
Free full text

179

The effect of osteopathic manipulative treatment on chronic rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kalkat, A., Hammes, C., Kohli, E., Callahan, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2025/02
Free full text

180

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text

181

Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/02
Free full text

182

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text


184

Efficacy of non-surgical, non-pharmacological treatments for congenital muscular torticollis: a systematic review and meta-analysis
Antares, J. B., Jones, M. A., Chak, N. T. N., Chi, Y., Li, H., Li, M., Chan, E. Y. W., Chen, T. M. K., Lee, C. M. Y., Urquhart, D. M.
BMC Musculoskeletal Disorders, 2025/02
Free full text


186

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01


188

Heilungshindernisse
(Obstacles to healing)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01

189

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text

190

An Unusual Presentation of Respiratory Dysfunction in Parkinson’s Disease: A Case Study
Rundquist, L. D., Lyons, S. E., Moljo, R. J., Blavo, C.
Cureus, 2025/01
Free full text

191

Osteopathic treatment of infants with infantile colic/excessive crying: a prospective, multicentric, randomized controlled trial and nested observational trial
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
BMC Pediatrics, 2025/01
Free full text

192

Early osteopathic manipulative treatment to prevent cranial positional deformities: A randomized controlled trial
Genelot, C., Macioce, V., Huguet, H., Harrewijn, I., Cambonie, G., Dessauge, D., Mura, T., Moulis, L., Captier, G.
Archives de Pédiatrie, 2025/01
Free full text

193

Three-Dimensional Posture Analysis-Based Modifications After Manual Therapy: A Preliminary Study
Scoppa, F., Graffitti, A., Pirino, A., Piermaria, J., Tamburella, F., Tramontano, M.
Journal of Clinical Medicine, 2025/01
Free full text

194

Osteopathic Manipulative Treatment: A Safe and Feasible Adjunct in Sickle Cell Disease Pain Management
Brown, A., Goubeaux, D., Jacob, S. A., Belsky, J. A.
Pediatric Blood & Cancer, 2025/01


196

Resolution of Chronic Coccydynia after Osteopathic Manipulative Treatment: A Case Report.
Valdés, D., Sherrington, M., Waters, L. M.
Osteopathic Family Physician, 2024/9


198

Osteopathic Manipulative Treatment During Post-operative Recovery: A Scoping Review
Randall, C. G., Paul, H. A., Lumley, H., Ortega, A., Rowley, J., Brown, B., Mohan, S., Smith, K., Messer, T., Swan, E., Mehra, R. S.
Cureus, 2024/2
Free full text

199

Osteopathic Treatment of a person with Arnold-Chiari Malformation and Syringomyelia: a case report
Cases-Solé, R., Varillas-Delgado, D., Trinidad-Cascudo, F., Pino-Tamayo, M. C., García-Algar, O.
International Journal of Osteopathic Medicine, 2024/12

200

Neuropsychiatric considerations in treating anorexia nervosa patients with osteopathic manipulative medicine: a narrative review
Talebi-Talghian, T., Schulz, P., Huzij, T.
Journal of Osteopathic Medicine, 2024/12
Free full text

201

Treatment of migraine with aura with osteopathic manipulative treatment: a case report with renewed perspectives
Babek, N., Fiechter, C., Caretti, R., Phinney, T.
Journal of Osteopathic Medicine, 2024/12
Free full text

202

Autonomic Nervous System and Viscera-Related Responses to Manual Therapy: A Narrative Overview
Alanazi, M. S., Degenhardt, B., Franklin, G., Jacobson, E., Fritz, S., Kettner, N., Kremen, V., Lipke, L., Reed, W. R.
International Journal of Osteopathic Medicine, 2024/12
Free full text

203

Osteopathic Manual Treatment in Women with Endometriosis: A Scoping Review on Clinical Symptoms, Fertility and Quality of Life
De Strooper, M., De Nys, L., Theys, L., Vermeersch, A., Quaghebeur, J.
International Journal of Osteopathic Medicine, 2024/12
Free full text


205

Effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in individuals with chronic low back pain: A double-blind, randomised placebo-controlled trial
Armbrust, D., Arêas, G. P. T., Fonseca, C. L., Arêas, F. Z. S., Duarte, N. A. C., Santana, S. A. A., Dumont, A. J. L., Neto, H. P., Oliveira, C. S.
Clinical Rehabilitation, 2024/12

206

The Effects of Osteopathic Manipulative Treatment on Arrhythmias: A Double-blind Randomized Controlled Trial in Patients with Cardiac Implantable Electronic Devices
Nikakis, J., Malkov, D., Tale, E., Mangla, M., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
The Journal of Innovations in Cardiac Rhythm Management, 2024/12
Free full text



209

The Effects of Osteopathic Manipulative Treatment on Climbing Performance
Beyer, B. R., Sheppard, C., Bolig, J., Muvvala, M.
Journal of Osteopathic Medicine, 2024/12

210

Perception of Osteopathic Medicine in a Rural Clinic in Peru
Hovetter, K., Henke, C., Lopes, K., Berger, M., Boswell, K., Kandil, F., Ridpath, L., Waddell, M., Schmidt, D.
Journal of Osteopathic Medicine, 2024/12

211

Improving Sleep with OMT: A Randomized Controlled Trial using Cervical Techniques to Improve Sleep for OMSI
Le, D., Fagen, D., Christensen, S., Jensen, C., Alacron, A., Slife, R., Thakur, C., Teo, R., Spradley, G., Jackson, S, Zamanian, P., Finley, D., Tran, N., Tran, A., Redeman, K., Marble, A., Keane, J., Mangiaracina, M.
Journal of Osteopathic Medicine, 2024/12

212

Multifaceted Therapeutic Approaches for the Management of Dyspareunia: A Narrative Review
Rastogi, M., Deka, K., Krishnan, S., Narayan, A., Nayak, M. M., Kumar, K. V.
The Open Public Health Journal, 2024/12
Free full text


214

The Effect of Osteopathic Manipulative Treatment in Chronic Rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kallat, A., Callahan, M., Kohli, E., Hammes, C., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/12

215

Haltung bewahren. Körperhaltung und OMT
Liem, T.
Naturheilpraxis, 2024/12

216

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2024/12
Free full text







223

The Effect of Osteopathic Manipulative Treatment on Acute Post COVID-19 Anosmia and Ageusia Symptoms: A Case Report
Mehra, M., Companion, N., Yao, S. C., Ventimiglia, M.
The AAO Journal, 2024/12


225

Diagnosing and treating upper back pain: insights from New Zealand’s manipulative physiotherapists and osteopaths
Kovanur Sampath, K., Smith, T., Belcher, S., Farrell, G., Fryer, G., Vaughan, B., Moran, R.
Journal of Manual & Manipulative Therapy, 2024/12

226

Osteopathie in der Rehabilitation von Patienten mit rezidivierenden muskuloskeletalen Verletzungen: eine experimentelle Studie
(Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study)
Sankova, M. V., Nikolenko, V. N., Vovkogon, A. D., Oganesyan, M. V., Trishina, A., Babarzai, L., Antonyan, S. Z., Babarzai, F., Pontes-Silva, A., Zharikov, Y. O.
Manuelle Medizin, 2024/11

227

Applying an osteopathic intervention to improve mild to moderate mental health symptoms: a mixed-methods feasibility randomised trial
Hope-Bell, J., Draper-Rodi, J., Edwards, D. J.
Chiropractic & Manual Therapies, 2024/11
Free full text

228

Pelvic joint stiffness and fear of falling in patients over 75 years of age: a prospective cohort study of 100 patients
Laizeau, C., Jochmans, S., Aufaure, S.
Journal of Osteopathic Medicine, 2024/11
Free full text

229

Efficacy of manual therapy for sacroiliac joint pain syndrome: a systematic review and meta-analysis of randomized controlled trials
Trager, R. J., Baumann, A. N., Rogers, H., Tidd, J., Orellana, K., Preston, G., Baldwin, K.
Journal of Manual & Manipulative Therapy, 2024/11

230

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text

231

A systematic review of manual therapy modalities and anxiety
West, K. L., Huzij, T.
Journal of Osteopathic Medicine, 2024/11
Free full text

232

Is Osteopathic Manipulative Treatment Clinically Superior to Sham or Placebo for Patients with Neck or Low-Back Pain? A Systematic Review with Meta-Analysis
Ceballos-Laita, L., Jiménez-Del-Barrio, S., Carrasco-Uribarren, A., Medrano-de-la-Fuente, R., Robles-Pérez, R., Ernst, E.
Diseases, 2024/11

233

Management of Medial Tibial Stress Syndrome with osteopathic manipulative treatment in a basketball player: Case Report
Colli, D., Tarantino, A. G., Bergna, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2024/10

234

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10

235

Effect of manual manipulation on mechanical gait parameters
Yanuck, S. B., Fox, S. K., Harting, B. R., Motyka, T. M.
Journal of Osteopathic Medicine, 2024/10

236

Efficacy of osteopathic manipulative treatment (93.6, ICD-9) - systematic review
Dwornik, M., Puszczałowska-Lizis, E., Wójcik, M., Szajkowski, S., Graczykowski, M., Szymański, D., Marszałek, S.
Medical Studies/Studia Medyczne, 2024/10
Free full text


238

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2024/10

239

Effectiveness of Osteopathic Treatment in Adults with Short Hamstring Syndrome: A Systematic Review
Ogando-Berea, H., Leirós-Rodríguez, R., Hernandez-Lucas, P., Rodríguez-González, Ó
Journal of Clinical Medicine, 2024/10
Free full text

240

Novel Diagnosis and Treatment for Neurogenic Thoracic Outlet Syndrome
Tafler, L., Borkowski, S., Javaid, G., Gandolfo, D., Kleyn, D.
Cureus, 2024/10
Free full text

241

Elite Track and Field Athletes’ Perspective and Experiences of Osteopathic Treatments: A Descriptive Phenomenological Study
Cella, M., Consorti, G., Odorisio, L., Fard, R.
Journal of Bodywork and Movement Therapies, 2024/10

242

Effect of Standard Physical Exercises for Non-specific Low Back Pain Combined with Multimodal Osteopathy Treatment on Pain Intensity and Functional Capacity: A Study Protocol for a Randomized Controlled Trial
Ferreira, C. R., Hort, J. P., Bezerra, L. A., Neto, H. P., Biasotto-Gonzalez, D. A., Politti, F.
Journal of Advances in Medicine and Medical Research, 2024/10
Free full text

243

Conservative, physical and surgical interventions for managing faecal incontinence and constipation in adults with central neurological diseases
Todd, C. L., Johnson, E. E., Stewart, F., Wallace, S. A., Bryant, A., Woodward, S., Norton, C.
Cochrane Database of Systematic Reviews, 2024/10

244

An Osteopathic Approach to Foot Drop: A Case Report of Posterior Fibular Head
Volokitin, M., Libman, A. E., Milani, S., Banihashem, M., Ayon, S.
Cureus, 2024/10
Free full text


246

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10

247

Primary and secondary prevention of musculoskeletal pain and disability in chiropractic, osteopathy, and physiotherapy: A scoping review
Draper-Rodi, J., Delion, T., MacMillan, A., Storey, A. I., Spadaccini, J., Jebi, W., Thomson, O. P., Hohenschurz-Schmidt, D.
International Journal of Osteopathic Medicine, 2024/09
Free full text


249

Efficacy of ankle mobilization on postural control in older people: A systematic review with meta-analysis
Hernández-Guillén, D., García-Gomariz, C., Roig-Casasús, S., Díaz-Díaz, B., Domínguez-Navarro, F., Pérez-Maletzki, J., Blasco, J.M.
International Journal of Osteopathic Medicine, 2024/09
Free full text




253

Osteopathy: A potential ally against anorexia?
Mattatia, J.
Advances in Integrative Medicine, 2024/09

254

Endometriose
(Endometriosis)
Engel-Schulmeyer, A., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

255

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09


257

Positional plagiocephaly: results of the osteopathic treatment of 424 infants. An observational retrospective cohort study
Panza, R., Piarulli, F., Rizzo, V., Schettini, F., Baldassarre, M. E., Di Lorenzo, A., Tafuri, S., Laforgia, N.
Italian Journal of Pediatrics, 2024/09
Free full text


259





263


264

Available Treatments and Adjunctive Therapies for Polycystic Ovarian Syndrome (PCOS) Patients of Reproductive Age: A Scoping Review
Cochran, L., Nadolny, R., Garcia, K., Kluglein, K. A., Yagoda, A., Gandhi, P., Dressel, J., Prol, B., Peralta, R., Shipp, A., Costin, J. M.
Cureus, 2024/09
Free full text

265

Response to “Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection“
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2024/09
Free full text


267

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2024/09
Free full text

268

Trends in Utilization and Cost of Nonpharmacological Pain Therapies in the United States Under Medicare Part B, 2000-2022
Whedon, J., Zakhary, G.
Journal of Integrative and Complementary Medicine, 2024/09

269

Data-driven analysis of whole-brain intrinsic connectivity in patients with chronic low back pain undergoing osteopathic manipulative treatment
Tomaiuolo, F., Cerritelli, F., Delli Pizzi, S., Sestieri, C., Paolucci, T., Chiacchiaretta, P., Sensi, S. L., Ferretti, A.
NeuroImage: Clinical, 2024/08
Free full text

270

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text

271

A Natural Approach to Bell's Palsy: An Osteopathic Treatment Option
Schneider, N., Shih, S., Rundquist, L., Llanio, L., Kurian, A., Ring, A., Barry, P.
Cureus, 2024/08
Free full text

272

A Review on Osteopathic Manipulation in Patients With Headache
Sharath, H. V., Nadipena, P. T., Qureshi, M. I., Phansopkar, P.
Cureus, 2024/08
Free full text

273

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text

274

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08

275

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text

276

The effect of osteopathic manipulative treatment on quality of life in patients with cardiac implantable electronic devices
Nikakis, J., Tale, E., Malkov, D., Arora, U. S., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2024/08
Free full text

277

Post-operative osteopathic manipulative treatment of Morel-Lavallee syndrome assessed using infrared thermal imaging: A case report
Maillot, C., Riquet, D., Stubbe, L., Bodnar, J.L., Houel, N.
Journal of Bodywork and Movement Therapies, 2024/07
Free full text

278

The short- and long-term effect of osteopathic manipulative treatment on pain, and psychosocial factors in adults with chronic low back pain
Nicodemus, C. L., Epstein, J., Huebner, M., DeCicco, B., Shaik, M.
Journal of Osteopathic Medicine, 2024/07
Free full text

279

How completely are randomized controlled trials of non-pharmacological interventions following concussion reported? A systematic review
van Ierssel, J. J., Galea, O., Holte, K., Luszawski, C., Jenkins, E., O', Neil, J., Emery, C. A., Mannix, R., Schneider, K., Yeates, K. O., Zemek, R.
Journal of Sport and Health Science, 2024/07
Free full text

280

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text

281

Interoceptive bodily awareness in patients seeking pain relief with osteopathic manipulative treatment: an observational cohort pilot study
Emmet, D. K., Davis, G., Pierce-Talsma, S., Shubrook, J. H., Mehling, W.
Journal of Osteopathic Medicine, 2024/07
Free full text

282

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07

283


284

The Effects of Osteopathic Manipulative Treatment on Brain Activity: A Scoping Review of MRI and EEG Studies
Bonanno, M., Papa, G. A., Ruffoni, P., Catalioto, E., De Luca, R., Maggio, M. G., Calabrò, R. S.
Healthcare, 2024/07
Free full text

285

Alternative Therapies for Ankyloglossia-Associated Breastfeeding Challenges: A Systematic Review
Chowdhury, R., Khoury, S., Leroux, J., Alsayegh, R., Lawlor, C. M., Graham, M. E.
Breastfeeding Medicine, 2024/07


287

A 25-year-old woman with 7 years of intractable hiccups treated with OMT – A case report
Bowman, D. E., Pohlod, C.
International Journal of Osteopathic Medicine, 2024/06

288

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text

289

Responsiveness to osteopathic manipulative treatments in people with non-specific low back pain: A secondary analysis of the LC-OSTEO trial
Rören, A., Yagappa, D. M., Zegarra-Parodi, R., Fabre, L., Krief, G., Daste, C., Lefèvre-Colau, M. M., Rannou, F., Nguyen, C.
Annals of Physical and Rehabilitation Medicine, 2024/06

290

Effects of osteopathic manipulative therapy on recurrent pelvic pain and dyspareunia in women after surgery for endometriosis: a retrospective study
Alboni, C., Melegari, S., Camacho Mattos, L., Farulla, A.
Minerva Obstetrics and Gynecology, 2024/06

291

Reported biological effects following Osteopathic Manipulative Treatment: A comprehensive mapping review
Dal Farra, F., Bergna, A., Lunghi, C., Bruini, I., Galli, M., Vismara, L., Tramontano, M.
Complementary Therapies in Medicine, 2024/06

292


293

From finger to breast: OMT helps latch
Barr, J., O'Donnell, A.
The AAO Journal, 2024/06

294

Osteopathic Manipulative Treatment, a Novel Adjunct in Sickle Cell Disease Care: Interim Safety and Feasibility Analysis
Brown, A., Eyassu, E., Hoffmann, L., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
The AAO Journal, 2024/06

295

The Role of Osteopathic Structural Findings in Meningitis
Cecil, E., Burke, D.
The AAO Journal, 2024/06

296

Efficacy of Osteopathic Manipulative Treatment in Post-Stroke Recovery Patients
Dalton, D., Walker, A., Vu, P., Medina, C.
The AAO Journal, 2024/06

297

OMT Improves Diaphragm Range of Motion on Ultrasound Imaging
DiSabato, X., Atkinson, E., Kozar, A. J., Robinson, L., Dixon, E.
The AAO Journal, 2024/06

298

OMT in Headache Management: Systematic Review and Meta-Analysis Protocol
Gibson, E., Will, M., Garcia, C. J., Johnson, R., Kirsch, J. R., Spencer, D. V., Wang, M. Y.F., Rehman, Y., Snider, K. T.
The AAO Journal, 2024/06




302

Short leg syndrome in clinical practice
(Синдром короткой ноги в клинической практике)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06






308

Seize the Dura: An Osteopathic Approach to Postictal Delirium
Vijayakar, R., Obialo, S., Nixon, K.
The AAO Journal, 2024/06




312

Workin’ 9 to 5, but Now Can Thrive: Chronic Headache Diagnosed and Treated with OMT
Bernett, A. M., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06


314

Osteopathic Management of Bertolotti Syndrome
Bowen, A., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06

315

Resolution of Notalgia Paresthetica Symptoms following Osteopathic Manipulative Treatment (OMT): A Case Report
Bressler, K., Macmillan, G., Mancini, J., Yao, S. C., Papadopoulos, D., Abu-Sbaih, R.
The AAO Journal, 2024/06





320

Osteopathic Management of Chronic Pain Following Bilateral Periacetabular Osteotomy in Developmental Hip Dysplasia
Edgar, T., Heller, G. R., Hutson, M., Melin, D., Bardowell, A.
The AAO Journal, 2024/06




324

Stagnating the Symptomatic Progression of Primary Lateral Sclerosis
Geyer-Roberts, E., Desai, B., Perez, J., Grote, J., Helderlein, P., Posey, A.
The AAO Journal, 2024/06


326

Transforming Fibromyalgia Care: An Osteopathic Route to Improving Quality of Life
Kurian, A., Schneider, N., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06

327

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06

328

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06


330

Effects of OMT on Blood Glucose and Insulin Sensitivity in Adult Male Rats
Petrillo, G., Staudt, M., Lobo, S., Cai, W., Keys, J.
The AAO Journal, 2024/06

331

OMT in the 21st century: current use of technologies in manual therapy education and opportunities for innovation
Pietrantoni, D., Krzykwa, E., Broussard, D., Fredrickson, T., Waters, H., Mehra, R.
The AAO Journal, 2024/06


333

Osteopathic Manipulative Treatment in Occipital Neuralgia
Ring, A., Llanio, L., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06

334

An Osteopathic Approach to Cervicogenic Vertigo
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2024/06

335


336

An Osteopathic Approach to Temporomandibular Dysfunction Secondary to A Motor Vehicle Accident
Schneider, N., Kurian, A., Widboom, N., Qureshi, Y.
The AAO Journal, 2024/06

337

An Osteopathic Approach to Eyelid Myokymia
Shih, S., Rundquist, L., Qureshi, Y.
The AAO Journal, 2024/06

338

Effect of Osteopathic Manipulative Treatment (OMT) for Symptomatic Headache Relief in Long-COVID Patient: A Case Report
Unser, K., Thomas, A., Cornwell, S., Yao, S. C., Keys, J.
The AAO Journal, 2024/06

339

Osteopathic Manipulative Medicine and Disorders: An Overview of Peer-Reviewed Publications 2018-2022
White, C., Xie, Y., Bigham, J., Stanczak, A., Ninan, D., Hu, C. A.
Cureus, 2024/06
Free full text

340

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06


342

Case Study: The Effect of Osteopathic Manipulation on Diabetic Gastroparesis
Yazdi, S. A., Tucker, D., Hwang, G., Majeed, A., Hsubrook, J. H., Penq, N.
The AAO Journal, 2024/06


344

Increased Alertness in Comatose Patient After Osteopathic Manipulative Treatment: A Case Report
Garcia, A. E., Kay, K., Perera, M. X., Martinez, E. S., Onyi, S., Nourani, B., Loveless, B.
The AAO Journal, 2024/06

345

An Alternative Approach to Median Arcuate Ligament Syndrome
Geyer-Roberts, E., Wallace-Ross, J.
The AAO Journal, 2024/06

346

Successful Treatment using OMT for Chronic GERD in a Pediatric Patient
Shams, S., Chohan, M. M., King, A.
The AAO Journal, 2024/06

347

Osteopathic Approach to the Voice
Surve, S.
The AAO Journal, 2024/06


349

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic low back pain: a single-blinded randomized controlled trial
Popovich, J. M., Cholewicki, J., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan, A.
Journal of Osteopathic Medicine, 2024/05
Free full text

350

Immediate Effects of Integrative Health and Medicine Modalities Among Outpatients With Moderate-To-Severe Symptoms
Rodgers-Melnick, S. N., Srinivasan, R., Rivard, R. L., Adan, F., Dusek, J. A.
Global Advances in Integrative Medicine and Health, 2024/05
Free full text

351

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05


353

The Effects of Osteopathic Manipulative Treatment (OMT) on Postoperative Length of Stay: A Meta-Analysis
Henwood, L., Le Donne, M. E., Vaughn, A., Kamil, S., Harrington, A., Scott, R.
Cureus, 2024/05
Free full text


355

The Efficacy of Early Osteopathic Therapy in Restoring Proper Sucking in Breastfed Infants: Preliminary Findings from a Pilot Study
Parodi, A., Ruffa, R., De Felice, V., Sartini, M., Cristina, M. L., Martino, B., Bianco, F., Di Stefano, R., Mazzella, M.
Healthcare, 2024/05
Free full text

356

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05

357

Implementing paper-based patient-reported outcome collection within outpatient integrative health and medicine
Srinivasan, R., Rodgers-Melnick, S. N., Rivard, R. L., Kaiser, C., Vincent, D., Adan, F., Dusek, J. A.
PLoS One, 2024/05
Free full text


359

Manual Therapy of Dysphagia in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
De Marchi, I., Buffone, F., Mauro, A., Bruini, I., Vismara, L.
Medicina, 2024/05
Free full text

360

Effect of osteopathic manipulative treatment and Bio-Electro-Magnetic Energy Regulation (BEMER) therapy on generalized musculoskeletal neck pain in adults
Palmer, G. M., Dominick, N., Kane, M., Bawek, S., Burch, B., Sanders, T., Phrathep, D., Myers, N., Lorenzo, S.
Journal of Osteopathic Medicine, 2024/04
Free full text


362

Lumbar Spinal Stenosis: Diagnosis and Management
Webb, C. W., Aguirre, K., Seidenberg, P. H.
American Family Physician, 2024/04

363

Overview of Treatment Options for Mild Traumatic Brain Injury: A Literature Review
Patel, H., Polam, S., Joseph, R.
Cureus, 2024/04
Free full text


365

How do Australian osteopaths manage migraines? Outcomes from a national practice-based research network
Fleischmann, M., Vaughan, B., Campbell, C., Ekberg, J., Evans, M., Green, M., Ong, A., Pitrone, G., Lane, R., Adams, J.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text


367

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03


369

The effectiveness of manipulation in combination with exercise for patients with coccydynia: Six months follow-up of a randomized controlled trial
Tufekci, O., Yilmaz, K., Gercek, H., Unuvar, B. S.
International Journal of Osteopathic Medicine, 2024/03


371

Rehabilitation after severe gaff disease
(Реабилитация после тяжелого течения гаффской болезни)
Lebedeva, D. I., Turovinina, E. F., Marchenko, A. N., Aptekar, I. A., Raspopova, Y. I., Suvorov, A. Y., Bychenko, S. M.
Russian Osteopathic Journal, 2024/03






377

Osteopathic techniques and manual rotation of the fetal head successfully resolve mechanical dystocia
Miletić, A. I., Habek, D., Medić, F.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/03



380

Osteopathisch-manipulative Behandlung bei herzchirurgischen Patient*innen: Eine systematische Übersicht
(Osteopathic-manipulative treatment in cardiac surgery patients: A systematic review)
Rorris, F.P., Skouteli, E.A. T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
Osteopathische Medizin, 2024/03
Free full text

381

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

382

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

383

A Survey Assessment of Neurosurgeons’ Interest in Osteopathic Medicine and Its Integration Into Their Practice.
Kolmetzky, D W, Gooder, D B, Polly, E S, Glisan, S. N., Al-Atrache, Z., Badger, C. A., Yocom, S. S., Turtz, A. R., Allison, D. L.
Cureus, 2024/03

384

Osteopathic manipulative treatment for pediatric Long-COVID headache: A case report
Danto, S. E., Danto, J. B.
International Journal of Osteopathic Medicine, 2024/03

385

Utility of Osteopathic Manipulation Treatment in MTBI Patients With PPCS and Cervicogenic & Vestibuloocular Profiles
Chen, A., Gross, A., Marshall, J., Anilkumar, A., Patel, N., Maes, L., Mulumba, D., Dusenberry, B.
Clinical Journal of Sport Medicine, 2024/03

386

Investigation of Immediate Effects of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S., Matthias, A., Roush, A., Wilson, H., Nicholas, J., Edwards, C., Mangum, K., Pickett, B.
Clinical Journal of Sport Medicine, 2024/03

387

Meta-epidemiologic review: Blinding and sham treatment in clinical trial design for osteopathic manipulative treatment research
Irving, R., Schmidt, E., Stone, M., Fleming, R. K., Xie, J. Y.
International Journal of Osteopathic Medicine, 2024/03

388

Effect of Osteopathic Manipulation in an Autism Spectrum Child With Speech Impairment and Attention Deficit: A Case Report
Sharath, H. V., Raghuveer, R., Qureshi, M. I., Warghat, P. A., Desai, S., Brahmane, N. A.
Cureus, 2024/03
Free full text

389

Effect of physiotherapy on infertility treatment in polycystic ovary syndrome patients
Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jędrzejczyk, S., Jerzak, M., Jerzak, M.
Przegląd Menopauzalny, 2024/03

390

Osteopathic manipulative treatment for autism spectrum disorder: Three case reports
Wolf, K., Widjaja, F., O'Keefe, W., Chen, Y., Breard, M., Parenteau, C., Keys, J., Riemer, R., Hendren, R. L.
International Journal of Osteopathic Medicine, 2024/03

391

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03

392

Effects of osteopathic manipulative treatment on maternal-fetal hemodynamics in third trimester pregnant women: A prospective study
Arruda Correia, M. L., Peixoto Filho, F. M., Gomes Júnior, S. C., de Jesus, G. R.
PLoS One, 2024/03
Free full text

393

Potential mechanisms for osteopathic manipulative treatment to alleviate migraine-like pain in female rats
Byrd, K., Lund, M., Pan, Y., Chung, B. H., Child, K., Fowler, D., Burns-Martin, J., Sanikommu, M., Henderson, H., Gregory, C., Fleming, R. K., Xie, J. Y.
Frontiers in Pain Research, 2024/02
Free full text

394

Osteopathic approach as an additional therapy of infertility in women with PCOS
Jędrzejczyk, S., Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jerzak, M., Jerzak, M.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/02

395


396

The endogenous oxytocin after manipulative osteopathic treatment in full-term pregnant women
Ragusa, A., Svelato, A., Fogolari, M., Ficarola, F., Plotti, F., De Luca, C., D'Avino, S., Davini, F., De Cesaris, M., Messina, G., Bertolini, A., Marci, R., Angeletti, S., Angioli, R., Terranova, C.
European Review for Medical and Pharmacological Sciences, 2024/02

397

Application Of Osteopathic Treatment for Non-Pain–Related Discomforts of Pregnancy: A Literature Review
Gomperts, J., Carroll, L., Powers, B., Rodriguez, A.
Osteopathic Family Physician, 2024/02

398

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02

399



401

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text

402

Interdisciplinary Approach to Orthodontic Treatment Involving an Osteopath and a Dentist (Protocol)
Aptekar, I. A., Abramova, E. V., Postnikov, M. A., Kopetsky, I. S., Eremin, D. A., Postnikova, E. M., Poluianova, E. B., Aptekar, V. I., Muravyov, I. O.
Bulletin of Russian State Medical University, 2024/02
Free full text

403

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text

404

Osteopathic Manipulative Treatment in Dysmenorrhea: A Systematic Review
Bonner, P. E., Paul, H. A., Mehra, R. S.
Cureus, 2024/01
Free full text


406

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

407

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

408

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01



411

Assessment of Long-term Effects of Adding Osteopathic Manipulative Treatment to Neck Exercises for Individuals With Non-specific Chronic Neck Pain: A Randomized Trial
Groisman, S., da Silva, L., Sanches, T., Rocha, C., Malysz, T., Jotz, G.
Journal of Chiropractic Medicine, 2023/12


413

Investigating the current published literature where osteopathic manual therapy is used as an intervention: A scoping review
Ryan, H., Friedlander, T., Anderson, H., Mason, J.
International Journal of Osteopathic Medicine, 2023/12

414

Osteopathic Manipulative Treatment for Chronic Bronchiectasis: A Case Report
Abend, D., Powell, L., Sivanandam, A., Nayar, R.
Osteopathic Family Physician, 2023/12






420

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text

421

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12

422

Preliminary Evaluation of an Osteopathic Manipulative Treatment to Prevent Motion Sickness
Thomas, V. A., Kelley, A. M., Lee, A., Fotopoulos, T., Boggs, J., Campbell, J.
Aerospace Medicine and Human Performance, 2023/12

423

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/12
Free full text


425

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12

426

Safety and Efficacy of Osteopathic Manipulative Treatment (OMT) in the Pediatric Oncology Inpatient Setting
Brown, A., Hoffman, L., Eyassu, E., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
Journal of Osteopathic Medicine, 2023/12

427

OMT Alleviated Migraine-Like Pain via Blockade of Trigeminal Activation
Child, K., Fowler, D., Pan, Y., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2023/12


429

Investigation of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S. P., Matthias, A., Roush, A. J., VanderMerwe, D., Starr, E. G., Wong, W. J., Parker, L. M., Nicholas, J. M., Wilson, H.
Journal of Osteopathic Medicine, 2023/12

430

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12

431

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12

432

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12

433

The Efficacy of Osteopathic Manipulation Treatment (OMT) on Post-Operative Outcomes: An Abstract
Reddy, P., Santhakumar, K.
Journal of Osteopathic Medicine, 2023/12


435

Efficacy of Osteopathic Manipulation Therapy in the Treatment of Post-concussive Versus Primary Migraines
Song, J., Hall, T., Waddington, M.
Journal of Osteopathic Medicine, 2023/12

436

Analyzing ChatGPT’s Proficiency In Multiple Choice Osteopathic Manipulative Medicine Questions: Insights and Implications
Sundin, A., Gawash, A., Zia, H., Lo, D. F., Averell, N., King, A., Powell, L.
Journal of Osteopathic Medicine, 2023/12

437

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
Free full text


439

Osteopathic Manipulative Treatment on Predominantly African American Hospitalized Coronavirus Disease 2019 Patients during Michigan’s First Wave.
Soni, E., Kattan, M., Jackson, N. M., Mainor, I., Corser, W.
MI Medical Education and Health Bulletin, 2023/11
Free full text




443

Effekte von Osteopathie auf Migräne
(Effects of osteopathy on migraine)
Pöchlauer-Schneck, J.
Unpublished MSc thesis, 2023/11







450

Osteopathic Manipulative Medicine and Its Role in Psychiatry
Bowes, M. R., Speicher, M. R., Tran, L. T., Santiago, P. N.
Cureus, 2023/10
Free full text




454

Case History #4
Coffey, D.
The AAO Journal, 2023/09
Free full text

455



457

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text

458

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09

459

Osteopathic treatment for cam-type Femoroacetabular impingement syndrome: A case report
Kilic, R. T., Yosmaoglu, H. B., Bayrakci Tunay, V.
International Journal of Osteopathic Medicine, 2023/09

460

Quantitative ultrasound to assess efficacy of treatment for neck somatic dysfunctions: a feasibility study
Tran, A., Ngo, T., Roberts, T., Ko, E., Holmgren, J. G., Edwards, C., Coleman, M., Gao, J.
Journal of Osteopathic Medicine, 2023/09
Free full text


462






467



469

Osteopathic Manual Therapy for Infant Colic: A Randomised Clinical Trial
Martínez-Lentisco, M. D. M., Martín-González, M., García-Torrecillas, J. M., Antequera-Soler, E., Chillón-Martínez, R.
Healthcare, 2023/09
Free full text

470

Evaluation of the effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in chronic nonspecific low back pain. A protocol for a randomised controlled trial
Armbrust, D., Fonseca, C. L., Lopes Dumont, A. J., Viegas da Trindade, A. M., Neto, H. P., Oliveira, C. S.
International Journal of Osteopathic Medicine, 2023/09

471

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09

472


473

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text

474

A Novel Approach to Assessing and Conservatively Treating Anterior Cutaneous Nerve Entrapment Syndrome: A Case Study
Newman, D. P., Holkup, S. M., Masi, E. L., Soto, A. T.
Cureus, 2023/09
Free full text

475

Osteopathic Manipulative Treatment for a Chronic Rotator Cuff Tear: A Case Report
Scypinski, L. J., Bonitz, T. J., Lomiguen, C. M., Chin, J.
Cureus, 2023/09
Free full text



478

The process and outcomes of chronic low back pain treatment provided by osteopathic and allopathic physicians: a retrospective cohort study
Licciardone, J. C., Kellerlee, J., Joseph, M., Mohammad, M. B., Kim, K. G., Jain, J., Aryal, S.
Journal of Osteopathic Medicine, 2023/08
Free full text

479

Osteopathic manipulative treatment for concussions and postconcussive syndrome in athletes: a literature review
Thomas, K. D., Lombard, Z. K., Shadiack, A. L.
Journal of Osteopathic Medicine, 2023/08
Free full text

480

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text

481

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text


483

Awareness and interest in osteopathic manipulative treatment in allopathic medical students
Darby, A., Parascando, J. A., Lipinski, M., Lipinski, C., Mendez-Miller, M., Berg, A., Rabago, D., Oser, T. K.
Journal of Osteopathic Medicine, 2023/08
Free full text

484

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text

485

Systematic review and meta-analysis showed that complementary and alternative medicines were not effective for infantile colic
Cabanillas-Barea, S., Jiménez-del-Barrio, S., Carrasco-Uribarren, A., Ortega-Martínez, A., Pérez-Guillén, S., Ceballos-Laita, L.
Acta Paediatrica: Nurturing the Child, 2023/07
Free full text

486

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text

487

Effectiveness of Osteopathic Manipulative Treatment in Treating Symptoms of Irritable Bowel Syndrome: A Literature Review
Lotfi, C., Blair, J., Jumrukovska, A., Grubb, M., Glidden, E., Toldi, J.
Cureus, 2023/07
Free full text


489

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text

490

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07

491

Effectiveness of visceral fascial therapy targeting visceral dysfunctions outcome: systematic review of randomized controlled trials
da Silva, F. C., Vieira, L. S., Santos, L V., Gaudreault, N., Cruvinel-Júnior, R H., Santos, G M.
BMC Complementary Medicine and Therapies, 2023/07
Free full text

492

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06
Free full text

493

An Osteopathic Approach to Dizziness Secondary to Meniere’s Disease
Grote, J., Perez, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text



496

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
Free full text


498

Resolution of a Plica Band Syndrome with Osteopathic Manipulative Treatment
Barr, J., Heller, G.
The AAO Journal, 2023/06
Free full text

499

An Osteopathic Approach to Chronic Inflammatory Demyelinating Polyneuropathy
Baxter, C., Grote, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text


501

Nervous System Under Attack
Blaukovitch, C., Unger, M., Thorsvik, N., Heller, G.
The AAO Journal, 2023/06
Free full text

502

Happy Feet are Dancing Feet, Response to OMT in a Patient with Morphea Profunda: A Case Report
Bomani-Bailey, A., Ettlinger, H.
The AAO Journal, 2023/06
Free full text

503

Comparison of Tone and Stiffness Changes to Lumbar Paraspinal Muscle with Varying Osteopathic Treatment Modalities (254)
Companion, N., Guha, A., Naeem, A., Abu-Sbaih, R., Keys, J., Yao, S.
The AAO Journal, 2023/06
Free full text

504

The Effects of Osteopathic Manipulative Treatment (OMT) on an Infant with Failure to Thrive (FTT); A Case Study
Cornwell, S., Yao, S., Abu-Sbaih, R.
The AAO Journal, 2023/06
Free full text

505

Osteopathic Manipulative Treatment Reduces Pain and Improves Range of Motion in Patients with Chronic Neck Pain
Daly, E., Prodoehl, J., Bolch, C., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2023/06
Free full text



508

Drug Induced Tibial Nerve Neuropathy in Former Collegiate Baseball Player
Dickey, Z., Turnbull, J., Sharma, N., Aldret, S.
The AAO Journal, 2023/06
Free full text

509

Cranial Osteopathic Manipulative Treatment for Post-COVID Syndrome
Drakeley, C., Shah, R., Waters, H., Mehra, R., Kumaran, N., Johnson, T.
The AAO Journal, 2023/06
Free full text

510

Stalled out: An Osteopathic Approach To A Post-Traumatic Gastroparesis
Fisher, B., Vijayakar, R., Coppinger, J., Motashaw, V.
The AAO Journal, 2023/06
Free full text

511

An Osteopathic Approach to Shoulder Injury Following Post-Hemorrhage Hemiparesis
Geyer-Roberts, E., Helderlein, P., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text

512

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06


514

Intersegmental sacral dysfunction as primary etiology of low back pain in a college athlete: A case study
Householder, L., Veach, A., Diefenderfer, J.
The AAO Journal, 2023/06
Free full text

515


516

International Overview of Osteopathic Manipulative Treatment in Infants with Nonsynostotic Plagiocephaly: A Scoping Review to Aid in the Inclusion of OMT into the Current Evidence-Based Treatment Guidelines
Jimenez, R., Cao, G., Bomstad, C., Myxter, K., Lozano, A., Tran, M.T., Roettger, V., Gubler, K. D., Brooks, B., Branda, A.
The AAO Journal, 2023/06
Free full text

517

The Effects of Osteopathic Manipulative Treatment (OMT) on Rare Diseases- Gordon Syndrome
Johnson, T. A., Waters, H.
The AAO Journal, 2023/06
Free full text

518

Osteopathic Manipulative Treatment for Enhanced Functional Recovery in Stroke Survivors
Kumaran, N., Drakeley, C., Waters, H., Mehra, R.
The AAO Journal, 2023/06
Free full text


520

The 5 Models of Osteopathic Medicine, An Approach to Transgendered Care: A Case Report
Lentz, A., Koehler, T., Caldwell, G., Fremarek, N.
The AAO Journal, 2023/06
Free full text

521

Case Study on the Effect of Osteopathic Manipulation on Gallbladder Ejection Fraction
Lin, E., Montalvo, E., Garcia Garcia, D., Adams, N., Sparks, C., Gibson, J., Seals, R.
The AAO Journal, 2023/06
Free full text


523

Osteopathic Treatment of Chronic Chest Pain After Trauma
Martini, J., Veach, A.
The AAO Journal, 2023/06
Free full text

524

Effects of OMT on Running Performance and Recovery
Matz, O., Gustafson, H., Hartwell, L., Rudberg-Post, L., Lewis, D.
The AAO Journal, 2023/06
Free full text

525


526

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study, Part 2
Miranda, E., Feketeova, E., Giza, J.
The AAO Journal, 2023/06
Free full text

527

An Osteopathic Approach to Dysmenorrhea
Paul, H., Bonner, P., Mehra, R.
The AAO Journal, 2023/06
Free full text



530

The Effect of OMT on Insulin Sensitivity and Glucose Control in Rodent Models: A Pilot Study
Petrillo, G., Cai, W., Keys, J.
The AAO Journal, 2023/06
Free full text

531

An Osteopathic Approach To Refractory Sternal Pain
Risov, D., Geer, R.
The AAO Journal, 2023/06
Free full text

532

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
Free full text

533

Palpatory tests in manual therapies: an international survey on osteopathic clinical practice
Novelli, E., Molinari, L., Consolo, S., Mingrone, L.
Journal of Complementary and Integrative Medicine, 2023/06
Free full text

534

An Osteopathic Approach to Plagiocephaly in the Absence of Pre-Post Sphenoid Fusion
Rosten, C., Nixon, K., Jons-Cox, L.
The AAO Journal, 2023/06
Free full text


536

Refractory Temporomandibular Joint Pain Resolved with Intraoral Osteopathic Manipulative Treatment
Shah, R., Drakeley, C., Mehra, R.
The AAO Journal, 2023/06
Free full text

537

Ultrasound Assessment of OMT on Diaphragm Motion
Snow, N., DeDi, C., Rathjen, S., Redden, D. T., Kozar, A., Robinson, L.
The AAO Journal, 2023/06
Free full text

538

26.2 Miles: A Case Study of Osteopathic Manipulative Treatment in Marathon Training
Sofka, M., Giovanis, A.
The AAO Journal, 2023/06
Free full text





543

Osteopathic Manipulative Medicine as an Adjuvant Treatment for Hemicrania Continua: A Case Study
Van Fossen, E., Kanithi, M., Jelneck, S., Ferguson, D., Tran, J., Bui, N., Hassan, D., Gordon, T.
The AAO Journal, 2023/06
Free full text

544



546

Osteopathic Manipulative Treatment of Chronic Pelvic Pain due to High-Tone Pelvic Floor Dysfunction
Barnett, M. E., Henderson, K. K., Elliott-Burke, T. L., Heinking, K. P.
Osteopathic Family Physician, 2023/06

547

Incorporation of an osteopathic-focused lecture series into an already established pediatric residency curriculum
Wysong, M., Copenheaver, D., Powers, L., Flaherty, R.
The AAO Journal, 2023/06
Free full text

548

Effect of OMT on post-anoxic brain injury resulting in intractable myoclonus
Zhong, X., Campo, Z., Torrents, M.
The AAO Journal, 2023/06

549

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06



552

Somatic Dysfunction. Clinical Guidelines 2023
(Соматическая дисфункция. Клинические рекомендации 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
Free full text

553

Pressure force on tissues in various osteopathic techniques (pilot study
(Сила давления на ткани при различных остеопатических техниках (пилотное исследование)
Mokhov, D. E., Tregubova, E. S., Potekhina, Y. P., Smirnova, L. M., Kolyshnitsyn, N. Y., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/06
Free full text



556

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06

557

Use of osteopathic manipulative treatment in management of intractable singultus and associated symptoms
Bloch, R. R., Kempa, M. R., Lippert, J. A.
International Journal of Osteopathic Medicine, 2023/06


559

Utilization and Reimbursement Trends of Osteopathic Manipulative Treatment for Medicare Patients: 2000-2019
Starr, E., Smith, J. F., Hanson, R. B., Woolstenhulme, J. B., Roush, A. J., Sperry, N. B., Wilde, B., Brooks, A., Zapata, I.
Journal of Osteopathic Medicine, 2023/06
Free full text




563

Osteopathy in the Early Diagnosis and Management of Degenerative Cervical Myelopathy: National Survey
Brannigan, J. F. M., Mowforth, O. D., Rogers, M., Wood, H., Karimi, Z., Kotter, M. R. N., Davies, B. M.
JMIR Formative Research, 2023/05
Free full text


565

Serological Assessment of the Effectiveness of Osteopathic Manipulative to Augment the Covid-19 Vaccine Immune Response
Martinez, E., Loveless, B., Crone, P., Szurmant, H., Fuchs, S., Sanchez, J.
Journal of Investigative Medicine, 2023/05

566

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05

567

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05

568

Evaluation of Osteopathic Manipulative Treatment in Patients with Chikungunya Fever in the Chronic Phase: A Randomized Controlled Trial
Tenorio, L., Mello, K., Maia, M., Valença, A., Duarte, Â., Marques, C.
Journal of Clinical Rheumatology, 2023/05


570

Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine
Alvarez, G., Lucas, S., Roura, S.
Journal of Osteopathic Medicine, 2023/05
Free full text

571

Osteopathic manipulative treatment of patients with chronic low back pain in the United States: a retrospective cohort study
Licciardone, J. C., Moore, S., Fix, K., Blair, L. G., Ta, K.
Journal of Osteopathic Medicine, 2023/05
Free full text

572

Osteopathic Manual Treatment Compared to Kaltenborn-Evjenth Orthopedic Manual Therapy for Chronic Low Back Pain: A Randomized Study
Lizis, P., Kobza, W., Jaszczur-Nowicki, J., Wisniewski, D.
Alternative Therapies in Health and Medicine, 2023/05

573

Efficacy of the Osteopathic Pedal Pump in Reducing Lower Limb Volume in Older Adults with Lymphedema
Parikh, S. H., Adams, J. S., Goodwin, B. J., McLaughlin, M. H., Noll, D. R.
Journal of the American Geriatrics Society, 2023/04

574

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: Randomized controlled trial
Boas Fernandes, W. V., Politti, F., Blanco, C. R., Garcia Lucareli, P. R., Gomes, C. A. F. d. P., Corrêa, F. I., Corrêa, J. C. F.
Journal of Bodywork and Movement Therapies, 2023/04

575

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text

576

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text

577

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text

578

Validation of subjective manual palpation using objective physiological recordings of the cranial rhythmic impulse during osteopathic manipulative intervention
Pelz, H., Müller, G., Keller, M., Mathiak, K., Mayer, J., Borik, S., Perlitz, V.
Scientific Reports, 2023/04
Free full text

579

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

580

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

581

Osteopathic Findings and Treatment of Patient with Crohn's Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text



584

Communication strategies in psychologically informed osteopathic practice: A case report
Abbey, H.
International Journal of Osteopathic Medicine, 2023/03

585

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text


587

Covid-19 Fatigue: Diagnosis and Treatment for the Osteopathic Physician
Foss, V. B., Maddie, N., Frankini, E. L., Landman, S., Maccagnano, J., Yao, S. C.
Osteopathic Family Physician, 2023/03


589

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03

590


591

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text

592

Response to “Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine“
Rehman, Y., Kirsch, J., Snider, K. T.
Journal of Osteopathic Medicine, 2023/03
Free full text

593

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03

594

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03

595

Osteopathic Findings and Treatment of Patient with Crohn’s Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text










605

Osteopathic intervention for infants with breastfeeding difficulty: A retrospective case series
Greenwood, K., Engel, R., Grace, S.
International Journal of Osteopathic Medicine, 2023/03











616

Osteopathic Manipulation as a Method of Cortisol Modification: A Systematic Review
Thibaut, D., Santarlas, V., Hoppes, J., Vásquez-Castillo, A., Morrow, A., Oviedo, E., Toldi, J.
Cureus, 2023/03
Free full text



619

Weibliche Genitalverstümmelung und Osteopathie
(Female genital mutilation and osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

620

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text

621

The Impact of Complementary and Integrative Medicine Following Traumatic Brain Injury: A Scoping Review
Kim, S., Mortera, M. H., Wen, P. S., Thompson, K. L., Lundgren, K., Reed, W. R., Sasson, N., Towner Wright, S., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
The Journal of Head Trauma Rehabilitation, 2023/02
Free full text




625


626

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01


628

An exploration of the experience of osteopaths managing individuals with endometriosis
Zeigler, Z. L.
Unpublished MSc thesis, 2023/01
Free full text

629

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text


631

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text

632

Concussion-related visual memory and reaction time impairment in college athletes improved after osteopathic manipulative medicine: a randomized clinical trial
Mancini, J. D., Angelo, N., Abu-Sbaih, R., Kooyman, P., Yao, S.
Journal of Osteopathic Medicine, 2023/01
Free full text

633

Effectiveness of osteopathic manipulative treatment in cardiovascular function: a systematic review protocol
Vanier, C., Johnston, K., DeArmond, M., Salloum, L., Arjmand, S., Toder, E., Ioudina, M.
JBI Evidence Synthesis, 2023/01
Free full text


635

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Wang, M. Y., Ferguson, H., Bingham, J., Senger, B., Swogger, S. E., Johnston, R., Snider, K. T.
Journal of Osteopathic Medicine, 2023/01


637

(Osteopathy as a treatment proposal for patients with temporomandibular disorders: a systematic review)
Pereira de Paula, R., Oliveira da Silva Almeida, D., Garcia de Paula, G., Moreira Alves, L., Oliveira Silva, M., Rodrigues da Cunha, M., Iatecola, A., Ramos Fernandes, V.A., Rodrigues Silva, V., de França, E., Barroso Hirota, V.
Revista Multidisciplinar da Saúde, 2023
Free full text



640

Corrigendum to “Treatment of infant colic with craniosacral therapy. A randomized controlled trial“ [Complement Ther Med 71 (2022) 102885]
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/12
Free full text

641


642

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12








650

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/12










660

Evaluation of Osteopathic Principles in Cadaveric Specimens Using Radiological Assessment
Siddiqi, I., Wang, A., Marino, M., Bowen, I., Miulli, D. E.
Cureus, 2022/12
Free full text

661

Pain and functional recovery from chronic low back pain over 12 months: implications for osteopathic medicine
Licciardone, J. C., Pandya, V.
Journal of Osteopathic Medicine, 2022/12
Free full text

662

Acupuncture and Osteopathic Medicine for Atopic Dermatitis – a Three-armed Randomized Controlled Explorative Clinical Trial
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Clinical and Experimental Dermatology, 2022/12
Free full text

663

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic neck pain: A single-blinded randomized controlled trial
Cholewicki, J., Popovich, J. M., Jr., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/12


665

Preliminary Results from a Randomized Controlled Trial on the Efficacy of Osteopathic Manipulative Medicine in Recovery from Concussions
Benedict, A. B., Torretta, C., Cholewicki, J., DeStefano, L. A., Fitton, N., Saffarian, M., Popovich, J. M., Zatkin, M., Lee, A., Sikorskii, A., Leslie, L., Shiver, Z.
Journal of Osteopathic Medicine, 2022/12

666

Effects of Osteopathic Manipulative Treatment on Primary Dysmenorrhea
Companion, N., Ahmed, E., Keys, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12

667

The Use of Osteopathic Manipulative Treatment (OMT) in the Management of Patients With Post-COVID Symptoms
Foss, V., Kaur, J., Stoukides, G., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12


669

A Feasibility Study to Assess OMT for NAS
Householder, L., Glynn, B., Wadman, H., Hoffmann, K.
Journal of Osteopathic Medicine, 2022/12

670

Use of Osteopathic Manipulative Medicine in Treating Migraines
Lund, M., Pan, Y., Burns-Martin, J., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2022/12

671

Reduction in Stress Among Frontline Healthcare Workers Receiving Osteopathic Manipulation
Schnautz, R., Eilerman, A., Faherty, M.
Journal of Osteopathic Medicine, 2022/12

672

Impact of Osteopathic Manipulative Techniques on the Management of Dizziness Caused by Neuro-Otologic Disorders: Systemic Review and Meta-Analysis
Senger, B., Rehman, Y., Snider, K. T., Kirsch, J., Wang, M. Y.F., Johnston, R., Bingham, J., Ferguson, H., Swogger, S.
Journal of Osteopathic Medicine, 2022/12

673

Osteopathic Manipulative Treatment Efficacy in Mean HIT-6 Score Reduction in Tension-Type Headaches: A Meta-Analysis
Tran, E., Thomas, C., Zheng, T., Thalody, A., Winegar, A., Torelli, V., Wu, S. S.
Journal of Osteopathic Medicine, 2022/12


675

A Randomized Controlled Trial of Osteopathic Manipulative Therapy to Reduce Cranial Asymmetries in Young Infants with Nonsynostotic Plagiocephaly
Bagagiolo, D., Priolo, C. G., Favre, E. M., Pangallo, A., Didio, A., Sbarbaro, M., Borro, T., Daccò, S., Manzoni, P., Farina, D.
American Journal of Perinatology, 2022/12

676

Diagnosis and management of headache disorders in osteopathic practice: A qualitative study
Tripodi, N., Cordina, J., Jaffre, D., Mason, K., McMahon, G., Xeureb-Graham, B., Yanovsky, R., Wospil, R.
International Journal of Osteopathic Medicine, 2022/12



679

Physiotherapists and Osteopaths' Attitudes: Training in Management of Temporomandibular Disorders
Saran, S., Saccomanno, S., Petricca, M. T., Carganico, A., Bocchieri, S., Mastrapasqua, R. F., Caramaschi, E., Levrini, L.
Dentistry Journal, 2022/11
Free full text


681

Osteopathic Manipulative Medicine for Chronic Pain in the Setting of Cerebral Palsy
Dixon, D. S., Elwert, N. C., McDermott, G. A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/11

682

Osteopathy: effectiveness and safety for musculoskeletal pain and overview of training and quality requirements. AIHTA Project Report No.: 144 2022
Gassner, L., Hofer, V.
HTA Austria – Austrian Institute for Health Technology Assessment GmbH, 2022/11
Free full text

683

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/11
Free full text

684

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11

685

Model-Base Estimation of Non-Invasive Ventilation Weaning of Preterm Infants Exposed to Osteopathic Manipulative Treatment: A Propensity-Score-Matched Cohort Study
Tarantino, A. G., Vismara, L., Buffone, F., Bianchi, G., Bergna, A., Vanoni, M., Tabbi, C., Bresesti, I., Agosti, M.
Healthcare, 2022/11
Free full text

686

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text

687

The Benefits of Integrative Medicine in the Management of Chronic Pain: A Review
Trivedi, H., Avrit, T. A., Chan, L., Burchette, M., Rathore, R.
Cureus, 2022/10
Free full text

688

Effect of osteopathic techniques on human resting muscle tone in healthy subjects using myotonometry: a factorial randomized trial
Bohlen, L., Schwarze, J., Richter, J., Gietl, B., Lazarov, C., Kopyakova, A., Brandl, A., Schmidt, T.
Scientific Reports, 2022/10
Free full text

689

Effects of osteopathic manipulative treatment of the pivots on lower limb function in young professional football players
Thomas, E., Petrucci, M., Barretti, M., Messina, G., Cavallaro, A. R., Bianco, A.
Journal of Bodywork and Movement Therapies, 2022/10

690

Osteopathic manipulative treatment use among family medicine residents in a teaching clinic
Caldwell, G., Zeng, L., Kaufman, J., Bates, J.
Journal of Osteopathic Medicine, 2022/10
Free full text

691

Postoperative Osteopathic Manipulative Treatment in Children with Esophageal Atresia: Potential Benefits on the Anthropometric Parameters
Manzotti, A., Alati, A., Galli, M., Cerritelli, F., Leva, C., Alberti, A., Stizzoli, A., Costanzo, S., Canonica, C. P. M., Destro, F., Zuccotti, G., Calcaterra, V., Pelizzo, G.
Pediatric Reports, 2022/10


693

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09





698

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text











709

Case Report on Visceral Manipulation in Adolescent Idiopathic Scoliosis
Chahab, M., Donnet, P., Hernandez, D.
International Journal of Therapeutic Massage and Bodywork, 2022/09



712

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09





717

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text

718

Comparing In-person vs. Live-streamed Osteopathic Manual Medicine Lab Instruction
Ellis, M., Finneran, K., Jie, C., Lewis, D.
The AAO Journal, 2022/09
Free full text

719

Osteopathic Manipulative Treatment for Optic Pathway Glioma
Gordon, S., Hagopian, S.
The AAO Journal, 2022/09
Free full text

720

Treatment of infant colic with craniosacral therapy. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/09
Free full text

721

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text


723

Thoracic outlet syndrome due to first rib subluxation in a 69-year-old woman
Deveze, E., Daligault, M., Ammi, M., Picquet, J.
Annals of Vascular Surgery - Brief Reports and Innovations, 2022/09
Free full text

724

Investigating the safety and feasibility of osteopathic medicine in the pediatric oncology outpatient setting
Belsky, J. A., Stanek, J. R., Rose, M. J.
Journal of Osteopathic Medicine, 2022/08
Free full text

725

Effectiveness of osteopathic interventions in patients with non-specific neck pain: A systematic review and meta-analysis
Dal Farra, F., Buffone, F., Risio, R. G., Tarantino, A. G., Vismara, L., Bergna, A.
Complementary Therapies in Clinical Practice, 2022/08

726

“What you feel under your hands“: exploring professionals' perspective of somatic dysfunction in osteopathic clinical practice-a qualitative study
Arcuri, L., Consorti, G., Tramontano, M., Petracca, M., Esteves, J. E., Lunghi, C.
Chiropractic & Manual Therapies, 2022/08
Free full text

727

Osteopathic Treatment for Gastrointestinal Disorders in Term and Preterm Infants: A Systematic Review and Meta-Analysis
Buffone, F., Monacis, D., Tarantino, A. G., Farra, F., Bergna, A., Agosti, M., Vismara, L.
Healthcare, 2022/08
Free full text

728

The Role of Osteopathic Care in Gynaecology and Obstetrics: An Updated Systematic Review
Ruffini, N., D', Alessandro, G., Pimpinella, A., Galli, M., Galeotti, T., Cerritelli, F., Tramontano, M.
Healthcare, 2022/08
Free full text


730

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text

731

Cranial osteopathic techniques and electroencephalogram (EEG) alpha power: a controlled crossover trial
Cella, M., Acella, E., Aquino, A., Pisa, V.
Journal of Osteopathic Medicine, 2022/08
Free full text


733

Osteopathic Manipulative Treatment and the Management of Headaches: A Scoping Review
Jara Silva, C. E., Joseph, A. M., Khatib, M., Knafo, J., Karas, M., Krupa, K., Rivera, B., Macia, A., Madhu, B., McMillan, M., Burtch, J., Quinonez, J., Albert, T., Khanna, D.
Cureus, 2022/08
Free full text

734

Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine
Sookaromdee, P., Wiwanitkit, V.
Journal of Osteopathic Medicine, 2022/08
Free full text

735

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08

736

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07

737

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text

738

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text

739

Osteopathic Manipulative Treatment for Pediatric Conditions: An Update of Systematic Review and Meta-Analysis
Posadzki, P., Kyaw, B. M., Dziedzic, A., Ernst, E.
Journal of Clinical Medicine, 2022/07
Free full text


741

Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects
Gawrys, S. P., Bradshaw, J. T., Parker, L. M.
Journal of Osteopathic Medicine, 2022/07
Free full text

742

Osteopathic practice in the United Kingdom: A retrospective analysis of practice data
Plunkett, A., Fawkes, C., Carnes, D.
PLoS One, 2022/07
Free full text

743

Successful Osteopathic Manipulative Treatment of Foot Drop
Tafler, L., Katz, V., Kolesnikov, V., Singh, R.
Cureus, 2022/07
Free full text

744

Reduction and Resolution of a Hiatal Hernia Using Osteopathic Manipulative Treatment: A Case Report
Volokitin, M., Song, A., Peck, M. T., Milani, S.
Cureus, 2022/07
Free full text

745

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07

746

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07


748

Effectiveness of osteopathic manipulative treatment for pediatric conditions: A systematic review
Franke, H, Franke, J.D., Fryer, G.
Journal of Bodywork and Movement Therapies, 2022/07




752

Osteopathic Manipulative Treatment for Refractory Gastroesophageal Reflux Disease (GERD)
Yassin, K., Mutter, C., Waters, H., Mehra, R.
The AAO Journal, 2022/06
Free full text


754

The Effect of Osteopathic Manipulative Treatment in Pregnancy on Labor Duration: A Meta-Analysis
Zak, A., Streeter, E., Tran, N., Wales, A., Yep, M., Rowane, M.
The AAO Journal, 2022/06
Free full text







761

Osteopathy and physiotherapy compared to physiotherapy alone on fatigue in long COVID: Study protocol for a pragmatic randomized controlled superiority trial
Certain Curi, A. C., Antunes Ferreira, A. P., Calazans Nogueira, L. A., Mello Meziat Filho, N. A., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2022/06
Free full text



764

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06

765

Osteopathic Evaluation and Positional Plagiocephaly: A Descriptive Study on a Population of Children with ASD
Di Renzo, M., Laurenti, A., Di Castelbianco, F. B., Vanadia, E., Petrillo, M., D’Errico, S., Ferrara, R., Racinaro, L., Rea, M.
American Journal of Pediatrics, 2022/06
Free full text

766

Comparison of the Effect of Osteopathic Manipulations and Exercises on the Myoelectric Activity of the Pelvic Floor: A Randomized Controlled Trial
Arcanjo, G. N., Pires, Jlvr, Jacinto, M. E. M., Colares, J. M., Belo, L. M. C., Lima, P. O. P., Vilaça-Alves, J.
Journal of Chiropractic Medicine, 2022/06

767

Adjunctive osteopathic therapy for hospitalized COVID-19 patients: A feasibility-oriented chart review study with matched controls
Lennon, R. P., Dong, H., Zgierska, A. E., Demetriou, T., Croad, J., Livelsberger, C., Hodge, L., Mendez-Miller, M., Darby, A., Rabago, D.
International Journal of Osteopathic Medicine, 2022/06

768

Tongue stretching: technique and clinical proposal
Buscemi, A., Coco, M., Rapisarda, A., Frazzetto, G., Di Rosa, D., Feo, S., Piluso, M., Presente, L. P., Campisi, S. S., Desirò, P.
Journal of Complementary and Integrative Medicine, 2022/06
Free full text

769

Effect of Physique on Medical Students’ Perceived Physical Ability to Perform Osteopathic Manipulative Treatment (OMT)
Than, S., Santos, L., Lin, X., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text


771

Abnormal Foot Progression Angle Kinematics in Cervical Dystonia Improved After Osteopathic Manipulative Medicine: A Prospective Case Series
Mancini, J., Oliff, Z., Abu-Sbaih, R., Simone, J., LaRosa, A., Mody, S., Li, T. S., Leder, A.
Cureus, 2022/06
Free full text

772

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text

773

A long COVID patient and their experience of osteopathic care: A case report
Monro, M.
International Journal of Osteopathic Medicine, 2022/06






779

Response to Osteopathic Manipulative Treatment in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
Bomani-Bailey, A., Xu, T., Ettlinger, H.
The AAO Journal, 2022/06
Free full text

780

Variations in Average Cranial Rhythmic Impulse Rates
Crider, T., Grimm, J., Kozar, A., Tobey, A. H.
The AAO Journal, 2022/06
Free full text

781

An Osteopathic Approach to Secondary Enuresis and Encopresis: Recovering Autonomic Stability
Goodman, F., Ammons, R., Gebhardt, G., Largent, J.
The AAO Journal, 2022/06
Free full text

782

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

783

SCIWORA: A Pediatric Case
Masterson, C., Byrd, A., Gebhardt, G.
The AAO Journal, 2022/06
Free full text



786

A Randomized Pilot Study Comparing Bilirubin Levels of Newborns Treated with Osteopathic Manipulative Treatment (OMT) Versus Routine Newborn Care Alone
Stephenson, C. M., Fremarek, N., Lentz, A., Klene-Bowns, A., Boeve, M., Brinsky, K., Chatterley, L., Yarling, C., Caldwell, G., Grundwaldt, D.
The AAO Journal, 2022/06
Free full text

787

Osteopathic Manipulative Treatment plus Phototherapy in the Management of Neonatal Hyperbilirubinemia: A Case Report
Zylinski, B. L., Stephenson, C. M., Dean, A. L., Rajala, J. W., Miller, D. J.
The AAO Journal, 2022/06
Free full text


789

The Effects of a Novel Virtual Reality Osteopathic Manipulative Medicine Program on First Year Practical Exam Scores
Ahmed, E., Jose, J., Stout, R., Yao, S. C.
The AAO Journal, 2022/06
Free full text

790

Augmentation of Immune Response to COVID-19 mRNA Vaccination Through Osteopathic Manipulative Treatment
Ahn, B., Martinez, E., Hadiprodjo, H., Jackson, C., Gutierrez, M., Crone, P., Loveless, B., Fuchs, S., Szurmant, H., Sanchez, J.
The AAO Journal, 2022/06
Free full text

791

Utilizing Osteopathic Manipulative Techniques to Mitigate Fall Risk Among Hospitalized Elderly Patients: A Literature Review
Arshad, U., Baum, B., Carter, R., Gustowski, S.
The AAO Journal, 2022/06
Free full text

792

Upper Cross Syndrome and a Guarded Heart: Posture in a Case of Depression
Benzell, J. A., Abend, D., Bailey, J., Cooley, D., King Channell, M.
The AAO Journal, 2022/06
Free full text

793

Osteopathic Manipulative Treatment of Individual with Intractable Singultus
Bloch, R., Kempa, M., Lippert, J.
The AAO Journal, 2022/06
Free full text

794

SOAP Note Review: Evaluating Osteopathic Principles and Practice in Clinical Education
Budny, B., Gigliotti, D., Diggs, B., Fotopoulos, T., Johns, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text

795

An Osteopathic Approach to Chronic Pelvic Pain
Cameron, D. L., Mainville, M., Wallace-Ross, J.
The AAO Journal, 2022/06
Free full text

796

Effects of Osteopathic Manipulative Treatment (OMT) on Anosmia and Ageusia in Post-COVID-19 Patient: A Case Report
Companion, N., Ventimiglia, M., Yao, S. C.
The AAO Journal, 2022/06
Free full text


798

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

799

Relief of Post-COVD-19 Burning Mouth Syndrome (BMS) with OMM- A case study
Frankini, E. L., Leder, A., Yao, S. C.
The AAO Journal, 2022/06
Free full text

800

Body-Mind-Spirit Connection as an Approach to Treatment of Spasmodic Torticollis
Haley, L., Clark, M., Litman, R., Heller, G.
The AAO Journal, 2022/06
Free full text

801

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text

802

Osteopathic Manipulative Treatment may be a Cost-Effective Approach to Reducing Pain Associated with Acute Flare of Interstitial Cystitis
Hermann, S. J., Barnett, M. E., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text

803

Effects of Osteopathic Manipulative Therapy on Temporomandibular Joint Disorders
Honeyman, J., Robke, B., Reed, G., Jacob, L., O'Donnell, M., Lynch, W. D., Moore, W.
The AAO Journal, 2022/06
Free full text

804

Out of Place: An Osteopathic Approach to Recurrent Shoulder Dislocations in an Ehlers Danlos Patient
Lambros, S., Tuyn, D., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text

805

Effect of Medical School Experiences on Perceived Likelihood of Performing Osteopathic Manipulative Treatment (OMT) in Future Practice
Lin, X., Santos, L., Than, S., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text

806

Managing Muscle Rigidity: An Osteopathic Approach to the Treatment of Stiff Person Syndrome
Mainville, M., Cameron, D. L., Barry, P.
The AAO Journal, 2022/06
Free full text

807

Osteopathic Manipulative Treatment of the Deep Fascia for the Treatment of Chronic Trauma-induced Somatic Dysfunction
Nelson, C., Henderson, J., Kim, C., Le, B., Mintier, K.
The AAO Journal, 2022/06
Free full text


809

An Osteopathic Approach to Childhood Scoliosis and Leg Length Inequality in a Pediatric Patient with Chiari I Malformation
Schultz, R., Baig, Y., Henderson, K. K., Heinking, K. P.
The AAO Journal, 2022/06
Free full text

810

Establishing OMT as a Key Treatment Modality in Injury Rehabilitation: Teres Major Tear
Shah, N., Cortes, M., Posey, A.
The AAO Journal, 2022/06
Free full text

811

Osteopathic Manipulative Therapy Effects on Prolonged Post-COVID Olfactory Dysfunction
Stenta, M. E., Bacon, C., Haile, Z. T., Walkowski, S. A.
The AAO Journal, 2022/06
Free full text

812

Novel Lymphatic Counterstrain (LC) in a Case of Low Ankle Sprain
Trinh, D., Henderson, J., Goering, E.
The AAO Journal, 2022/06
Free full text

813

Uncovering Trigger Points Masked by Lumbar Radiculopathy
Tuyn, D., Lambros, S., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text

814

“Skateboard to the Head” A Case of Persistent Headaches Following Blunt Eye Trauma
Williams, D., Richie, C.
The AAO Journal, 2022/06
Free full text

815

Restricted Shoulder Range of Motion: A Neglected Component That May Surprise You
Williams, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text

816

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text

817

Complementary medicine visits by palliative care patients: a cross-sectional survey
Steel, Amie, Schloss, Janet, Diezel, Helene, Palmgren, Per J., Maret, Jean Baptiste, Filbet, Marilène
BMJ Supportive and Palliative Care, 2022/05

818

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text

819

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text


821

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text

822

Effect of osteopathic manipulation of the sacroiliac joint vs electrotherapy on pain and functional disability in patients with low back pain: A pilot study
Rodríguez-Pastor, J. A., Caro-Puértolas, B., Caña-Pino, A., Sánchez-Preciado, A. M., Garrido-Ardila, E. M., Apolo-Arenas, M. D.
Journal of Back and Musculoskeletal Rehabilitation, 2022/05

823

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05

824

Association of sleep quality and chronification of musculoskeletal pain in an older adult: A case report
Westendorp, R., Thaker, V., Srbely, J.
International Journal of Osteopathic Medicine, 2022/05

825

Effects of osteopathic manipulative treatment vs. osteopathic cranial manipulative medicine on Parkinsonian gait
Terrell, Z. T., Moudy, S. C., Hensel, K. L., Patterson, R. M.
Journal of Osteopathic Medicine, 2022/05
Free full text


827

An updated brief overview on post-traumatic headache and a systematic review of the non-pharmacological interventions for its management
Argyriou, A. A., Mitsikostas, D. D., Mantovani, E., Litsardopoulos, P., Panagiotopoulos, V., Tamburin, S.
Expert Review of Neurotherapeutics, 2022/04
Free full text

828

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text

829

Incidence Rate of Somatic Dysfunction in Previously Undiagnosed Spotted Fever Rickettsiosis: A Case Report
Unger, M. D., Palmer, J. L., Thorsvik, N. M.
Cureus, 2022/04
Free full text

830

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text



833

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text

834

Comparative assessment of osteopathy technique with manual therapy associated with biofeedback in patients with the lumbar spine pain.
Mańko, G., Jekiełek, M., Sosulska, A., Pieniążek, M., Jaszczur-Nowicki, J.
Medical Rehabilitation, 2022/04
Free full text


836

Retention of tissue texture change after cervical muscle energy and high velocity low amplitude intervention: implications for treatment intervals
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2022/04
Free full text

837

A Review of Glymphatics and the Impact of Osteopathic Manipulative Treatment in Alzheimer's Disease, Concussions, and Beyond
Marino, M. A., Petrova, S., Sweiss, R., Duong, J., Miulli, D. E.
Cureus, 2022/03
Free full text


839

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text








847

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text

848

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text

849

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

850

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text

851

Patellofemoral pain syndrome: a review of the literature with osteopathic emphasis
Balint, T., Jones, J., Paquette, M., Amalfitano, J.
The AAO Journal, 2022/03
Free full text


853

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text

854

Efficacy and Feasibility of an Osteopathic Intervention for Neurocognitive and Behavioral Symptoms Usually Associated With Fetal Alcohol Spectrum Disorder
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., García-Algar, Ó.
Frontiers in Behavioral Neuroscience, 2022/03
Free full text


856

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

857

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

858

In bestimmter Weise auf jemanden wirken …
(To affect someone in a certain way...)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03




862

Efeitos da abordagem osteopática em neonatos com dificuldade na biomecânica da amamentação: ensaio clínico randomizado
(Effects of the osteopathic approach in neonates with difficulties in the biomechanics of breastfeeding: a randomized clinical trial)
Barros, R. C. T., Vilagra, J. M., Taglietti, M., Tori, F.S., Cagnini, T. L., Camilo, J.M., Grando, F., Abico, R. M., Abico, S. T.
Research, Society and Development, 2022/03
Free full text

863

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03



866

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02


868

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text

869

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text

870

Advances in the therapeutic approach of pudendal neuralgia: a systematic review
Murer, S., Polidori, G., Beaumont, F., Bogard, F., Polidori, E., Kinne, M.
Journal of Osteopathic Medicine, 2022/01
Free full text

871

The rationale for including osteopathic manipulative treatment in the management of infections: a hermeneutic review
Lesho, E., McKeown, A., Laguio-Vila, M.
Expert Review of Anti-Infective Therapy, 2022/01
Free full text

872

International Overview of Somatic Dysfunction Assessment and Treatment in Osteopathic Research: A Scoping Review
Tramontano, M., Tamburella, F., Farra, F., Bergna, A., Lunghi, C., Innocenti, M., Cavera, F., Savini, F., Manzo, V., D', Alessandro, G.
Healthcare, 2022/01
Free full text

873

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text

874

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text



877

Neurogenic Bowel Dysfunction Changes after Osteopathic Care in Individuals with Spinal Cord Injuries: A Preliminary Randomized Controlled Trial
Tamburella, F., Princi, A. A., Piermaria, J., Lorusso, M., Scivoletto, G., Masciullo, M., Cardilli, G., Argentieri, P., Tramontano, M.
Healthcare, 2022/01
Free full text

878

The immediate effect of thoracolumbar manipulation and diaphragmatic release on inspiratory muscle strength in healthy smokers: A randomized clinical trial
Albarrati, A., Taher, M., Nazer, R., Alshameri, T.
Journal of Back and Musculoskeletal Rehabilitation, 2022/01

879

Relationship between osteopathic manipulative treatment of the temporomandibular joint, molar shim and the orthostatic position: A randomized, controlled and double blinded study
Detoni, R., Heartz, C. S., Fusatto, E. L., Bicalho, E., Nacimento-Moraes, K. S. G., Rizzatti-Barbosa, C. M., Lopes, F. O. T.
Journal of Bodywork and Movement Therapies, 2022/01
Free full text

880

Osteopathic treatment in addition to standard care in patients with Gastroesophageal Reflux Disease (GERD) – A pragmatic randomized controlled trial
Lynen, A., Schömitz, M., Vahle, M., Jäkel, A., Rütz, M., Schwerla, F.
Journal of Bodywork and Movement Therapies, 2022/01

881

Lymphatic osteopathic manipulative treatment reduces duration of deltoid soreness after Pfizer/BioNTech COVID-19 vaccine
Marshall, S., Winter, S., Capobianco, J. D.
Journal of Osteopathic Medicine, 2022/01
Free full text


883


884

The Effect of Pedal Pump Lymphatic Technique Versus Passive Recovery Following Maximal Exercise: A Randomized Cross-Over Trial
DiFrancisco-Donoghue, J., Chan, T., Jensen, A. S., Docherty, J. E. B., Grohman, R., Yao, S. C.
Sports Medicine - Open, 2022/01
Free full text


886

Results of a feasibility randomised controlled trial of osteopathy on neck-shoulder pain in computer users
Santiago, R. J., Esteves, J. E., Baptista, J. S., Magalhães, A., Costa, J. T.
Complementary Therapies in Clinical Practice, 2022/01
Free full text



889

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12

890

Osteopathic Manipulation of the Sphenopalatine Ganglia Versus Sham Manipulation, in Obstructive Sleep Apnoea Syndrom: A Randomised Controlled Trial
Attali, V., Jacq, O., Martin, K., Arnulf, I., Similowski, T.
Journal of Clinical Medicine, 2021/12
Free full text






896

The immediate effect of harmonic therapy on peripheral blood flow in young males: A cross-over pilot study
Alsayani, K. Y. A., Aslan, U. B., Büker, N., Şavkın, R., Yağcı, A. B.
International Journal of Osteopathic Medicine, 2021/12


898

Use of muscle energy technique amongst a nationally representative sample of Australian osteopaths
Fryer, G., Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2021/12

899

Epidemiology, common diagnoses, treatments and prognosis of shoulder pain: A narrative review
Hodgetts, C., Walker, B.
International Journal of Osteopathic Medicine, 2021/12

900

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: Protocol for systematic review and meta-analysis
Rehman, Y., Kirsch, J., Bhatia, S., Johnston, R., Bingham, J., Senger, B., Swogger, S., Snider, K. T.
International Journal of Osteopathic Medicine, 2021/12

901


902

OMM alters chronic ethanolinduced changes to VTA GABA neurons, NAc DA release and measures of withdrawal in rats
Bills, K., Small, C., Otteson, D., Jones, G., Steffensen, S.
Journal of Osteopathic Medicine, 2021/12

903

Serum osteocalcin in the osteopathic treatment for motor function in Parkinson’s Disease
Gupta, S., Lamba, S., Yao, S. C., Mancini, J.
Journal of Osteopathic Medicine, 2021/12

904

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

905

Understanding medical student perspectives in virtual osteopathic manipulative medicine education during the COVID pandemic
Liu, T., Torrents, M., Sharma, S., Burke, D., Giovanis, A.
Journal of Osteopathic Medicine, 2021/12

906

Assessing usage and perceptions of osteopathic manipulative treatment (OMT) and self-identity among osteopathic physicians
Mangla, M., Asif, S., Asif, S., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

907

A Pilot Study to Examine Medical Students’ Perception of their Osteopathic Manipulative Therapy Education
Mazzi, J., Leavitt, N., Kisby, G.
Journal of Osteopathic Medicine, 2021/12

908

Patient Perception of Clinical Trials With and Without Osteopathic Manipulative Treatment During the COVID-19 Pandemic
Nikakis, J., Singh Arora, U., Wang, L., Abramowitz, C., Malkov, D., Cohen, T. J.
Journal of Osteopathic Medicine, 2021/12


910

Correction: Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/12
Free full text

911

An Osteopathic Approach to Complex Regional Pain Syndrome (CRPS)
Deol, N., Nuño, V., Schuman, M., Contreras, C.
The AAO Journal, 2021/12
Free full text

912

A comparative study of the effectiveness of an osteopathic primary care sports medicine led intervention on performance in men's collegiate lacrosse players
Rao, N. C., Zwibel, H., Berezanskaya, J., Pena, P., Jung, M. K.
Journal of Osteopathic Medicine, 2021/11
Free full text

913

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text

914

Effect of joint manipulation and muscle energy technique in patients with Chronic Obstructive Pulmonary Disease: A review
Bains, D., Goyal, M., Chahal, A., Shaphe, M. A.
Annals of Clinical and Analytical Medicine, 2021/11
Free full text

915

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11

916

Fast improvements in functional status after osteopathic manipulative treatment based on myofascial release in patients with moderate or severe fibromyalgia: a retrospective study
Farra, F., Chiesa, A., Risio, R. G., Vismara, L., Bergna, A.
Journal of Complementary and Integrative Medicine, 2021/11
Free full text

917

Effect of osteopathic manipulation on gait asymmetry
Hill, C. N., Romero, M., Rogers, M., Queen, R. M., Brolinson, P. G.
Journal of Osteopathic Medicine, 2021/11
Free full text



920

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11

921

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11


923

Response to Alvarez et al
Coste, J., Medkour, T., Maigne, J. Y., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/11
Free full text

924

The ACAMTO study—impact of add-on osteopathic treatment on adolescent patients with anorexia nervosa: study protocol for a randomized controlled trial
Letranchant, A., Montebello, Y., Dugré-Le bigre, C., Wagner, A., Curt, F., Silva, J., Nicolas, I., Votadoro, P., Kalindjian, N., Korchonnoff, A., Gutierre, A., Novelli, Ana B., Pham-Scottez, A., Corcos, M.
Trials, 2021/11
Free full text





929

Effectiveness of myofascial release on pain, sleep, and quality of life in patients with fibromyalgia syndrome: A systematic review
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P.
Complementary Therapies in Clinical Practice, 2021/11


931

Most common infant health concerns in osteopathic practices in Germany. A survey
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2021/10

932

Spinal Manipulative Therapy for Acute Neck Pain: A Systematic Review and Meta-Analysis of Randomised Controlled Trials
Chaibi, A., Stavem, K., Russell, M. B.
Journal of Clinical Medicine, 2021/10
Free full text




936

Effects of osteopathic approach in infants with deformational plagiocephaly: an outcome research study
Gasperini, M., Vanacore, N., Massimi, L., Consolo, S., Haass, C., Scapillati, M. E., Petracca, M.
Minerva Pediatrics, 2021/10

937

Stimulating the Use of OMT in Primary Care Offices Via Point-of-Care Reminders
Agcopra, A., Collins, P., Jha, S., Mancuso, A.
Osteopathic Family Physician, 2021/10

938

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10


940

Osteopathy in Germany: attitudes, beliefs and handling among general practitioners - results of a nationwide cross-sectional questionnaire survey
Schmid, G. L., Kluge, J., Deutsch, T., Geier, A. K., Bleckwenn, M., Unverzagt, S., Frese, T.
BMC Family Practice, 2021/10
Free full text

941

Osteopathic Treatment and Evaluation in the Clinical Setting of Childhood Hematological Malignancies
Barbieri, M., Zardo, W., Frittoli, C., Rivolta, C., Valdata, V., Bouquin, F., Passignani, G., Maggiani, A., Jankovic, M., Cossio, A., Biondi, A., Balduzzi, A., Lanfranconi, F.
Cancers, 2021/10
Free full text

942

Osteopathic Treatment of Infants in Their First Year of Life: A Prospective Multicenter Observational Study (OSTINF Study)
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Complementary Medicine Research, 2021/10
Free full text


944

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09



947

Efficacy of osteopathic manipulative treatment in patients with Parkinson's disease: a narrative review
Li, R., Jose, A., Poon, J., Zou, C., Istafanos, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/09
Free full text

948

Exploring the Utility of Motion Analysis in Osteopathic Clinical Trials; a School-Based Pilot Study on Jaw and Cervical Range of Motion
Bagory, T., Vaucher, P., Mhadhbi, H., Ménard, M.
International Journal of Osteopathic Medicine, 2021/09

949

Osteopathic Cranial Manipulation for a Patient With Whiplash-Associated Disorder: A Case Report
Parravicini, G., Ghiringhelli, M.
Journal of Chiropractic Medicine, 2021/09


951

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09

952

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09


954

Effects of Osteopathic Manipulation and Other Manual Manipulative Treatments on Cystic Fibrosis
Ball, K. T., Kraft, D. E., Snider, K. T.
The AAO Journal, 2021/09
Free full text


956

Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/09
Free full text

957

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study
Miranda, E., Giza, J., Feketeova, E., Castro-Nunez, C., Vieux, U., Huynh, M.D.
The AAO Journal, 2021/09
Free full text



960

A Systematic Review of Musculoskeletal Mobilization and Manipulation Techniques Used in Veterinary Medicine
Haussler, K. K., Hesbach, A. L., Romano, L., Goff, L., Bergh, A.
Animals, 2021/09
Free full text



963

Osteopathic Manipulative Treatment for Chronic Low Back Pain
Licciardone, J. C.
JAMA Internal Medicine, 2021/08

964

Osteopathic Manipulative Treatment for Chronic Low Back Pain—Reply
Nguyen, C., Zegarra-Parodi, R, Boutron, I.
JAMA Internal Medicine, 2021/08

965

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08

966

Osteopathic interventions via telehealth in a pediatric population: a retrospective case series
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2021/08
Free full text


968

Vertigo and Balance Disorders-The Role of Osteopathic Manipulative Treatment: A Systematic Review
Tramontano, Marco, Consorti, Giacomo, Morone, Giovanni, Lunghi, Christian
Complementary Medicine Research, 2021/08

969

The Lymphatic System: An Osteopathic Review
Hruby, R. J., Martinez, E. S.
Cureus, 2021/07
Free full text


971

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07

972

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07


974

Effects of myofascial release or self-myofascial release and control position exercises on lower back pain in idiopathic scoliosis: A systematic review
López-Torres, O., Mon-López, D., Gomis-Marzá, C., Lorenzo, J., Guadalupe-Grau, A.
Journal of Bodywork and Movement Therapies, 2021/07

975

Secondary dysmenorrhea and dyspareunia associated with pelvic girdle dysfunction: A case report and review of literature
Origo, D., Piloni, S., Tarantino, A. G.
Journal of Bodywork and Movement Therapies, 2021/07

976

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text



979

Knowledge of osteopathic manipulative medicine and osteopathic physicians in a New York South Asian community
Lee, J., Maung, C., Espares, J., Chen, J., Yip, F., Lin, W., Zhao, L., Li, T. S.
Journal of Osteopathic Medicine, 2021/07
Free full text





984

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07


986

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text

987

Osteopathic empirical research: a bibliometric analysis from 1966 to 2018
Morin, C., Gaboury, I.
BMC Complementary Medicine and Therapies, 2021/07
Free full text


989

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06



992

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text

993

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text

994

Crochet the Pain Away: A Case Study of Osteopathic Manipulation for Cervical Rib Induced Thoracic Outlet Syndrome
Herring, J. A., Soto, G. N., Silver, S.
The AAO Journal, 2021/06
Free full text


996

‘Don’t focus on the finger, look at the moon’ - The importance of contextual factors for clinical practice and research
Thomson, O. P., Rossettini, G.
International Journal of Osteopathic Medicine, 2021/06

997

Craniosacral Therapy Use in Normal Pressure Hydrocephalus
Park, Y., Kabariti, J., Tafler, L.
Cureus, 2021/05
Free full text

998

Osteopathic Manipulative Treatment of Herpes Zoster Ophthalmicus/Postherpetic Neuralgia
Volokitin, M., Izadi, N., Myers, R., Kane Diaw, N., Milani, S.
Cureus, 2021/05
Free full text

999

The importance of epistemological consideration in the reporting of evidence for osteopathic care in Covid-19 papers
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/05
Free full text

1000

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05

1001

The importance of rigour in the reporting of evidence for osteopathic care in Covid-19 papers
Draper-Rodi, J., Vaucher, P., Thomson, O. P.
Explore (NY), 2021/05
Free full text

1002

Effect of Osteopathic Manipulative Treatment vs Sham Treatment on Activity Limitations in Patients With Nonspecific Subacute and Chronic Low Back Pain: A Randomized Clinical Trial
Nguyen, C., Boutron, I., Zegarra-Parodi, R., Baron, G., Alami, S., Sanchez, K., Daste, C., Boisson, M., Fabre, L., Krief, P., Krief, G., Lefèvre-Colau, M.M., Rannou, F.
JAMA Internal Medicine, 2021/05

1003

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

1004

The usage of multidisciplinary physical therapies at the Rio de Janeiro 2016 Olympic Summer Games: an observational study
Grant, M. E., Steffen, K., Palmer, D.
Brazilian Journal of Physical Therapy, 2021/05
Free full text

1005

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05

1006

Obstructed defecation syndrome associated with paradoxical puborectalis contraction: osteopathic treatment versus anal biofeedback. Results of a pilot study
Ascanelli, S., Portinari, M., Canella, M., Solari, S., Dall&rsquo, Omo, F., Danese, S., De Troia, A., Carcoforo, P.
Techniques in Coloproctology, 2021/05



1009

Direct and mediated effects of treatment context on low back pain outcome: a prospective cohort study
Bishop, F., Al-Abbadey, M., Roberts, L., MacPherson, H., Stuart, B., Carnes, D., Fawkes, C., Yardley, L., Bradbury, K.
BMJ Open, 2021/05
Free full text



1012

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text


1014

Effects of Osteopathic T9-T10 Vertebral Manipulation in Tonsillitis: A Randomized Clinical Trial
Luceño-Mardones, A., Luceño-Rodríguez, I., Rodríguez-López, E. S., Oliva-Pascual-Vaca, J., Rosety, I., Oliva-Pascual-Vaca, Á
Healthcare, 2021/04
Free full text

1015

Osteopathic manual therapy in heart failure patients: A randomized clinical trial
Thomaz, S. R., Teixeira, F. A., de Lima, Acgb, Cipriano Junior, G., Formiga, M. F., Cahalin, L. P.
Journal of Bodywork and Movement Therapies, 2021/04

1016

Assessment of Studies Evaluating Spinal Manipulative Therapy and Infectious Disease and Immune System Outcomes: A Systematic Review
Chow, N., Hogg-Johnson, S., Mior, S., Cancelliere, C., Injeyan, S., Teodorczyk-Injeyan, J., Cassidy, J. D., Taylor-Vaisey, A., Cote, P.
JAMA Network Open, 2021/04
Free full text


1018

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text


1020

Osteopathic manipulative medicine in the management of headaches associated with postconcussion syndrome
Esterov, D., Thomas, A., Weiss, K.
Journal of Osteopathic Medicine, 2021/04
Free full text









1029

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text

1030

A Closer Look into the Association between the Sacroiliac Joint and Low Back Pain
Wieczorek, A., Campau, E., Pionk, E., Gabriel-Champine, M. E., Rios-Bedoya, C. F.
Spartan Medical Research Journal, 2021/04
Free full text

1031

Osteopathic medicine for fibromyalgia: a sham-controlled randomized clinical trial
Coste, J., Medkour, T., Maigne, J., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/04
Free full text




1035

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text

1036

Osteopathic manipulative treatment to improve exclusive breast feeding at 1 month
Danielo Jouhier, M., Boscher, C., Roze, J. C., Cailleau, N., Chaligne, F., Legrand, A., Flamant, C., Muller, J. B.
Archives of Disease in Childhood. Fetal and Neonatal Edition, 2021/04

1037

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text

1038

Osteopathic Manipulative Treatment to Optimize the Glymphatic Environment in Severe Traumatic Brain Injury Measured With Optic Nerve Sheath Diameter, Intracranial Pressure Monitoring, and Neurological Pupil Index
Kashyap, S., Brazdzionis, J., Savla, P., Berry, J. A., Farr, S., Patchana, T., Majeed, G., Ghanchi, H., Bowen, I., Wacker, M. R., Miulli, D. E.
Cureus, 2021/03
Free full text



1041

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03

1042

Osteopathische Behandlung bei Vulvodynie
(Osteopathic treatment for vulvodynia)
Morgentau, M. J., Reinartz, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03


1044

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03

1045

Osteopathic model of the development and prevention of occupational musculoskeletal disorders
Price, J. W.
Journal of Osteopathic Medicine, 2021/03
Free full text

1046

Patient expectations of manual and non-manual therapy within an osteopathic consultation: A cross sectional study
Tripodi, N., Garrett, A., Savic, D., Sadrani, K., Robertson, L., Volarich, S., Sirgiovanni, T.
International Journal of Osteopathic Medicine, 2021/03

1047

Effects of osteopathic manipulative treatment and bio-electromagnetic energy regulation therapy on lower back pain
Auger, K., Shedlock, G., Coutinho, K., Myers, N. E., Lorenzo, S.
Journal of Osteopathic Medicine, 2021/03
Free full text

1048

Support for osteopathic manipulative treatment inclusion in chronic pain management guidelines: a narrative review
Franzetti, M., Dries, E., Stevens, B., Berkowitz, L., Yao, S. C.
Journal of Osteopathic Medicine, 2021/03
Free full text

1049

Teaching and use of cervical high-velocity, low-amplitude manipulation at colleges of osteopathic medicine
Hu, A., Motyka, T., Gish, E., Dogbey, G.
Journal of Osteopathic Medicine, 2021/03
Free full text

1050

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03

1051

Manual treatment for kidney mobility and symptoms in women with nonspecific low back pain and urinary infections
Lo Basso, F., Pilzer, A., Ferrero, G., Fiz, F., Fabbro, E., Oliva, D., Cazzarolli, C., Turrina, A.
Journal of Osteopathic Medicine, 2021/03
Free full text

1052

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03


1054

Impact of different types of revision materials on the learning of musculoskeletal techniques
Launay, F., Ménard, M., Bourgin, M., Mhadhbi, H., Sutre, F., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2021/03


1056

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text



1059

Complementary and alternative medicine use by pediatric oncology patients before, during, and after treatment
Lüthi, E., Diezi, M., Danon, N., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
BMC Complementary Medicine and Therapies, 2021/03


1061

An Osteopathic Approach to Neck Pain
Zona, J. C., Cranor, M.
American Family Physician, 2021/03

1062

A splenic cyst causing a viscerosomatic reflex in the thoracic spine. A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2021/03

1063

Osteopathic manipulative treatment and the Spanish flu: a historical literature review
Baroni, F., Mancini, D., Tuscano, S. C., Scarlata, S., Lunghi, C., Cerritelli, F., Haxton, J.
Journal of Osteopathic Medicine, 2021/02
Free full text

1064

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text

1065

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text

1066

Characteristics and treatment of geriatric patients in an osteopathic neuromusculoskeletal medicine clinic
King, A. A., Cox, J., Bhatia, S., Snider, K. T.
Journal of Osteopathic Medicine, 2021/02
Free full text


1068

Effect of occipitoatlantal decompression on cerebral blood flow dynamics as evaluated by Doppler ultrasonography
Roberts, B., Makar, A. E., Canaan, R., Pazdernik, V., Kondrashova, T.
Journal of Osteopathic Medicine, 2021/02
Free full text


1070

Supportive care and osteopathic medicine in pediatric oncology: perspectives of current oncology clinicians, caregivers, and patients
Belsky, J. A., Stanek, J., Skeens, M. A., Gerhardt, C. A., Rose, M. J.
Supportive Care in Cancer, 2021/02
Free full text



1073

Pediatric Osteopathic Manipulative Medicine: A Scoping Review
DeMarsh, S., Huntzinger, A., Gehred, A., Stanek, J. R., Kemper, K. J., Belsky, J. A.
Pediatrics, 2021/02

1074

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text

1075

The role of touch in osteopathic practice: A narrative review and integrative hypothesis
Baroni, F., Ruffini, N., D'Alessandro, G., Consorti, G., Lunghi, C.
Complementary Therapies in Clinical Practice, 2021/02




1079

Osteopathische Behandlung bei Plagiozephalie
(Osteopathic treatment of plagiocephaly)
Kenner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01

1080

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01

1081

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01

1082


1083

Gut Microbiome Changes with Osteopathic Treatment of Constipation in Parkinson's Disease: A Pilot Study
Mancini, J. D., Yao, S., Martinez, L. R., Shakil, H., Li, T. S.
Neurology (ECronicon), 2021/01
Free full text

1084

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01

1085

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01

1086

Pilot study assessing the effect of osteopathic manipulative treatment (OMT) on length of stay in neonates after therapeutic hypothermia
Bendixen, K., Beinlich, A., Beck, B., Hashmi, N., Craig, A.
Journal of Osteopathic Medicine, 2021/01

1087

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text

1088

Osteopathic manipulative treatment (OMT) use among osteopathic physicians in the United States
Healy, C. J., Brockway, M. D., Wilde, B. B.
Journal of Osteopathic Medicine, 2021/01
Free full text

1089

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text


1091

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text

1092

Effectiveness of osteopathic interventions in chronic non-specific low back pain: A systematic review and meta-analysis
Dal Farra, F., Risio, R. G., Vismara, L., Bergna, A.
Complementary Therapies in Medicine, 2021/01
Free full text

1093

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text

1094

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text

1095


1096

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text

1097

The Effect of Osteopathic Manipulative Treatment (OMT) on Proprioception in Adults: A Pilot Study
Hoevemeyer, K., Teng, K. Y., Mehner, T., McMunn, R., Figueroa, J., Jie, C.
The AAO Journal, 2020/12
Free full text



1100

Characteristics and Management of Pregnant Patients From a Neuromusculoskeletal Medicine/Osteopathic Manipulative Medicine Clinic
Frank, L. D., Bhatia, S., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/12
Free full text

1101

Osteopathic Approach to the Treatment of a Patient With Idiopathic Iliohypogastric Neuralgia
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

1102

CRI over MRI: A Cranial Approach to Dizziness
Qureshi, Y., Patel, U., Mercer, A.
The AAO Journal, 2020/12
Free full text


1104

The Use of Osteopathic Manipulative Medicine in the Management of Recurrent Mastitis
Jackson, C., Loveless, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

1105

Crying Unsettled and disTressed Infants Effectiveness Study of osteopathic care (CUTIES trial): Pragmatic randomised superiority trial protocol
Carnes, D., Bright, P., Brownhill, K., Carroll, K., Engel, R., Grace, S., Vogel, S., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/12


1107

Brain Connectivity Changes after Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tramontano, M., Cerritelli, F., Piras, F., Spanò, B., Tamburella, F., Piras, F., Caltagirone, C., Gili, T.
Brain Sciences, 2020/12
Free full text





1112

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12

1113

The effect of osteopathic medicine on pain in musicians with nonspecific chronic neck pain: a randomized controlled trial
Rotter, G., Fernholz, I., Binting, S., Keller, T., Roll, S., Kass, B., Reinhold, T., Willich, S. N., Schmidt, A., Brinkhaus, B.
Therapeutic Advances in Musculoskeletal Disease, 2020/12
Free full text

1114

The Effect of Osteopathic Manipulative Treatment on Stiff Person Syndrome
Bazzi, M. O., Vemuri, A., Downing, M. A., Barry, P. E.
The Journal of the American Osteopathic Association, 2020/12

1115

The Use of Osteopathic Manipulation to Facilitate Bone Remodeling in a Postmenopausal Osteoporotic Woman
Grabie, Y., Jamil, N., Habib, N., Simone, J. J.
The Journal of the American Osteopathic Association, 2020/12

1116

The Effects of Osteopathic Manipulative Treatment on HbA1c in Type 2 Diabetes and Pre-diabetes: A Randomized-Control Clinical Trial
Sureshbabu, S., Sheflin, K., Li, T. S., Heller, M., Yusupov, E., Krishnamachari, B., Allera, A., Rivera-Martinez, S.
The Journal of the American Osteopathic Association, 2020/12





1121

The Effect of Osteopathic Manipulative Treatment on Lower Limb Muscle Rigidity in a Parkinson's Patient
Vemuri, A., Xu, E., Downing, M., Widboom, N.
Southern Medical Journal, 2020/12




1125

An Osteopathic Modular Approach to Asthma: A Narrative Review
Schend, J., Rowane, M., Sanan, N., Hostoffer, S. R.
The Journal of the American Osteopathic Association, 2020/11
Free full text

1126

The clinical management of neck pain of novice and experienced Australian osteopaths: a secondary analysis of a nationally representative sample
Fleischmann, M., McLaughlin, P., Hayes, A., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2020/11

1127

Ultrasonography to Assess the Efficacy of Osteopathic Manipulative Treatment for Lumbar Spine Asymmetry
Winter, J., Kimber, A., Montenegro, S., Gao, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text



1130

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text

1131


1132

Osteopathic Approach to Treatment of Carpal Dysfunction: The Carpal Mobilization Technique
Mehner, T. R., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/11
Free full text




1136

Osteopathic Manipulative Treatment in Individuals With Vertigo and Somatic Dysfunction: A Randomized, Controlled, Comparative Feasibility Study
Fraix, M., Badran, S., Graham, V., Redman-Bentley, D., Hurwitz, E. L., Quan, V. L., Yim, M., Hudson-McKinney, M., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text

1137

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text

1138

Cranial osteopathic treatment and stress-related effects on autonomic nervous system measured by salivary markers: A pilot study
Abenavoli, A., Badi, F., Barbieri, M., Bianchi, M., Biglione, G., Dealessi, C., Grandini, M., Lavazza, C., Mapelli, L., Milano, V., Monti, L., Seppia, S., Tresoldi, M., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2020/10

1139

Cerebral tissue oxygenation during cranial osteopathic CV4 procedure in newborns
Malak, R., Kozłowska, Z., Owsiańska, Z., Sikorska, D., Andrusiewicz, M., Szymankiewicz-Bręborowicz, M., Samborski, W., Szczapa, T.
Advances in Clinical and Experimental Medicine, 2020/10
Free full text



1142

A Pilot Study of Jugular Compression (Queckenstedt maneuver) for Cranial Movement Perception
Abenavoli, A., Pisa, S., Maggiani, A.
The Journal of the American Osteopathic Association, 2020/10

1143

The Role of Musculoskeletal Disorders in Chronic Disease: A Narrative Review
Asahi, M. G., Briganti, D., Cam, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text

1144

Osteopathic Manipulative Treatments for Pediatric Conditions
Raines, S. G. M., Ramey, A. L.
Osteopathic Family Physician, 2020/10
Free full text

1145

A Case of Resolved Vincristine-Induced Constipation Following Osteopathic Medicine in a Patient With Infantile Fibrosarcoma
Belsky, J. A., Wolf, K., Setty, B. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text

1146

Osteopathic Manipulative Treatment for a Recognizable Pattern of Somatic Dysfunction Following Laparoscopic Cholecystectomy
Mills, M., Sevensma, K., Serrano, J.
The Journal of the American Osteopathic Association, 2020/10
Free full text

1147

La fascia desde la medicina osteopática
(Fascia from the perspective of osteopathic medicine)
Stambulie Padilla, E. A.
Unpublished MSc thesis, 2020/10
Free full text

1148

Treating Complex Regional Pain Syndrome Using Counterstrain: A Novel Approach
Schranz, K., Meitz, D., Powers, B., Ables, A.
Cureus, 2020/10
Free full text

1149



1151

Osteopathie bei epileptischen Anfällen
(Osteopathy for epileptic disorder)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10


1153

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text

1154

The Immediate, Intermediate, and Long-Term Effects of Osteopathic Manipulative Treatment on Pulmonary Function in Adults with Asthma
Kasten, K. M., Tyler, S. K., Johnson, A. R., Kolakowski, E. R., Pickos, J., Heineman, K., Jie, C.
The AAO Journal, 2020/09
Free full text


1156

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09

1157

Severe Viscerosomatic Neck Pain from Refractory Gastroesophageal Reflux
Uhrig, J., Rettos, J.
The AAO Journal, 2020/09
Free full text

1158

What Makes an Osteopathic Treatment Effective From a Patient's Perspective: A Descriptive Phenomenological Study
Consorti, G., Marchetti, A., De Marinis, M. G.
Journal of Manipulative and Physiological Therapeutics, 2020/09










1168

Instrumentation used to assess pain in osteopathic interventions: A critical literature review
Santiago, R. J., Esteves, J., Baptista, J. S., Marques, A. T., Costa, J. T.
International Journal of Osteopathic Medicine, 2020/09

1169

Does Osteopathic Manipulative Treatment Induce Autonomic Changes in Healthy Participants? A Thermal Imaging Study
Cerritelli, F., Cardone, D., Pirino, A., Merla, A., Scoppa, F.
Frontiers in Neuroscience, 2020/08
Free full text

1170

Osteopathic Considerations for the Pregnant Patient with COVID-19
Gray, K. M., Murphy, L., Buckner, B.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1171

Effectiveness of Osteopathic Manipulative Medicine vs Concussion Education in Treating Student Athletes With Acute Concussion Symptoms
Yao, S. C., Zwibel, H., Angelo, N., Leder, A., Mancini, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1172

Osteopathic Manipulative Treatment for Inhaled Rib Somatic Dysfunction
Koch, J., Tsui, C., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1173

Treatment Modalities for Notalgia Paresthetica Including OMT
Cooley, D., McAree, M., Joshi, N., Peerzada, W.
Osteopathic Family Physician, 2020/08
Free full text

1174

Effects of Osteopathic Manipulative Treatment on Sleep Quality in Student Athletes After Concussion: A Pilot Study
Mazzeo, S., Silverberg, C., Oommen, T., Moya, D., Angelo, N., Zwibel, H., Mancini, J., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1175

Rib Somatic Dysfunction Among General Surgical Patients
Baltazar, G. A., Kolwitz, C. E., Florek, M. G.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1176

Clinical Efficacy of Mesenteric Lift to Relieve Constipation in Traumatic Brain Injury Patients
Berry, J. A. D., Ogunlade, J., Kashyap, S., Berry, D. K., Wacker, M., Miulli, D. E., Saini, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1177

Use of Osteopathic Manipulation for Treatment of Chronic Shoulder Injury Related to Vaccine Administration
Veera, S., Chin, J., Kleyn, L., Spinelli, S., Tafler, L.
Cureus, 2020/08
Free full text


1179

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07

1180

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07

1181

Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Cicchitti, L., Di Lelio, A., Barlafante, G., Cozzolino, V., Di Valerio, S., Fusilli, P., Lucisano, G., Renzetti, C., Verzella, M., Rossi, M. C.
Medical sciences, 2020/07
Free full text

1182

Osteopathic Manipulation in the Management of Chronic Pain: Current Perspectives
Licciardone, J. C., Schultz, M. J., Amen, B.
Journal of Pain Research, 2020/07
Free full text


1184

Osteopathic Response to the COVID-19 Pandemic
Martinez, E., Redding, D.
The Journal of the American Osteopathic Association, 2020/07
Free full text

1185

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text


1187

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06


1189

Neuro-Ocular Release: A New Osteopathic Technique For Resolving Somatic Dysfunction
Feely, R. A., Smith, J. A.
The AAO Journal, 2020/06
Free full text

1190

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text

1191

Integrating Osteopathic Manipulative Treatment and Injections in the Diagnosis and Management of a Hip Labral Tear
Snyder, L. L., Knox, S. C., Smutny, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text


1193

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text


1195

Effects of Osteopathic Manipulative Treatment on Musicians: A Systematic Review
Kiepe, M. S., Fernholz, I., Schmidt, T., Brinkhaus, B., Schmidt, A., Weikert, C., Rotter, G.
Medical problems of performing artists, 2020/06

1196

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text













1209

Beliefs about chronic low back pain amongst osteopaths registered in Spain: A cross-sectional survey
Van Biesen, T., Alvarez, G.
International Journal of Osteopathic Medicine, 2020/06


1211

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

1212

Weekly Osteopathic Manipulative Treatment to Improve Measures of Sympathetic Tone in Women With Polycystic Ovary Syndrome: A Randomized, Controlled Pilot Study
Davis, S. E., Hendryx, J., Menezes, C., Bouwer, S., Menezes, H., Patel, V., Bostick Smith, C. A., Speelman, D. L.
The Journal of the American Osteopathic Association, 2020/05
Free full text

1213

Evaluation of the stomatognathic system before and after osteopathic manipulative treatment in 120 healthy people by using surface electromyography
Manzotti, A., Viganoni, C., Lauritano, D., Bernasconi, S., Paparo, A., Risso, R., Nanussi, A.
International Journal of Environmental Research and Public Health, 2020/05
Free full text


1215

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05





1220

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04


1222

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text

1223

Osteopathic manipulative treatment combined with exercise improves pain and disability in individuals with non-specific chronic neck pain: A pragmatic randomized controlled trial
Groisman, S, Malysz, T, de Souza da Silva, L., Rocha Ribeiro Sanches, T., Camargo Bragante, K., Locatelli, F., Pontel Vigolo, C., Vaccari, S., Homercher Rosa Francisco, C., Monteiro Steigleder, S., Jotz, G. P.
Journal of Bodywork and Movement Therapies, 2020/04

1224

Severe Postoperative Chronic Constipation Related to Anorectal Malformation Managed with Osteopathic Manipulative Treatment
Vismara, L., Cozzolino, V., Pradotto, L. G., Gentile, R., Tarantino, A. G.
Case Reports in Gastroenterology, 2020/04
Free full text

1225

Osteopathic Manipulative Treatment Relieves Post-concussion Symptoms in a Case of Polytrauma
Baltazar, G. A., Kolwitz, C., Petrone, P., Stright, A., Joseph, D'A.
Cureus, 2020/04
Free full text

1226

Inhibitory Tests as Assessment Tools for Somatic Dysfunctions: Mechanisms and Practical Applications
Bicalho, E., Vieira, L., Makita, D. K., Rivas, L.
Cureus, 2020/04
Free full text

1227

The Effect of High Velocity Low Amplitude Cervical Manipulations on the Musculoskeletal System: Literature Review
Giacalone, A., Febbi, M., Magnifica, F., Ruberti, E.
Cureus, 2020/04
Free full text



1230

Effect of Osteopathic Manipulative Therapy on Generalized Anxiety Disorder
Dixon, L., Fotinos, K., Sherifi, E., Lokuge, S., Fine, A., Furtado, M., Anand, L., Liberatore, K., Katzman, M. A.
The Journal of the American Osteopathic Association, 2020/03
Free full text


1232

Transitions: Our Own, Our Patients’, Our Profession’s
Newman, D.B.
The AAO Journal, 2020/03
Free full text

1233

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text

1234

Assessment and Management of Somatic Dysfunctions in Patients With Patellofemoral Pain Syndrome
Tramontano, M., Pagnotta, S., Lunghi, C., Manzo, C., Manzo, F., Consolo, S., Manzo, V.
The Journal of the American Osteopathic Association, 2020/03
Free full text


1236

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text

1237

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text

1238

Characteristics and Treatment of Pediatric Patients in an Osteopathic Manipulative Medicine Clinic
Kaiser, G., Degenhardt, B. F., Michael Menke, J., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/03
Free full text

1239

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text

1240

An osteopathic approach to Graves’ ophthalmopathy: A case report
McDermott, G., Qureshi, Y., Foster-Moumoutjis, G., Espejo, A.
International Journal of Osteopathic Medicine, 2020/03
Free full text

1241

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text


1243

Osteopathic Manipulative Medical Assistant: A Proposed Allied Profession
Lennon, J. L.
The Journal of the American Osteopathic Association, 2020/02
Free full text

1244

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text

1245

Osteopathic Medical Care With and Without Osteopathic Manipulative Treatment in Patients With Chronic Low Back Pain: A Pain Registry-Based Study
Licciardone, J. C., Gatchel, R. J.
The Journal of the American Osteopathic Association, 2020/02
Free full text



1248

The labor study: Labor length and birth outcomes osteopathic research
Martingano, D., Mitrofanova, A., Kim, A. F., Ulfers, A., Mersch, M., Stevenson, R., Singh, S.
American Journal of Obstetrics & Gynecology, 2020/01

1249

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01

1250

Isometric osteopathic manipulation influences on cervical ranges of motion and correlation with osteopathic palpatory diagnosis: A randomized trial
Niewiadomski, C., Bianco, R. J., Arnoux, P. J., Evin, M.
Complementary Therapies in Medicine, 2020/01

1251

Lateral Strain Patterns at the Sphenobasilar Synchondrosis
Burruano, M. P.
The Journal of the American Osteopathic Association, 2020/01
Free full text



1254

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020



1257

Who Uses Osteopathic Manipulative Treatment? A Prospective, Observational Study Conducted by DO-Touch.NET
Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2019/12
Free full text

1258

Impact of Predoctoral Teaching Fellows on Osteopathic Medical Students: A Near-Peer Teaching Program Evaluation
Akers, B., Davis, G., Keys, J., Pierce-Talsma, S. L., Lund, G.
The AAO Journal, 2019/12
Free full text

1259




1262

Impact of osteopathic manipulative treatment on range of motion of the pelvis during the one-sided tilt test: a pilot study
Menard, M., Ferrari, M., Bouchet, A., Puchaud, P., Vaucher, P., Sutre, F., Bideau, B., Bourgin, M.
HAL CCSD Taylor & Francis, 2019/12
Free full text


1264

Constipation in Parkinson’s Disease Improved by an Osteopathic Manipulative Medicine Sequence in a Repeated Measures Study
Valasareddi, S., Mathai, M., Li, T. S., Yao, S. C., Mancini, J.
The Journal of the American Osteopathic Association, 2019/12








1272

Developing “Migraneous” Rat Models to Evaluate the Efficacy of OMT on Various Migraine Biomarkers
Byrd, K. E., Gregory, C., Krishna, S., Xie, J. Y., Fleming, R. K.
The Journal of the American Osteopathic Association, 2019/12

1273

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12


1275

Osteopathic Manipulative Medicine Vs Counseling in the Treatment of Sports-Related Concussion: Comparative Balance Assessment
Morris, J. Z., Shah, J., Zwibel, H., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12


1277

The Effect of OMM on Opioid Users with Chronic Low Back Pain
Patel, K. C., Cooley, D. L., Bailey, J. W., Janora, D. M., Fusco, C.
The Journal of the American Osteopathic Association, 2019/12

1278

The Efficacy of Osteopathic Manipulative Treatment on Decreasing the Severity of Migraine Headaches
Rhoads, A., Metzgar, M. M., Donovan, P.
The Journal of the American Osteopathic Association, 2019/12



1281

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text

1282

The Role of Mental Imagery in Osteopathic Palpation: a qualitative study
Kraml, M. M., Besse, J.P.
European Journal of Osteopathic Research, 2019/11
Free full text

1283

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11

1284

The Effect of Osteopathic Manual Treatment on Concussion Injury Rehabilitation
Henderson, L. D.
Unpublished MSc thesis, 2019/11
Free full text




1288

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text




1292

Effectiveness of an osteopathic treatment on the autonomic nervous system: a systematic review of the literature
Rechberger, V., Biberschick, M., Porthun, J.
European Journal of Medical Research, 2019/10
Free full text


1294

Understanding the role of osteopathic manipulative medicine in the management of gastrointestinal disorders and symptoms: a survey study
Shah, R. N., Diehl, D. L., Graham, J., Kim, A. H., Loughlin, M. T.
The American Journal of Gastroenterology, 2019/10
Free full text

1295

Effects of Osteopathic Visceral Treatment in Patients with Gastroesophageal Reflux: A Randomized Controlled Trial
Eguaras, N., Rodriguez-Lopez, E. S., Lopez-Dicastillo, O., Franco-Sierra, M. A., Ricard, F., Oliva-Pascual-Vaca, A.
Journal of Clinical Medicine, 2019/10


1297

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10




1301

Osteopathic Manipulative Treatment for Allostatic Load Lowering
Nuno, V., Siu, A., Deol, N., Juster, R. P.
The Journal of the American Osteopathic Association, 2019/10
Free full text


1303

Does Compression of the Fourth Ventricle Cause Preterm Labor? Analysis of Data From the PROMOTE Study
Hensel, K. L., Roane, B. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text




1307

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text

1308

Osteopathic Approach for Lateral Knee Pain Caused by Iliotibial Band Friction Syndrome: A Case Report
Kostanjevec, J., Fleming, R. K.
The AAO Journal, 2019/09
Free full text

1309

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy in somatoform disorders - Systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
Free full text

1310

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

1311

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09


1313

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text


1315

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09

1316

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09

1317

Temporomandibuläre Dysfunktion (TMD) mit Diskusprolaps
(Temporomandibular dysfunction (TMD) with discus prolapse: Case study on the efficacy of osteopathic treatment)
Vathrakokoilis, K., Liem, T., Aetopoulos, I., Antoniadis, K., Triantafyllidou, E.
Osteopathische Medizin, 2019/09

1318

Osteopathic Manipulation Treatment Improves Cerebro-splanchnic Oximetry in Late Preterm Infants
Marinelli, B., Pluchinotta, F., Cozzolino, V., Barlafante, G., Strozzi, M. C., Marinelli, E., Franchini, S., Gazzolo, D.
Molecules, 2019/09
Free full text

1319

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text

1320

A Literature Review of Osteopathic Manipulative Techniques for Otalgia
Lindsey, T., Lawson, R., Hiffernan, F.
Osteopathic Family Physician, 2019/09


1322

Is visceral manipulation beneficial for patients with low back pain? A systematic review of the literature
Switters, Jacob Marten, Podar, Stefan, Perraton, Luke, Machotka, Zuzana
International Journal of Osteopathic Medicine, 2019/09

1323

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy for somatoform disorders - a systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

1324

Efficacy of osteopathic treatment in patients with stable moderate-to-severe chronic obstructive pulmonary disease: a randomized controlled pilot study
Buscemi, A., Pennisi, V., Rapisarda, A., Pennisi, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2019/08

1325

Muscle energy technique for chronic obstructive pulmonary disease: a systematic review
Baxter, D. A., Shergis, J. L., Fazalbhoy, A., Coyle, M. E.
Chiropractic & Manual Therapies, 2019/08

1326

Empathy in Medicine Osteopathic and Allopathic Physician Interpersonal Manner, Empathy, and Communication Style and Clinical Status of Their Patients: A Pain Registry-Based Study
Licciardone, J. C., Schmitt, M. E., Aryal, S.
The Journal of the American Osteopathic Association, 2019/08
Free full text

1327

Assessment of shoulder pain and somatic dysfunction in young competitive swimmers: Preventive Osteopathic Manipulative Treatment
Granger, F., Etevenard, M., Kily, J. P., Garet, M.
Journal of Sports Medicine and Therapy, 2019/08
Free full text

1328

Osteopathic Manipulative Therapy in Patients With Chronic Tension-Type Headache: A Pilot Study
Deodato, M., Guolo, F., Monticco, A., Fornari, M., Manganotti, P., Granato, A.
The Journal of the American Osteopathic Association, 2019/08

1329

Stretch Receptor and Somatic Dysfunction: A Narrative Review
Andrews, M. A. W.
The Journal of the American Osteopathic Association, 2019/08


1331

Effects of Post-Isometric Relaxation on Ankle Plantarflexion and Timed Flutter Kick in Pediatric Competitive Swimmers
Noto-Bell, L., Vogel, B. N., Senn, D. E.
The Journal of the American Osteopathic Association, 2019/08

1332

Understanding Myalgic Encephalomyelitis/Chronic Fatigue Syndrome and the Emerging Osteopathic Approach: A Narrative Review
Larrimore, C., Ramnot, A., Jaghab, A., Sarduy, S., Guerrero, G., Troccoli, P., Hilton, K., Bested, A.
The Journal of the American Osteopathic Association, 2019/07
Free full text

1333

OMT for the Prevention and Management of Chronic Constipation and Distal Intestinal Obstructive Syndrome in Cystic Fibrosis: A Pilot Study
Modlin, S. E., Borofka, K., Franzini, D., Klene-Bowns, A. C., Nuño, V. A.
The Journal of the American Osteopathic Association, 2019/07
Free full text

1334

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text

1335

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07






1341

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text








1349

Effect of Osteopathic Obstetrical Management on the Duration of Labor in the Inpatient Setting: A Prospective Study and Literature Review
Martingano, D., Ho, S., Rogoff, S., Chang, G., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2019/06
Free full text



1352


1353

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06

1354

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06

1355

Integrated pilot medical study on 40 patients affected by open angle glaucoma undergoing topical therapy with additional osteopathic manipulation
Paoli, D., Brusini, P., Michelin, L., Vassallo, F., Ciullo, L., Torelli, L.
Acta Ophthalmologica, 2019/06


1357

Do empathic osteopaths achieve better clinical results? An observational feasibility study
Acquati, A., Uberti, S., Aquino, A., Cerasetti, E., Castagna, C., Rovere-Querini, P., Pisa, V.
International Journal of Osteopathic Medicine, 2019/06

1358

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text


1360

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06

1361

Patient experience, satisfaction, perception and expectation of osteopathic manipulative treatment: A systematic review
Lam, M. T., Banihashem, M., Lam, H. R., Wan, A. B., Chow, E.
International Journal of Osteopathic Medicine, 2019/06

1362

The role of osteopathic complementary treatment in high frequency paediatric headache: a randomised controlled study
Rossi, R., Versace, A., Lauria, B., Grasso, G., Bagagiolo, D., Cappitella, E., Altieri, R., Delli Santi, M., Scarinzi, C., Urbino, A. F.
Neurological Sciences, 2019/06

1363

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text



1366

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06

1367

Osteopathic Approach to the Treatment of a Patient With an Atypical Presentation of Coccydynia
Alexandre, K., Channell, M. K.
The Journal of the American Osteopathic Association, 2019/06
Free full text

1368

Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Levy, V. J., Holt, C. T., Haskins, A. E.
The Journal of the American Osteopathic Association, 2019/05
Free full text


1370

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text

1371

Cynefin Framework for Evidence-Informed Clinical Reasoning and Decision-Making
Lunghi, C., Baroni, F.
The Journal of the American Osteopathic Association, 2019/05
Free full text



1374

Manual therapy for musculoskeletal pain in cystic fibrosis: Review of the literature
Graziano, L., Giordani, B., Nico, D., Colella, E., Savi, D., Cimino, G., Di Vito, A., Valente, D., Palange, P.
Italian Journal of Pediatrics, 2019/04

1375

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text



1378

Manipulasjonsteknikker ved nakkeasymmetri hos spedbarn
(Manipulation techniques for infant torticollis)
Brurberg, K. G., Dahm, K. T., Kirkehei, I.
Tidsskrift for den Norske Laegeforening, 2019/04
Free full text

1379

Allopathic supervision of osteopathic education: What support is needed?
James, S. J., Zakletskaia, L:
Osteopathic Family Physician, 2019/04

1380

Effects of osteopathic manipulative treatment on patients with multiple sclerosis: A pilot study
Porcari, B., Russo, M., Naro, A., La Via, C., Pullia, M., Accorinti, M., De Luca, R., Calabro, R. S.
Complementary Therapies in Medicine, 2019/04

1381

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04

1382

Osteopathic Manipulative Treatment as a Novel Way to Manage Postvasectomy Pain Syndrome
Gray, R. E., Kasper, K.
The Journal of the American Osteopathic Association, 2019/04
Free full text

1383

Patient satisfaction and perception of treatment in a student-led osteopathy teaching clinic: Evaluating questionnaire dimensionality and internal structure, and outcomes
Vaughan, B., Burns, C., Burridge, L., Wigger, J., Blair, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2019/03

1384

Osteopathic Structural Findings in Women During Menstruation
Cabrera, K. L., Darwish, A. M., Lurz, K. L., L., McClain. R., McClain, E., Cox, J., Segars, L.
The AAO Journal, 2019/03
Free full text




1388

Rescued Root Canal: A Case Report on OMT for Jaw Pain Following Repeat Root Canal Procedure
Fong, K. F., Rummel, T. B.
The AAO Journal, 2019/03
Free full text




1392

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text


1394

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text

1395

Osteopathie bei Bone Bruise
(Osteopathy for bone bruise)
Bick, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03

1396

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03


1398

Manual therapy for the pediatric population: a systematic review
Parnell Prevost, C., Gleberzon, B., Carleo, B., Anderson, K., Cark, M., Pohlman, K. A.
BMC Complementary and Alternative Medicine, 2019/03
Free full text


1400

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text

1401

Dancers’ experience of osteopathy and their attitudes towards dance injuries
Maddren, K.
Unpublished MSc thesis, 2019/03
Free full text

1402

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text

1403

Does somatic dysfunction lead to lower extremity injuries in the high school soccer player?
Wisinski, J., Lipp, T., Dougherty, J. J.
Clinical Journal of Sport Medicine, 2019/03

1404

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03

1405

Short-term effectiveness of the flexion-distraction technique in comparison with high-velocity vertebral manipulation in patients suffering from low-back pain
Carrasco-Martínez, F., Ibáñez-Vera, A. J., Martínez-Amat, A., Hita-Contreras, F., Lomas-Vega, R.
Complementary Therapies in Medicine, 2019/03

1406

Effects of Practicing Osteopathic Manipulative Treatment (OMT) on Hand Function
Barnum, I. F. O., Chang, M. E., Patterson, R. M., Surve, S.
UNTHSC Scholarly Repository, 2019/03

1407

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text

1408

Osteopathic Manipulative Treatment: A Primary Care Approach
Bodine, W. A.
American Family Physician, 2019/02

1409

Assessment of the Efficacy of An Osteopathic Treatment in Infants with Biomechanical Impairments to Suckling
Herzhaft-LeRoy, J., Xhignesse, M., Gaboury, I.
Journal of Visualized Experiments, 2019/02

1410

Osteopathic Manipulative Treatment for Pertussis in the 19th and 20th Centuries: A Structured Historical Literature Review
Liem, T.
The Journal of the American Osteopathic Association, 2019/02
Free full text

1411

Evaluating Patient's Understanding of Pain Neurophysiology: Rasch Analysis of the Neurophysiology of Pain Questionnaire
Vaughan, B., Mulcahy, J., Fitzgerald, K., Austin, P.
The Clinical Journal of Pain, 2019/02


1413

Nonpharmacologic Management of Symptoms in Females With Polycystic Ovary Syndrome: A Narrative Review
Speelman, D. L.
The Journal of the American Osteopathic Association, 2019/01
Free full text

1414

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text

1415

The Italian Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross sectional survey
Cerritelli, F., van Dun, P. L. S., Esteves, J. E., Consorti, G., Sciomachen, P., Lacorte, E., Vanacore, N.
PLoS One, 2019/01
Free full text

1416

Ultrasound Evaluation of Diaphragmatic Mobility and Contractility After Osteopathic Manipulative Techniques in Healthy Volunteers: A Prospective, Randomized, Double-Blinded Clinical Trial
Mancini, D., Cesari, M., Lunghi, C., Benigni, A. M., Antonelli Incalzi, R., Scarlata, S.
Journal of Manipulative and Physiological Therapeutics, 2019/01

1417

Women’s experiences of osteopathic care whilst living with endometriosis
Waugh, M. D.
Unpublished MSc thesis, 2019/01
Free full text

1418

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01

1419

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text

1420

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12

1421

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text

1422

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text

1423

Effect of the soft-tissue techniques in the quality of life in patients with Crohn's disease: A randomized controlled trial
Espi-Lopez, G. V., Ingles, M., Soliva-Cazaban, I., Serra-Ano, P.
Medicine (Baltimore), 2018/12
Free full text

1424

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1425

Can lateral epicondylitis be relief by osteopathic treatments targeting tensions from the thoracic region? Results of a case study
Brisson-Larouche, A., Kassab, G., Wehbe, W.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1426

Effect of global osteopathic treatment on functional mobility in the parkinsonian patient: A quasi-experimental study
Devantéry, K., Bouchard, J.C.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1427

The effect of early osteopathic manual treatment (OMT) care, after vaginal delivery, on pelvic health recovery
Fafard, A.M.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1428

Assessing the immediate behavioural responses of hospitalized preterm babies during osteopathic manipulative treatment (OMT): A case series
O'Connor, S., Lafrenaye, S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1429

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text


1431

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text


1433

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text

1434

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text

1435

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
The Journal of the American Osteopathic Association, 2018/11

1436

The Effect of Osteopathic Manipulative Medicine on Oxidative Stress Following Mild Traumatic Brain Injury: A Pilot Study
Angelo, N., Mazzeo, S., Oommen, T., Zwibel, H., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

1437



1439

The Effect of Osteopathic Manipulative Treatment on Reactive Oxygen Species in Parkinson Disease
Docherty, J., Chu, K., Orshan, D., Kulason, K., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

1440

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

1441

Managing Tremor in Parkinson Disease Using Osteopathic Manipulative Medicine
Li, R., Docherty, J., Koo, S. L., Shinners, J., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

1442

Using Wearable Technology to Measure the Effectiveness of Osteopathic Manipulative Treatment on Parkinson Disease Motor Symptoms
Poon, J., Docherty, J., Mancini, J., DiFrancisco-Donoghue, J., Cheriyan, G., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

1443

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11

1444

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text


1446

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10




1450

Meralgia paresthetica: A 5 model osteopathic approach
Torrents, M., Malik, R.
Osteopathic Family Physician, 2018/10
Free full text

1451

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10



1454

A Short Review of the Treatment of Headaches Using Osteopathic Manipulative Treatment
Whalen, J., Yao, S., Leder, A.
Current Pain and Headache Reports, 2018/10

1455

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text

1456

An Osteopathic Approach to Rib Somatic Dysfunction in Respiratory Disorders
Pierce-Talsma, S., Talsma, J., Ferrill, H.
The Journal of the American Osteopathic Association, 2018/10
Free full text

1457

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text

1458

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09




1462

Osteopathic Manipulative Treatment Including Specific Diaphragm Techniques Improves Pain and Disability in Chronic Nonspecific Low Back Pain: A Randomized Trial
Marti-Salvador, M., Hidalgo-Moreno, L., Domenech-Fernandez, J., Lison, J. F., Arguisuelas, M. D.
Archives of Physical Medicine and Rehabilitation, 2018/09

1463

Primary care physicians' attitude and reported prescribing behavior for chronic low back pain: An exploratory cross-sectional study
Rodondi, P. Y., Dubois, J., Bill, A. S., Koutaissoff, D., Ros, J., Aveni, E., Pasquier, J., Herzig, L., Decosterd, I., Burnand, B.
PLoS One, 2018/09
Free full text


1465

Osteopathic Manipulative Therapy and Multiple Sclerosis: A Proof-of-Concept Study
Cordano, C., Armezzani, A., Veroni, J., Pardini, M., Sassos, D., Infante, M. T., Tacchino, A., Lapucci, C., Cellerino, M., Calabro, V., Ciullo, L., Nourbakhsh, B.
The Journal of the American Osteopathic Association, 2018/08
Free full text

1466

Effectiveness of an Osteopathic Abdominal Manual Intervention in Pain Thresholds, Lumbopelvic Mobility, and Posture in Women with Chronic Functional Constipation
Martinez-Ochoa, M. J., Fernandez-Dominguez, J. C., Morales-Asencio, J. M., Gonzalez-Iglesias, J., Ricard, F., Oliva-Pascual-Vaca, A.
The Journal of Alternative and Complementary Medicine, 2018/08

1467

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text

1468

Medical Infrared Thermography in back pain osteopathic management
Polidori, G., Kinne, M., Mereu, T., Beaumont, F., Kinne, M.
Complementary Therapies in Medicine, 2018/08

1469

Progressive Infantile Scoliosis Managed With Osteopathic Manipulative Treatment Response
Feely, R. A., Kapraun, H. E.
The Journal of the American Osteopathic Association, 2018/07
Free full text

1470

Treatment of bilateral dyshidrotic eczema with drugs versus nutritional and osteopathic treatment
Aceranti, A., Vernocchi, S.
Italian Journal of Medicine, 2018/07
Free full text

1471

Osteopathic Lymphatic Pump Techniques
Franzini, D., Cuny, L. A., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/07
Free full text

1472

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text

1473

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07

1474

Role of osteopathic manipulative treatment in cystic fibrosis: A pilot study
Fainardi, V., Benecchi, S., Longo, F., Tripodi, M. C., Villani, M. L., Teopompi, E., Chetta, A. A., Pisi, G.
Journal of Cystic Fibrosis, 2018/07

1475

Use of complementary health approaches at military treatment facilities, active component, U.S. Armed Forces, 2010-2015
Williams, V. F., Clark, L. L., McNellis, M. G.
Medical Surveillance Monthly Report, 2018/07


1477

Lymphatic Pump Treatment Mobilizes Bioactive Lymph That Suppresses Macrophage Activity In Vitro
Castillo, R., Schander, A., Hodge, L. M.
The Journal of the American Osteopathic Association, 2018/07
Free full text

1478

Osteopathic Manipulative Therapy Potentiates Motor Cortical Plasticity
Ponzo, V., Cinnera, A. M., Mommo, F., Caltagirone, C., Koch, G., Tramontano, M.
The Journal of the American Osteopathic Association, 2018/06
Free full text


1480


1481

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text

1482

Osteopathic Cranial Manipulative Medicine in the Setting of Concussion
Warren, C., Keys, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/06
Free full text

1483

Osteopathic manipulative treatment for post mastectomy pain: A case report
Downey, H. F.
International Journal of Osteopathic Medicine, 2018/06



1486

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects
Abdelfattah, A., Abdelraoof, N., Nasef, S.
Internal Medicine Journal, 2018/05
Free full text

1487

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05

1488


1489

Myofascial Release Therapy Beneficial for Patients With Chronic Low Back Pain
Jazayeri, S., Seffinger, M.
The Journal of the American Osteopathic Association, 2018/05
Free full text

1490

Fibromyalgia Symptoms Reduced by Osteopathic Manipulative Medicine and Gabapentin
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

1491

Osteopathic Manipulation Shown to Improve Upper Airway Stabilization
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

1492

Cervical Osteopathic Manipulation Shown to Affect Median Nerve Function
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

1493

Manipulation and mobilization for treating chronic low back pain: a systematic review and meta-analysis
Coulter, I. D., Crawford, C., Hurwitz, E. L., Vernon, H., Khorsan, R., Suttorp Booth, M., Herman, P. M.
The Spine Journal, 2018/05
Free full text

1494

Restoration of Full Shoulder Range of Motion After Application of the Fascial Distortion Model
Boucher, J. D., Figueroa, J.
The Journal of the American Osteopathic Association, 2018/05
Free full text

1495

Neck-stomach syndrome in the cervical spondylosis: An update on preliminary 2017 data
Ramieri, A., Miscusi, M., Costanzo, G.
European Spine Journal, 2018/04

1496

Fibromyalgia with Gabapentin and Osteopathic Manipulative Medicine: A Pilot Study
Marske, C., Bernard, N., Palacios, A., Wheeler, C., Preiss, B., Brown, M., Bhattacharya, S., Klapstein, G.
The Journal of Alternative and Complementary Medicine, 2018/04


1498

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text

1499

How type and number of training sessions influence the reliability of palpation
Lavazza, C., Milano, V., Abenavoli, A., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2018/04

1500

Osteopathic manipulative treatment in chronic coccydynia: A case series
Origo, D., Tarantino, A. G., Nonis, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2018/04

1501

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04

1502

The immediate effect of osteopathic cervical spine mobilization on median nerve mechanosensitivity: A triple-blind, randomized, placebo-controlled trial
Whelan, G., Johnston, R., Millward, C., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2018/04

1503

IGeL-Monitor. Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text


1505

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03

1506

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03




1510

Characterizing Adverse Events Reported After Osteopathic Manipulative Treatment
Degenhardt, B. F., Johnson, J. C., Brooks, W. J., Norman, L.
The Journal of the American Osteopathic Association, 2018/03
Free full text

1511

Shaping conservative spinal services with the Spine Tango Registry
Morris, S., Booth, J.
European spine journal, 2018/03

1512

The Safety of Osteopathic Manipulative Treatment (OMT)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/03
Free full text

1513

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text

1514

OMT for Patients With Sacral Somatic Dysfunction
Yu, K., Pfotenhauer, K., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/03
Free full text


1516

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text

1517

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text


1519

Work-related musculoskeletal injuries among Australian osteopaths: A preliminary investigation
McLeod, G. A., Murphy, M., Henare, T. M., Dlabik, B.
International Journal of Osteopathic Medicine, 2018/03


1521

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03



1524

The effects of osteopathic treatment on psychosocial factors in people with persistent pain: A systematic review
Saracutu, M., Rance, J., Davies, H., Edwards, D. J.
International Journal of Osteopathic Medicine, 2018/03




1528

OMT to Address the Physiologic Effects of Stress
Emmet, D., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/02
Free full text

1529

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text

1530




1533

Chronic Pain Management: Perspective of an Osteopathic Medical Student in New Mexico
Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text

1534

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text

1535

Effects of spinal manipulation and myofascial techniques on heart rate variability: A systematic review
Amoroso Borges, B. L., Bortolazzo, G. L., Neto, H. P.
Journal of Bodywork