Advanced search



 
 80% of the records
 
 20.0 % of the records
 
 56.7 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Medically Underserved Area*Osteopathic Medicine*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademicacademic barrieracademic difficultiesacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic successacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced trainingadvancing TBI careadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappraisalsapproachaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaaspirationassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical swallowingaudiovisual aidsauditory canalauditory channelauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioenergetic modelbioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumablack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrand disputeBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinC-tactileC-tactile afferentsC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SteeleC. WeaverC1C3cability crisiscadavercadaver dissectioncadaveric dissectioncadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCanadaCanadiancanal syndromecancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1cold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasesColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial volumecranial-sacral-motioncraniocranio sacral osteopathycranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutionculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latadeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdeglutition disordersdegreesdehydrationdelayed developmentdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational technologyeducational toolseducational valueEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30elastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemployment disabilityemu oilenactivismencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocular musclesextrinsic sleep disorderseyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial structurefacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilityGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenomicsgentlenessgeodesicgeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationgluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycosylationglygoaminoglycansglymphaticglymphatic systemglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead painhead positionhead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare costhealthcare costshealthcare deliveryhealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organshome carehome exercisehomeless personshomeless populationhomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehumanitiesHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8Interleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra ocular pressureintra- and inter-rater reliabilityintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohnston’s functional methodsjointjoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney mobilitykidney motilitykidney stonekidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdle muscular dystrophylimb injurieslimb placodelimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatrix-rhythm-therapymattermaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionmediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien TettambelmembershipmembranesmemorymemosmenMeniere’s diseasemeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticameridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetastasismetastatic abdominal cancermetastudiesmethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRImsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle contractilitymuscle contractionmuscle developmentmuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathyMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal hyperbilirubinemianeonatal intensive care unitneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuropsychiatric disorderneuropsychiatryneuropsychological testsneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotomesneurotransmissionneurotransmitterneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid use disorderopioid-related disordersopioidsopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral aversionoral cavityoral diagnosisoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondrosisosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered carepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphytotherapyPIC syndromepicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disordersplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologypreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprisonprivate collegesprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studyPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsrctre-findingsre-orientation processreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniascholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspeakingspecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific laryngeal manipulationspecificityspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintsSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal manipulationsternal painsternal recoil techniquesternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth settingtelemanagementtelemedicinetelemetrytelephonetelescopic bridgeworktemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamicsurogenital stage or phallic stageurogenital systemurogenital tracturologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. ComeauxzenZIMMTzinczinc deficiencyZink modelZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

3563 results (please see below)  Sort:    
1

Strategies to prevent and manage running-related knee injuries: A systematic review of randomised controlled trials
Alexander, J., Johnston, R., Ezzat, A., Culvenor, A., Barton, C.
Journal of Science and Medicine in Sport, Nov 2022 2022-11-02
2

Syndrome des releveurs de l’anus, troubles fonctionnels intestinaux et anomalies articulaires du petit bassin, place du traitement ostéopathiqueLevator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment
(Levator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment)
Riot, F. M., Goudet, P., Mouraux, J. P., Cougard, P.
La Presse Medicale, Jul 31
3

ОСТЕОПАТИЯ КАК ИННОВАЦИОННЫЙ ВЕКТОР В ВОССТАНОВИТЕЛЬНОЙ И СПОРТИВНОЙ МЕДИЦИНЕ
Osteopathy as an innovative Approach to Rehabilitation and Sports Medicine
Vovkogon, A., Sankova, M., Nikolenko, V., Oganesyan, M., Gridin, L.
Human Sport Medicine, 23/08
Free full text
4

Osteopathic manipulative treatment in a patient with idiopathic scoliosis assessed by breathing pattern characterization using optoelectronic plethysmography and quality of life — a case report
Gaillard, L., Stubbe, L., Riquet, D., Houel, N.
Journal of Bodywork and Movement Therapies, 2025/09
Free full text
5

Osteopathic diagnosis and treatment of the spine in patients with chronic back pain through the lens of medical infrared thermography: A randomized controlled pilot study
Bohlen, L., Biester, A., Rapp, O., Wentzel, J., Liem, T., Cerritelli, F., Schmidt, T.
Complementary Therapies in Clinical Practice, 2025/08
6

Investigating the trustworthiness of randomized controlled trials in osteopathic research: a systematic review with meta-analysis
Sénéquier, A., Draper-Rodi, J., Alvarez Bustins, G., Braithwaite, F. A., Brown, J., Corcoran, D., Forrest, L., Godsi, E., MacMillan, A., Menard, M., Roura Carvajal, S., Scocca, C., Treffel, L., Vaucher, P., Wagner, A., Soliman, N., Abbey, H., Hohenschurz-Schmidt, D.
Journal of Clinical Epidemiology, 2025/07
Free full text
7

Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial
Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., Arnal-Gómez, A.
International Journal of Osteopathic Medicine, 2025/06
Free full text
8

The combined effect of biofeedback training and osteopathic procedures for the treatment of functional daytime urinary incontinence: A prospective, randomized clinical trial
Elgohary, H. M. I., Elfahl, A. M., Elkholy, M. N.
Journal of Bodywork and Movement Therapies, 2025/06
9

An overview of systematic reviews on the efficacy and safety of osteopathic techniques
Zipp, C. R., Semlitsch, T., Tögel, G., Krenn, C., Loder, C., Jeitler, K., Siebenhofer, A.
Journal of Bodywork and Movement Therapies, 2025/06
10

Osteopathische Behandlung bei Säuglingskolik/exzessivem Schreien: Eine prospektive, multizentrische, randomisierte, kontrollierte Studie
(Osteopathic treatment for infant colic/excessive crying: A prospective, multicenter, randomized, controlled trial)
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
Osteopathische Medizin, 2025/06
11

Osteopathische Behandlung eines Reizdarmsyndroms
(Osteopathic treatment of irritable bowel syndrome)
Scheuchl, F., Spohr, G.
Osteopathische Medizin, 2025/06
12

Technik zur Behandlung des Sonnengeflechts (Ganglia coeliaca)
(Technique for treating the solar plexus (celiac ganglia))
Liem, T.
Osteopathische Medizin, 2025/06
13

Development of Standardized Osteopathic Manipulative Treatment Tracking Forms Recording Pain and Functional Outcomes to Facilitate Osteopathic Research
Joseph, C., Mintle, L. S., Hoegerl, C., Asher, D., Adams, K., Fugler, P., McKinney, J.
International Journal of Osteopathic Medicine, 2025/06
14

Osteopathic approach to injuries of the overhead thrower’s shoulder
De Luigi, A. J., Raum, G. M., King, B. W., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/06
Free full text
15

Shaft femoral fracture secondary to osteopathic manipulation: case report and medico-legal implication
Prevot, L. B., Bolcato, V., Fozzato, S., Tronconi, L. P., Basile, G.
International Journal of Osteopathic Medicine, 2025/06
16

Acute changes in functional connectivity associated with first osteopathic manual treatment in chronic low back pain spatially overlap with opioid receptor expression
Tomaiuolo, F., Cerritelli, F., Sestieri, C., Keys, J., Paolucci, T., Sensi, S. L., Ferretti, A., Delli Pizzi, S.
Brain Research Bulletin, 2025/06
Free full text
17

Article Review: Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Daugereaux, S.
The AAO Journal, 2025/06
18

An Osteopathic Strategy for the Recognition and Management of Cervicogenic Vertigo: A Case Study
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2025/06
19

Correlation of Ankyloglossia and Breastfeeding Difficulties in Infants Referred for Osteopathic Manipulation at a Family Medicine Residency Clinic: A Retrospective Chart Review
Bendrick, T., White, M., Drissi, W., Van Huigenbos, P., Hills, K., Furlano, A.
The AAO Journal, 2025/06
20

Osteopathic Treatment Decreases Pain and Opioid Use in Children with Acute Sickle Cell Disease Pain
Brown, A., Goubeaux, D., Belsky, J.
The AAO Journal, 2025/06
21

Use of Osteopathic Manipulative Medicine in Treatment of Neurologic Sequelae of Sjögren’s Syndrome
Campbell, K., Ettlinger, H. M.
The AAO Journal, 2025/06
22

Functional Improvement without the Surgery Referral, A Case Presentation
Candelori, W. J., Gailius, G. C.
The AAO Journal, 2025/06
23

When the Framework Fails: The Cost of Overlooking the Basics in Chest Pain
Collingsworth, M., Schaefer, M., Emmons, A.
The AAO Journal, 2025/06
24

The Use of Osteopathic Manipulative Medicine During the Inpatient Evaluation for Acute Coronary Syndrome
Coppinger, C., Rit, N., Coppinger, J.
The AAO Journal, 2025/06
25

Optimization of Abdominal Surgery and Controlling Intractable Neuropathic Pain with Peri-operative OMT
Cruz, C., Ural, E., Gailius, G. C., Neuer, K.
The AAO Journal, 2025/06
26

Resolving Deep Gluteal Syndrome with OMT
Dirusso, E., Shugar, J.
The AAO Journal, 2025/06
27

Rhabdo Resuscitation and Recovery Using Osteopathic Manipulative Treatment
Fadenrecht, H., Thorsvik, N.
The AAO Journal, 2025/06
28

Novel COL4A1-related phenotype: generalized hypermobility in a patient with heterozygous missense mutation at NM_001845.6(COL4A1): c.4006G>A (p. Val1336Ile)
Mingo, E. N., Unger, M. J. Jr.
The AAO Journal, 2025/06
29

OMT for TBI: A Case Report Showing Improvements in Vision, Mastication, and Post-Traumatic Headaches
Schneider, G., Garrison, S.
The AAO Journal, 2025/06
30

Patterns of OMT Use Across Diverse Practice Settings: Insights from a Multicenter Healthcare System
Toor, J., Stacey, S.
The AAO Journal, 2025/06
31

Osteopathic manipulative treatment and breastfeeding, correlation between age at presentation, mode of delivery, and LATCH scores: a retrospective chart review
White, M., Bendrick, T., Drissi, W., Van Huigenbos, P., Hills, K., Furlano, A.
The AAO Journal, 2025/06
32

OMT for acute on chronic pain in systemic scleroderma
White, M., Furlano, A.
The AAO Journal, 2025/06
33

Tic Douloureaux: Applied Osteopathy for a Case of Refractory Trigeminal Neuralgia
Wright, J., Thorsvik, N.
The AAO Journal, 2025/06
34

The Impact of Simulated Osteopathic Manipulative Medicine Hospital Rounds on Student Confidence and the Likelihood of OMT Use During Clinical Clerkships
Abdulnour, T., Pryor, J., Chun, L.
The AAO Journal, 2025/06
35

Utilizing Osteopathic Manipulative Medicine to Support Lifestyle Behavior Change: A Case Report
Arnold, C., Bercaw, K., Branda, A.
The AAO Journal, 2025/06
36

Look What The Stork Brought; Osteopathic Manipulative Treatment for Postpartum Foot Drop: A Case Study
Bethea, J., Waters, H.
The AAO Journal, 2025/06
37

The use of OMT in Myalgic Encephalomyelitis/Chronic Fatigue Syndrome
Brancale, D., Cooley, D.
The AAO Journal, 2025/06
38

Hand & Helmet: A Crown-to-Coccyx Approach for Positional Plagiocephaly
Enniss, A., Neuer, K., Whitaker, Z., Ural, E.
The AAO Journal, 2025/06
39

From Fatigue to Function: A Case Report of The Use of OMT in Chronic Fatigue Syndrome
Finkelstein, A., Petrillo, G., Keys, J.
The AAO Journal, 2025/06
40

Osteopathic Manipulative Treatment (OMT) in the Management of a Young Male with Lewy Body Dementia (LBD): A Case Study
Finkelstein, A., Radigan, R., Yao, S. C.
The AAO Journal, 2025/06
41

Management of Chemotherapy Induced Strains in a Breast Cancer Survivor with OMT
Johnson, R., White, E., Yu, X., Aldridge, A. F., Bardowell, A.
The AAO Journal, 2025/06
42

Turning the Tie: The Impact of OMT on infant torticollis and tongue tie
Lee, D. W., Katyal, J., Faillace, R.
The AAO Journal, 2025/06
43

Osteopathic Manipulative Treatment in a Case of a Runner with Long-COVID and Autonomic Dysregulation
Lupori, E., Bowen, S., Le, B.
The AAO Journal, 2025/06
44

Clavicular Dysfunctions: An Osteopathic Approach to Neck, Shoulder, and Chest Pain
Machado Douaihi, S. J., Waters, H.
The AAO Journal, 2025/06
45

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06
46

“I Feel Stuck:“ A Case Presentation on the Application of OMM to a Patient with Chronic Atypical Chest Pain After Pulmonary Coccidioidomycosis
Mayberry, M., Ural, E.
The AAO Journal, 2025/06
47

A Viscerosomatic Discovery: Unveiling a Case of Gastroparesis Disguised as Shoulder Pain
McKenna, T., Pfeifer, K., Wallace-Ross, J.
The AAO Journal, 2025/06
48

Exploring the Impact of Teaching Assistants on Student Learning in Osteopathic Manipulative Medicine (OMM) Laboratory Session: A Survey Study
Mehra, M., Ashkezari, A. D., Caron, E., Noto, P., Yao, S. C.
The AAO Journal, 2025/06
49

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06
50

Evaluation of Osteopathic Manipulative Treatment Strategies in Adults with Chronic Neck Pain
Moljo, M., Sreenivasa, S., Neupane, R., Harris, Z., Potter, A.
The AAO Journal, 2025/06
51

Comparing Measurements of the Carpal Tunnel and the Median Nerve Before and After Applying Osteopathic Manipulative Treatment: An Ultrasound-Guided Case Study
Nandedkar, T., Brown, S., Schneider, R., Rosten, C.
The AAO Journal, 2025/06
52

Osteopathic Manipulative Treatment (OMT) Techniques Utilized for Specific Post-COVID Symptoms Based on Physician Survey Results
Nawrocka, N., Baronos, A., Yao, S. C.
The AAO Journal, 2025/06
53

When it’s not about Ankyloglossia: A case of Osteopathic Manipulative Treatment for Newborn Breastfeeding Difficulties in the Absence of Restricted Labial or Lingual Frenula
Nixon, B., Waters, H.
The AAO Journal, 2025/06
54

Finding his Voice: A Case Report of the Utility of OMT in a Child with Global Delay
Petrillo, G., Keys, J.
The AAO Journal, 2025/06
55

Evaluating the Acute Effects of Osteopathic Manipulative Treatment on Sprint Times
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., Jo, K., Roush, J., Cosgrave, C.
The AAO Journal, 2025/06
56

The Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Sharma, H., Bethea, J., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
The AAO Journal, 2025/06
57

Short-Lever Assessment of Spinal Side-Bending
Sudweeks, K., McClendon, M., Khalil, F., Kania, A.
The AAO Journal, 2025/06
58

Impact of Osteopathic Manipulative Treatment in Delivering Comprehensive Care in Populations with Disabilities
Villarosa, M., Bae, P., Yeam, J., Hoang, V., White, G., Blumer, J.
The AAO Journal, 2025/06
59

Management of Chronic Migraine in a 34-year-Old Obese Female
White, E., Johnson, R., Yu, X., Bardowell, A.
The AAO Journal, 2025/06
60

Osteopaths’ perspective and experiences of elite track and field athletes osteopathic treatments: A descriptive phenomenological study
Consorti, G., Fard, R., Odorisio, L., Cella, M.
Journal of Bodywork and Movement Therapies, 2025/06
61

Effectiveness of osteopathic treatment in women with primary dysmenorrhea: A randomised controlled trial
Plathner, M., Wolf, L.
Journal of Bodywork and Movement Therapies, 2025/06
62

Efficiency of physical therapy and osteopathic techniques in the treatment of operated and recurrent lumbar disc herniation - a case report
Antohe, B.A., Rață, M., Rață, B., Rață, G.
Journal of Bodywork and Movement Therapies, 2025/06
63

Providing Palliative Care for Two: Managing Cancer-Related Pain During Pregnancy
Okonta, V., Kirkire, L., Schoen, M., Mesarwi, P., Skavinski, K.
Journal of Pain and Symptom Management, 2025/05
64

Effects of osteopathic treatments in a patient who underwent two cardiac surgeries - A case report
Aubin, A., Bekhazi, J., Fortin, A., Paradis, A., Morin, C.
International Journal of Osteopathic Medicine, 2025/05
65

Osteopathic Manipulative Treatment for Chronic Low Back Pain and Musculoskeletal Pain in Remote Underserved Populations: A Systematic Literature Review
Friedman, A., Sheth, R., Wallace-Ross, J.
Cureus, 2025/05
Free full text
66

A review of osteopathic and related manipulative treatments for improving symptoms of gastrointestinal distress in neurological disorders
Peters, J., Runnels, G., Lauinger, A., Murphy, T., Griffith, A., Slicho, T.
International Journal of Osteopathic Medicine, 2025/05
67

A Retrospective Multicenter Analysis of Osteopathic Manipulation in Academic and Community Settings
Stacey, S. K., Harmelink, B., Gordon, B., Toor, J., Furlano, A., Genewick, J., Westfall, E.
Cureus, 2025/05
Free full text
68

Effectiveness of osteopathic manual treatment in the elderly population: a scoping review of clinical evidence
Molinari, L., Mingrone, L., Novelli, E.
Journal of Osteopathic Medicine, 2025/05
Free full text
69

Chronic pain outcomes among patients treated by osteopathic vs. allopathic physicians: a 36-month follow-up study
Licciardone, J. C., Lewis, H., Dahl, K., Adams, B., Aryal, S.
Journal of Osteopathic Medicine, 2025/05
Free full text
70

The epidemiology of osteopathic diagnoses and treatments in United States emergency departments from 2018 to 2021
Distefano, A., Harris, H., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2025/05
Free full text
71

Osteopathic intervention for inflammatory conditions of the lactating breast: a case series
Engel, R., Willy, K., Fuller, E.
International Journal of Osteopathic Medicine, 2025/05
72

Potential impact of an osteopathic intervention for internationally adopted children with fetal alcohol spectrum disorder (FASD); a prospective case series
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., Aldecoa-Bilbao, V., García-Algar, Ó.
International Journal of Osteopathic Medicine, 2025/05
Free full text
73

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/05
74

Breath of Relief: Osteopathic Manipulative Treatment of Chronic Postoperative Pain in a Bilateral Lung Transplant Patient
Duggal, V., Finkelstein, A., Radigan, R., Bhushan, P.
Cureus, 2025/05
Free full text
75

Author Correction: Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., Perpetuini, D., Keys, J., Merla, A., Cardone, D.
Scientific Reports, 2025/05
Free full text
76

Exploring manual therapy in the management of irritable bowel syndrome in adults: A scoping review
Płóciennik-Korycka, N., Pani, S. M., Bruc, B., Contu, P., Wrzesińska, M.
Complementary Therapies in Medicine, 2025/05
Free full text
77

Elbow injuries in overhead throwing athletes: clinical evaluation, treatment, and osteopathic considerations
King, B. W., Raum, G. M., De Luigi, A. J., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/05
Free full text
78

Efficacy of Osteopathic Manipulative Treatment in Creating a Difference in Pain Levels for Patients With Localized Joint Pain: A Meta-Analysis of Randomized Controlled Trials
DeFrancisis, J. S., Vinarski, B. M., Abreu, M., Ibrahim, J., Hostoffer, R.
Cureus, 2025/04
Free full text
79

Patient-Practitioner-Environment Synchronization: Four-Step Process for Integrating Interprofessional and Distinctive Competencies in Osteopathic Practice-A Scoping Review with Integrative Hypothesis
Lunghi, C., Baroni, F., D'Alessandro, G., Consorti, G., Tramontano, M., Stubbe, L., Conte, J., Liem, T., Zegarra-Parodi, R.
Healthcare, 2025/04
Free full text
80

Swelling and skin changes: an osteopathic approach to pediatric lymphedema management
Jackson, S., Hussaini, A., Galan, J., Chung, T. C., Javed, B.
Journal of Osteopathic Medicine, 2025/04
Free full text
81

Corrigendum to: Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/04
Free full text
82

The Effect of Osteopathic Manipulative Treatment Adjunct on Stabilization Splint Treatment in Temporomandibular Joint Anterior Disc Displacement with Reduction Disorder: A Quantitative Analysis, Pilot Study
Aklar, A., Bal, B., Taşdelen, N., İnal, H. S., Ertaş, G.
Journal of Clinical Medicine, 2025/04
Free full text
83

Evaluation of the effectiveness of osteopathic treatment on the mother-newborn dyad in the event of painful breastfeeding in a maternity hospital despite the application of all usual aids: randomized interventional trial in two parallel arms without blinding
Elleau, C., Missmahl, C., Belcadi, W., Aurillac-Lavignolle, V., Sentilhes, L.
Frontiers in Nutrition, 2025/04
Free full text
84

Effect of osteopathic manipulation on pain, disability, range of motion and reposition sense in subjects with postural neck pain: a systematic review protocol
Hullumani, S., Raghumahanti, R., Qureshi, I., Ladkhedkar, P.
BMJ Open, 2025/04
Free full text
85

The role of osteopathic manipulative treatment for dystonia: a literature review
Phrathep, D. D., Abdo, Z., Tadros, M., Lewandowski, E., Evans, J.
Journal of Osteopathic Medicine, 2025/04
Free full text
86

Tradition-Dismissive vs. Tradition Reconceptualization Approaches in Musculoskeletal Care: The Example of Osteopathic Care
D&rsquo, Alessandro, G., Lunghi, C., Consorti, G., Zanon, S., Berti, F., Turinetto, M., Di Pietrantonio, L., Longobardi, M., Zegarra-Parodi, R., Baroni, F.
Applied Sciences, 2025/03
Free full text
87

Impact of osteopathic manipulative medicine training during graduate medical education and its integration into clinical practice
Kramer, J. L., Trombetti, K., De Asis, K., Mai, V., Swing, E.
Journal of Osteopathic Medicine, 2025/03
Free full text
88

Assessing the effects of manual therapy on pain in patients living with Persistent Non-Specific Low Back Pain (PNSLBP): Which evaluation criteria and measurement tools used in randomised controlled clinical trials? A systematic review
Bilhaut, A., Olivier, A.H., Draper-Rodi, J., Cretual, A., Ménard, M.
International Journal of Osteopathic Medicine, 2025/03
89

Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., David, P., Jordan, K., Arcangelo, M., Daniela, C.
Scientific Reports, 2025/03
Free full text
90

„Du lebst und stirbst durch mich“: Das Zwerchfell im osteopathischen Kontext
(“You live and die through me“: the diaphragm in an osteopathic context)
Engel, M.
Osteopathische Medizin, 2025/03
91

Effects of a single osteopathic manipulative treatment on intraocular pressure reduction: a pilot study
King, H. H., Weinreb, R. N., Walker, E., Zangwill, L. M.
Journal of Osteopathic Medicine, 2025/03
Free full text
92

A novel simulation enhanced education for osteopathic manipulation of hospitalized patients
Eilerman, A. P., Libonate, G., Pothen, S., Rudie, M., Zardoost, S., Donaldson, B., Gable, B.
Journal of Osteopathic Medicine, 2025/03
Free full text
93

Osteopathic Manipulative Treatment of the Ankle-Foot Complex in Individuals with Limited Dorsiflexion: Study Protocol for a Randomized Crossover Clinical Trial
Loures de Paula, A., Castro, R. Q., Souza, H. C., de Castro Moreira, B., Moreira Baião, I. C., Schmitz Correa, C. P., Felício, D. C., Fonseca, D. S.
International Journal of Osteopathic Medicine, 2025/03
94

Osteopathische Behandlung therapieresistenter Schmerzen: Chronisch abdominaler Schmerz, eingeschränkte Atmung und Unverträglichkeit von Schmerzmitteln bei Zustand nach Colon-ascendens-Karzinom
(Osteopathic treatment of therapy-resistant pain: Chronic abdominal pain, restricted breathing and intolerance to painkillers in the condition after ascending colon cancer)
Geilgens, A., Repik, I.
Osteopathische Medizin, 2025/03
95

An Innovative Osteopathic Curriculum for Allopathic and Osteopathic Family Medicine Residents
Price, J. W.
The AAO Journal, 2025/03
96

Влияние остеопатической коррекции на проявления постхолецистэктомического синдрома
(Effect of osteopathic correction on the manifestations of postcholecystectomy syndrome)
Bibikov, A. A., Nenashkina, E. N., Oreshko, A. Y.
Russian Osteopathic Journal, 2025/03
97

Возможности применения мануальной терапии и остеопатической коррекции при задержке речевого и моторного развития у детей
(Possibility of using manual therapy and osteopathic correction for delayed speech and motor development in children)
Bobko, A. Y., Bobko, Y. N., Adulas, E. I., Mizonova, I. B., Bulina, O. V., Suslova, G. A.
Russian Osteopathic Journal, 2025/03
98

Динамика остеопатического статуса у пациентов с хроническим тонзиллитом при комплексном лечении с включением остеопатической коррекции
(Dynamics of osteopathic status in patients with chronic tonsillitis during complex treatment with inclusion of osteopathic correction)
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushk, S. A.
Russian Osteopathic Journal, 2025/03
99

Немедикаментозные методы в консервативном лечении и предоперационной подготовке пациентов с гонартритом (обзор литературы)
(Non-medicamentous methods in conservative treatment and preoperative preparation of patients with gonarthritis (literature review))
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/03
100

Остеопатическая коррекция в составе комплексного лечения пациенток с маточной формой бесплодия
(Osteopathic correction as part of complex treatment of patients with uterine form of infertility)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/03
101

Применение остеопатической коррекции в комплексной терапии пациенток с варикозной болезнью нижних конечностей
(Application of osteopathic correction in complex therapy of patients with varicose veins of the lower limbs)
Belash, V. O., Usenko, K. P.
Russian Osteopathic Journal, 2025/03
102

Функции диафрагмы и их нарушение при искусственной вентиляции легких (обзор литературы)
Tolmachev, K. M., Potekhina, Y. P.
Russian Osteopathic Journal, 2025/03
103

Osteopathic Manual Therapy Versus Conventional Conservative Therapy in the Management of Temporomandibular Disorders
Rahman, S.
Journal of Modern Health and Rehabilitation Sciences, 2025/03
Free full text
104

Gender Health Gap und die Rolle der Osteopathie in der Frauenheilkunde
(Gender Health Gap and the role of osteopathy in gynecology)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
105

Track and field coaches' perspective and experiences of including osteopaths in shared management of elite athletes: A descriptive phenomenological study
Fard, R., Cella, M., Odorisio, L., Consorti, G.
Journal of Bodywork and Movement Therapies, 2025/03
106

Formen der funktionellen Harninkontinenz bei Kindern
(Forms of functional urinary incontinence in children)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
107

Formation of myofаscial pain syndrome and its correction in patients with tension headache
Vesnin, A. V., Tovazhnianska, O. L.
Journal of V. N. Karazin Kharkiv National University. Series 'Medicine', 2025/02
108

Efficacy of pulsed electromagnetic field therapy on pain and physical function in patients with non-specific low back pain: a systematic review
Kull, P., Keilani, M., Remer, F., Crevenna, R.
Wiener Medizinische Wochenschrift, 2025/02
Free full text
109

Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Galeazzi, Y., Houel, N., Gouaux, L., Rohan, A., Le Heiget, H., Jung, C., Housset, B., Stubbe, L.
Pain Reports, 2025/02
Free full text
110

Effects of manual osteopathic interventions on psychometric and psychophysiological indicators of anxiety, depression and stress in adults: a systematic review and meta-analysis of randomised controlled trials
Gordon, T. C., Hope-Bell, J., Draper-Rodi, J., MacMillan, A., Miller, D., Edwards, D. J.
BMJ Open, 2025/02
Free full text
111

Exploring the Impact of Osteopathic Manipulative Treatment on Chronic Migraine Relief: A Case Study
Lahlou, Y., Aamir, M., Shadiack, V.
Cureus, 2025/02
Free full text
112

“The Dark Side of Musculoskeletal Care”: Why Do Ineffective Techniques Seem to Work? A Comprehensive Review of Complementary and Alternative Therapies
Mamud-Meroni, L., Tarcaya, G. E., Carrasco-Uribarren, A., Rossettini, G., Flores-Cortes, M., Ceballos-Laita, L.
Biomedicines, 2025/02
Free full text
113

The effect of osteopathic manipulative treatment on chronic rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kalkat, A., Hammes, C., Kohli, E., Callahan, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2025/02
Free full text
114

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text
115

Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/02
Free full text
116

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text
117

Diagnosis and Treatment of Thoracic Outlet Syndrome in an Elderly Male Patient: A Case Report and Protocol Evaluation
Dale, J. L., Sood, H.
Cureus, 2025/02
Free full text
118

Efficacy of non-surgical, non-pharmacological treatments for congenital muscular torticollis: a systematic review and meta-analysis
Antares, J. B., Jones, M. A., Chak, N. T. N., Chi, Y., Li, H., Li, M., Chan, E. Y. W., Chen, T. M. K., Lee, C. M. Y., Urquhart, D. M.
BMC Musculoskeletal Disorders, 2025/02
Free full text
119

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
120

Gedanken zur Behandlung von Cochlea-Implantat-Trägern
(Thoughts on the treatment of cochlear implant users)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
121

Heilungshindernisse
(Obstacles to healing)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
122

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text
123

Osteopathic Manipulative Treatment in Cervical Dystonia Patients Treated with IncobotulinumtoxinA
Décarie, P., Chouinard, S., Venne, G.
International Journal of Osteopathic Medicine, 2025/01
124

An Unusual Presentation of Respiratory Dysfunction in Parkinson’s Disease: A Case Study
Rundquist, L. D., Lyons, S. E., Moljo, R. J., Blavo, C.
Cureus, 2025/01
Free full text
125

Osteopathic treatment of infants with infantile colic/excessive crying: a prospective, multicentric, randomized controlled trial and nested observational trial
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
BMC Pediatrics, 2025/01
Free full text
126

Early osteopathic manipulative treatment to prevent cranial positional deformities: A randomized controlled trial
Genelot, C., Macioce, V., Huguet, H., Harrewijn, I., Cambonie, G., Dessauge, D., Mura, T., Moulis, L., Captier, G.
Archives de Pédiatrie, 2025/01
Free full text
127

Three-Dimensional Posture Analysis-Based Modifications After Manual Therapy: A Preliminary Study
Scoppa, F., Graffitti, A., Pirino, A., Piermaria, J., Tamburella, F., Tramontano, M.
Journal of Clinical Medicine, 2025/01
Free full text
128

Osteopathic Manipulative Treatment: A Safe and Feasible Adjunct in Sickle Cell Disease Pain Management
Brown, A., Goubeaux, D., Jacob, S. A., Belsky, J. A.
Pediatric Blood & Cancer, 2025/01
129

Evaluation of an Osteopathic Manipulative Medicine Curriculum for Pediatric Residents
LeMay, M., Newhall, L.
Academic Pediatrics, 2025/01
130

Resolution of Chronic Coccydynia after Osteopathic Manipulative Treatment: A Case Report.
Valdés, D., Sherrington, M., Waters, L. M.
Osteopathic Family Physician, 2024/9
131

Use of Osteopathic Manipulative Treatment for the Management of Pectus Excavatum: A Single Case Study
Lin, Z. X., Perez, A., Volokitin, M.
Cureus, 2024/5
Free full text
132

Osteopathic Manipulative Treatment During Post-operative Recovery: A Scoping Review
Randall, C. G., Paul, H. A., Lumley, H., Ortega, A., Rowley, J., Brown, B., Mohan, S., Smith, K., Messer, T., Swan, E., Mehra, R. S.
Cureus, 2024/2
Free full text
133

Osteopathic Treatment of a person with Arnold-Chiari Malformation and Syringomyelia: a case report
Cases-Solé, R., Varillas-Delgado, D., Trinidad-Cascudo, F., Pino-Tamayo, M. C., García-Algar, O.
International Journal of Osteopathic Medicine, 2024/12
134

Neuropsychiatric considerations in treating anorexia nervosa patients with osteopathic manipulative medicine: a narrative review
Talebi-Talghian, T., Schulz, P., Huzij, T.
Journal of Osteopathic Medicine, 2024/12
Free full text
135

Treatment of migraine with aura with osteopathic manipulative treatment: a case report with renewed perspectives
Babek, N., Fiechter, C., Caretti, R., Phinney, T.
Journal of Osteopathic Medicine, 2024/12
Free full text
136

Autonomic Nervous System and Viscera-Related Responses to Manual Therapy: A Narrative Overview
Alanazi, M. S., Degenhardt, B., Franklin, G., Jacobson, E., Fritz, S., Kettner, N., Kremen, V., Lipke, L., Reed, W. R.
International Journal of Osteopathic Medicine, 2024/12
Free full text
137

Osteopathic Manual Treatment in Women with Endometriosis: A Scoping Review on Clinical Symptoms, Fertility and Quality of Life
De Strooper, M., De Nys, L., Theys, L., Vermeersch, A., Quaghebeur, J.
International Journal of Osteopathic Medicine, 2024/12
Free full text
138

An appraisal of neuroimmune changes and potential benefits of Osteopathic Manipulative Treatment integration with therapeutic management of Post COVID-19 Condition: a literature review
Senigagliesi, F., Scialla, S., Marasco, M. L.
International Journal of Osteopathic Medicine, 2024/12
139

Effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in individuals with chronic low back pain: A double-blind, randomised placebo-controlled trial
Armbrust, D., Arêas, G. P. T., Fonseca, C. L., Arêas, F. Z. S., Duarte, N. A. C., Santana, S. A. A., Dumont, A. J. L., Neto, H. P., Oliveira, C. S.
Clinical Rehabilitation, 2024/12
140

The Effects of Osteopathic Manipulative Treatment on Arrhythmias: A Double-blind Randomized Controlled Trial in Patients with Cardiac Implantable Electronic Devices
Nikakis, J., Malkov, D., Tale, E., Mangla, M., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
The Journal of Innovations in Cardiac Rhythm Management, 2024/12
Free full text
141

Osteopathische Behandlung radikulärer Schmerzen
(Osteopathic treatment of radicular pain)
Beckmann, U.
Osteopathische Medizin, 2024/12
142

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität – Teil 2: Ergebnisse der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability - Part 2: Results of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/12
143

The Effects of Osteopathic Manipulative Treatment on Climbing Performance
Beyer, B. R., Sheppard, C., Bolig, J., Muvvala, M.
Journal of Osteopathic Medicine, 2024/12
144

Perception of Osteopathic Medicine in a Rural Clinic in Peru
Hovetter, K., Henke, C., Lopes, K., Berger, M., Boswell, K., Kandil, F., Ridpath, L., Waddell, M., Schmidt, D.
Journal of Osteopathic Medicine, 2024/12
145

Improving Sleep with OMT: A Randomized Controlled Trial using Cervical Techniques to Improve Sleep for OMSI
Le, D., Fagen, D., Christensen, S., Jensen, C., Alacron, A., Slife, R., Thakur, C., Teo, R., Spradley, G., Jackson, S, Zamanian, P., Finley, D., Tran, N., Tran, A., Redeman, K., Marble, A., Keane, J., Mangiaracina, M.
Journal of Osteopathic Medicine, 2024/12
146

Exploring Attitudes Towards Osteopathic Medicine in First and Second Year Osteopathic Medical Students Following Osteopathic Manipulative Medicine
Neiman, N., de Jesus, A., Zeller, A. M.
Journal of Osteopathic Medicine, 2024/12
147

The Effect of Osteopathic Manipulative Treatment in Chronic Rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kallat, A., Callahan, M., Kohli, E., Hammes, C., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/12
148

Haltung bewahren. Körperhaltung und OMT
Liem, T.
Naturheilpraxis, 2024/12
149

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2024/12
Free full text
150

Using Osteopathic Manipulative Therapy to Treat Irritable Bowel Syndrome and Severe Refractory Gastroesophageal Reflux Disease: A Case Report
Johnson, T., Jahnke, A. R., Reindel, K.
Cureus, 2024/12
Free full text
151

Остеопатическая коррекция в комплексном лечении пациенток с паническим расстройством
(Osteopathic correction in the complex treatment of patients with panic disorder)
Adamasova, Y. V., Belash, V. O.
Russian Osteopathic Journal, 2024/12
152

Влияние остеопатической коррекции на функциональное состояние спортсменов-волейболистов
(The influence of osteopathic correction on the functional state of volleyball athletes)
Alukaev, M. I., Ahmetzianov, T. Z., Potekhina, Y. P., Nenashkina, E. N., Yanushanets, O. I.
Russian Osteopathic Journal, 2024/12
153

Мануальные медицинские технологии в комплексном лечении и реабилитации пациентов с первичным остеоартритом (обзор литературы)
(Manual medical technologies in complex treatment and rehabilitation of patients with primary osteoarthritis (literature review))
Mokhov, A. D., Belyaeva, I. B., Mokhov, D. E., Gavrilova, T. A.
Russian Osteopathic Journal, 2024/12
154

Возможность применения остеопатической коррекции в комплексном лечении пациента с тиннитусом
(The possibility of using osteopathic correction in the complex treatment of patient with tinnitus)
Revina, M. B.
Russian Osteopathic Journal, 2024/12
155

Остеопатическая коррекция в составе комплексного лечения пациентов с синдромом раздраженного кишечника
(Osteopathic correction as part of complex treatment of patients with irritable bowel syndrome)
Yarysheva, Y. V., Dmitriev, A. A., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/12
156

The Effect of Osteopathic Manipulative Treatment on Acute Post COVID-19 Anosmia and Ageusia Symptoms: A Case Report
Mehra, M., Companion, N., Yao, S. C., Ventimiglia, M.
The AAO Journal, 2024/12
157

Diagnosing and treating upper back pain: insights from New Zealand’s manipulative physiotherapists and osteopaths
Kovanur Sampath, K., Smith, T., Belcher, S., Farrell, G., Fryer, G., Vaughan, B., Moran, R.
Journal of Manual & Manipulative Therapy, 2024/12
158

Osteopathie in der Rehabilitation von Patienten mit rezidivierenden muskuloskeletalen Verletzungen: eine experimentelle Studie
(Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study)
Sankova, M. V., Nikolenko, V. N., Vovkogon, A. D., Oganesyan, M. V., Trishina, A., Babarzai, L., Antonyan, S. Z., Babarzai, F., Pontes-Silva, A., Zharikov, Y. O.
Manuelle Medizin, 2024/11
159

Applying an osteopathic intervention to improve mild to moderate mental health symptoms: a mixed-methods feasibility randomised trial
Hope-Bell, J., Draper-Rodi, J., Edwards, D. J.
Chiropractic & Manual Therapies, 2024/11
Free full text
160

Pelvic joint stiffness and fear of falling in patients over 75 years of age: a prospective cohort study of 100 patients
Laizeau, C., Jochmans, S., Aufaure, S.
Journal of Osteopathic Medicine, 2024/11
Free full text
161

Efficacy of manual therapy for sacroiliac joint pain syndrome: a systematic review and meta-analysis of randomized controlled trials
Trager, R. J., Baumann, A. N., Rogers, H., Tidd, J., Orellana, K., Preston, G., Baldwin, K.
Journal of Manual & Manipulative Therapy, 2024/11
162

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text
163

A systematic review of manual therapy modalities and anxiety
West, K. L., Huzij, T.
Journal of Osteopathic Medicine, 2024/11
Free full text
164

Is Osteopathic Manipulative Treatment Clinically Superior to Sham or Placebo for Patients with Neck or Low-Back Pain? A Systematic Review with Meta-Analysis
Ceballos-Laita, L., Jiménez-Del-Barrio, S., Carrasco-Uribarren, A., Medrano-de-la-Fuente, R., Robles-Pérez, R., Ernst, E.
Diseases, 2024/11
165

Management of Medial Tibial Stress Syndrome with osteopathic manipulative treatment in a basketball player: Case Report
Colli, D., Tarantino, A. G., Bergna, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2024/10
166

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10
167

Effect of manual manipulation on mechanical gait parameters
Yanuck, S. B., Fox, S. K., Harting, B. R., Motyka, T. M.
Journal of Osteopathic Medicine, 2024/10
168

Efficacy of osteopathic manipulative treatment (93.6, ICD-9) - systematic review
Dwornik, M., Puszczałowska-Lizis, E., Wójcik, M., Szajkowski, S., Graczykowski, M., Szymański, D., Marszałek, S.
Medical Studies/Studia Medyczne, 2024/10
Free full text
169

Effects of Osteopathic Manipulative Treatment on Rare Diseases: A Case Report on Gordon Syndrome
Johnson, T., Waters, H. B.
Cureus, 2024/10
Free full text
170

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2024/10
171

Effectiveness of Osteopathic Treatment in Adults with Short Hamstring Syndrome: A Systematic Review
Ogando-Berea, H., Leirós-Rodríguez, R., Hernandez-Lucas, P., Rodríguez-González, Ó
Journal of Clinical Medicine, 2024/10
Free full text
172

Novel Diagnosis and Treatment for Neurogenic Thoracic Outlet Syndrome
Tafler, L., Borkowski, S., Javaid, G., Gandolfo, D., Kleyn, D.
Cureus, 2024/10
Free full text
173

Elite Track and Field Athletes’ Perspective and Experiences of Osteopathic Treatments: A Descriptive Phenomenological Study
Cella, M., Consorti, G., Odorisio, L., Fard, R.
Journal of Bodywork and Movement Therapies, 2024/10
174

Effect of Standard Physical Exercises for Non-specific Low Back Pain Combined with Multimodal Osteopathy Treatment on Pain Intensity and Functional Capacity: A Study Protocol for a Randomized Controlled Trial
Ferreira, C. R., Hort, J. P., Bezerra, L. A., Neto, H. P., Biasotto-Gonzalez, D. A., Politti, F.
Journal of Advances in Medicine and Medical Research, 2024/10
Free full text
175

Conservative, physical and surgical interventions for managing faecal incontinence and constipation in adults with central neurological diseases
Todd, C. L., Johnson, E. E., Stewart, F., Wallace, S. A., Bryant, A., Woodward, S., Norton, C.
Cochrane Database of Systematic Reviews, 2024/10
176

An Osteopathic Approach to Foot Drop: A Case Report of Posterior Fibular Head
Volokitin, M., Libman, A. E., Milani, S., Banihashem, M., Ayon, S.
Cureus, 2024/10
Free full text
177

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10
178

Primary and secondary prevention of musculoskeletal pain and disability in chiropractic, osteopathy, and physiotherapy: A scoping review
Draper-Rodi, J., Delion, T., MacMillan, A., Storey, A. I., Spadaccini, J., Jebi, W., Thomson, O. P., Hohenschurz-Schmidt, D.
International Journal of Osteopathic Medicine, 2024/09
Free full text
179

Die Bedeutung des osteopathischen Behandelns für Kinder nach einer Frühgeburt: Eine Befragung von Kinderosteopath*innen
(The importance of osteopathic treatment for children after premature birth: a survey of pediatric osteopaths)
Hackner, L., Belz, S., Esch, S.
Osteopathische Medizin, 2024/09
Free full text
180

Efficacy of ankle mobilization on postural control in older people: A systematic review with meta-analysis
Hernández-Guillén, D., García-Gomariz, C., Roig-Casasús, S., Díaz-Díaz, B., Domínguez-Navarro, F., Pérez-Maletzki, J., Blasco, J.M.
International Journal of Osteopathic Medicine, 2024/09
Free full text
181

Heilungshindernis bei klaffender Tube – ein Fallbericht
(Obstacle to healing a patulous Eustachian tube - a case report)
Kaltenbrunner, U.
Osteopathische Medizin, 2024/09
Free full text
182

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität: Teil 1 – Ziele, Material und Methoden der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability: Part 1 - Objectives, material and methods of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/09
Free full text
183

ADHS bei Erwachsenen in der osteopathischen Praxis
(ADHD in adults in the osteopathic practice)
Plathner, M.
Osteopathische Medizin, 2024/09
Free full text
184

Osteopathy: A potential ally against anorexia?
Mattatia, J.
Advances in Integrative Medicine, 2024/09
185

Endometriose
(Endometriosis)
Engel-Schulmeyer, A., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
186

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
187

Behandlung des männlichen chronischen Beckenschmerzsyndroms (CBSS)
(Treatment of male chronic pelvic pain syndrome (CPPS))
Switters, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
188

Positional plagiocephaly: results of the osteopathic treatment of 424 infants. An observational retrospective cohort study
Panza, R., Piarulli, F., Rizzo, V., Schettini, F., Baldassarre, M. E., Di Lorenzo, A., Tafuri, S., Laforgia, N.
Italian Journal of Pediatrics, 2024/09
Free full text
189

Osteopathic Approach to Proximal Hamstring Tendinopathy-related Sciatic Nerve Entrapment (PHTrSNE): Case Report
Hermoso, J., Bailey, G., Bhatti, K., Sneed, J.
The AAO Journal, 2024/09
190

Osteopathic Considerations in the Medical Treatment of a Patient with COVID-Related Respiratory Distress
Yang, Y., Carnes, M., Kingery, J., Stiles, E.
The AAO Journal, 2024/09
191

Оценка клинической результативности остеопатических техник дренирования желчного пузыря
(Evaluation of the clinical effectiveness of osteopathic gallbladder drainage techniques)
Belash, V. O., Zavadsky, E. Y., Zueva, A. I.
Russian Osteopathic Journal, 2024/09
192

Влияние однократной процедуры остеопатической коррекции на регуляторные процессы организма недоношенных детей (пилотное исследование)
(Influence of a single osteopathic procedure on the regulatory processes of the body of premature infants (pilot study))
Belyaev, A. F., Yurchenko, M. S., Kharkovskaya, T. S., Kurleeva, T. Y., Akhtanina, E. A.
Russian Osteopathic Journal, 2024/09
193

Chronic Rhinosinusitis Management: A Narrative Review Comparing Interventional Treatment With Osteopathic Manipulation
Klover, C. R., Gorantla, V. R.
Cureus, 2024/09
Free full text
194

„Wie der Ast gebogen wird, so wächst der Baum“
Teichmann, P.
Skeptiker, 2024/09
195

Available Treatments and Adjunctive Therapies for Polycystic Ovarian Syndrome (PCOS) Patients of Reproductive Age: A Scoping Review
Cochran, L., Nadolny, R., Garcia, K., Kluglein, K. A., Yagoda, A., Gandhi, P., Dressel, J., Prol, B., Peralta, R., Shipp, A., Costin, J. M.
Cureus, 2024/09
Free full text
196

Response to “Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection“
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2024/09
Free full text
197

Investigating the safety and feasibility of osteopathic manipulative medicine in hospitalized children and adolescent young adults with cancer
Belsky, J. A., Brown, A. M.
Journal of Osteopathic Medicine, 2024/09
Free full text
198

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2024/09
Free full text
199

Trends in Utilization and Cost of Nonpharmacological Pain Therapies in the United States Under Medicare Part B, 2000-2022
Whedon, J., Zakhary, G.
Journal of Integrative and Complementary Medicine, 2024/09
200

Data-driven analysis of whole-brain intrinsic connectivity in patients with chronic low back pain undergoing osteopathic manipulative treatment
Tomaiuolo, F., Cerritelli, F., Delli Pizzi, S., Sestieri, C., Paolucci, T., Chiacchiaretta, P., Sensi, S. L., Ferretti, A.
NeuroImage: Clinical, 2024/08
Free full text
201

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text
202

A Natural Approach to Bell's Palsy: An Osteopathic Treatment Option
Schneider, N., Shih, S., Rundquist, L., Llanio, L., Kurian, A., Ring, A., Barry, P.
Cureus, 2024/08
Free full text
203

A Review on Osteopathic Manipulation in Patients With Headache
Sharath, H. V., Nadipena, P. T., Qureshi, M. I., Phansopkar, P.
Cureus, 2024/08
Free full text
204

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text
205

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08
206

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text
207

The effect of osteopathic manipulative treatment on quality of life in patients with cardiac implantable electronic devices
Nikakis, J., Tale, E., Malkov, D., Arora, U. S., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2024/08
Free full text
208

Post-operative osteopathic manipulative treatment of Morel-Lavallee syndrome assessed using infrared thermal imaging: A case report
Maillot, C., Riquet, D., Stubbe, L., Bodnar, J.L., Houel, N.
Journal of Bodywork and Movement Therapies, 2024/07
Free full text
209

The short- and long-term effect of osteopathic manipulative treatment on pain, and psychosocial factors in adults with chronic low back pain
Nicodemus, C. L., Epstein, J., Huebner, M., DeCicco, B., Shaik, M.
Journal of Osteopathic Medicine, 2024/07
Free full text
210

How completely are randomized controlled trials of non-pharmacological interventions following concussion reported? A systematic review
van Ierssel, J. J., Galea, O., Holte, K., Luszawski, C., Jenkins, E., O', Neil, J., Emery, C. A., Mannix, R., Schneider, K., Yeates, K. O., Zemek, R.
Journal of Sport and Health Science, 2024/07
Free full text
211

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text
212

Interoceptive bodily awareness in patients seeking pain relief with osteopathic manipulative treatment: an observational cohort pilot study
Emmet, D. K., Davis, G., Pierce-Talsma, S., Shubrook, J. H., Mehling, W.
Journal of Osteopathic Medicine, 2024/07
Free full text
213

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07
214

Kraft- und Spannungsübertragung in der unteren Extremität
(Transmission of force and tension in the lower extremity)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
215

The Effects of Osteopathic Manipulative Treatment on Brain Activity: A Scoping Review of MRI and EEG Studies
Bonanno, M., Papa, G. A., Ruffoni, P., Catalioto, E., De Luca, R., Maggio, M. G., Calabrò, R. S.
Healthcare, 2024/07
Free full text
216

Alternative Therapies for Ankyloglossia-Associated Breastfeeding Challenges: A Systematic Review
Chowdhury, R., Khoury, S., Leroux, J., Alsayegh, R., Lawlor, C. M., Graham, M. E.
Breastfeeding Medicine, 2024/07
217

Osteopathie bei Gliedergürtelmuskeldystrophie Miyoshi 3
(The effect of osteopathy for limb-girdle muscular dystrophy Miyoshi 3)
Ritter, C. I.
unpublished MSc thesis, 2024/07
218

A 25-year-old woman with 7 years of intractable hiccups treated with OMT – A case report
Bowman, D. E., Pohlod, C.
International Journal of Osteopathic Medicine, 2024/06
219

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text
220

Responsiveness to osteopathic manipulative treatments in people with non-specific low back pain: A secondary analysis of the LC-OSTEO trial
Rören, A., Yagappa, D. M., Zegarra-Parodi, R., Fabre, L., Krief, G., Daste, C., Lefèvre-Colau, M. M., Rannou, F., Nguyen, C.
Annals of Physical and Rehabilitation Medicine, 2024/06
221

Effects of osteopathic manipulative therapy on recurrent pelvic pain and dyspareunia in women after surgery for endometriosis: a retrospective study
Alboni, C., Melegari, S., Camacho Mattos, L., Farulla, A.
Minerva Obstetrics and Gynecology, 2024/06
222

Reported biological effects following Osteopathic Manipulative Treatment: A comprehensive mapping review
Dal Farra, F., Bergna, A., Lunghi, C., Bruini, I., Galli, M., Vismara, L., Tramontano, M.
Complementary Therapies in Medicine, 2024/06
223

Effects of Osteopathic Manipulative Treatment (OMT) on the Thoracic Duct via Ultrasound Imaging
Atkinson, E., Kawachi, S., Kozar, A. J.
The AAO Journal, 2024/06
224

From finger to breast: OMT helps latch
Barr, J., O'Donnell, A.
The AAO Journal, 2024/06
225

Osteopathic Manipulative Treatment, a Novel Adjunct in Sickle Cell Disease Care: Interim Safety and Feasibility Analysis
Brown, A., Eyassu, E., Hoffmann, L., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
The AAO Journal, 2024/06
226

The Role of Osteopathic Structural Findings in Meningitis
Cecil, E., Burke, D.
The AAO Journal, 2024/06
227

Efficacy of Osteopathic Manipulative Treatment in Post-Stroke Recovery Patients
Dalton, D., Walker, A., Vu, P., Medina, C.
The AAO Journal, 2024/06
228

OMT Improves Diaphragm Range of Motion on Ultrasound Imaging
DiSabato, X., Atkinson, E., Kozar, A. J., Robinson, L., Dixon, E.
The AAO Journal, 2024/06
229

OMT in Headache Management: Systematic Review and Meta-Analysis Protocol
Gibson, E., Will, M., Garcia, C. J., Johnson, R., Kirsch, J. R., Spencer, D. V., Wang, M. Y.F., Rehman, Y., Snider, K. T.
The AAO Journal, 2024/06
230

Остеопатическая коррекция в комплексном лечении женщин репродуктивного возраста с пролапсом тазовых органов
(Osteopathic correction in the complex treatment of women of reproductive age with pelvic organ prolapse)
Bakanova, A. R., Lebedev, D. S., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/06
231

The role of diaphragmatic motion in peritoneal lymphatic absorption examined in case of splenic rupture
King, C., Ettlinger, H.
The AAO Journal, 2024/06
232

The Role of Osteopathic Manipulative Treatment in a Case of Pediatric Craniosynostosis
Kurup, D., Ettlinger, H.
The AAO Journal, 2024/06
233

Синдром короткой ноги в клинической практике
(Short leg syndrome in clinical practice)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06
234

More Than a Pain in the Butt: Response to OMT as a diagnostic aid to identify arterial gluteal claudication
Mather, M., Schaefer, M.
The AAO Journal, 2024/06
235

Evaluating the effects of Osteopathic Manipulative Treatments in Pregnancy: Comparing the difference between outpatient versus inpatient treatments on incidence rates of C sections
Politi Gonzalez, C., Torres, J.
The AAO Journal, 2024/06
236

The case for Frequency Specific Microcurent in combination therapy of an acute forearm injury
Shah, A., Johnson, A.
The AAO Journal, 2024/06
237

Динамические стили остеопатов на основе оценки биоэлектрической активности мозга с применением метода математического анализа мультивариативной структурной функции первого порядка
(Dynamic styles of osteopaths based on assessment of the bioelectrical activity of the brain using the method of mathematical analysis of a first-order multivariate structural function)
Piskunova, G. E., Trifonov, M. I., Panasevich, E. A., Belyaev, A. F.
Russian Osteopathic Journal, 2024/06
238

Keeping the MonSter Under Control: The Role of Osteopathic Manipulative Therapy (OMT) in Characterization and Management of Chronic Pain in Multiple Sclerosis
Song, Y. J., Faruque, R., Hall, T., Waddington, M.
The AAO Journal, 2024/06
239

Seize the Dura: An Osteopathic Approach to Postictal Delirium
Vijayakar, R., Obialo, S., Nixon, K.
The AAO Journal, 2024/06
240

Hat die osteopathische Behandlung einen Einfluss auf persistierende Symptome unter Hormonersatztherapie bei Frauen mit einer Hashimoto-Thyreoiditis? Prä-Post-Studie.
(Does individual osteopathic treatment influence persistent symptoms under hormone replacement therapy in women with Hashimoto´s thyreoiditis? A pre-post study )
Kriehmig, S., Vetter, A., Rüdrich, K.
Unpublished D.O. thesis, 2024/06
241

An Osteopathic Approach to Prolonged Surgical Scar and Epidural Site Pain after Cesarean Section: A Case Study
Whitaker, Z., Gailius, G.
The AAO Journal, 2024/06
242

Die osteopathische Behandlung von Patienten mit idiopathischem Parkinson-Syndrom. Prä-Post-Studie.
(Does individual osteopathic treatment influence Parkinson´s disease-specific health related quality of life in patients suffering from idiopathic Parkinson´s disease?
Schellhase, M., Schröter, C.
Unpublished D.O. thesis, 2024/06
243

Workin’ 9 to 5, but Now Can Thrive: Chronic Headache Diagnosed and Treated with OMT
Bernett, A. M., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06
244

Piriformis or Not Piriformis? The Impact of OMT on Buttock and Hip Pain: A Case Report
Blankenbaker, J., Ural, E.
The AAO Journal, 2024/06
245

Osteopathic Management of Bertolotti Syndrome
Bowen, A., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06
246

Resolution of Notalgia Paresthetica Symptoms following Osteopathic Manipulative Treatment (OMT): A Case Report
Bressler, K., Macmillan, G., Mancini, J., Yao, S. C., Papadopoulos, D., Abu-Sbaih, R.
The AAO Journal, 2024/06
247

Invasive Beatmung und prolongiertes Weaning: Auswirkungen osteopathischer Techniksequenzen
(Invasive ventilation and prolonged weaning. Effects of osteopathic sequences of techniques)
Boehme, A., Thönnessen, P., Ibel, R.
Osteopathische Medizin, 2024/06
Free full text
248

Oh Snap! Osteopathic Treatment of Tendon Rupture with Link to Long Term Statin Use
Carpinelli, S., Richie, C.
The AAO Journal, 2024/06
249

Response to Osteopathic Manipulative Treatment in a Newborn with Breastfeeding Difficulties: A Case Report
Coxon, J., Gannon, T. M.
The AAO Journal, 2024/06
250

Comparison of the effects of abdominal massage and osteopathic manipulative treatment home program on constipation in children with cerebral palsy
Chatip, A. T., Acar, G., Akçay, A. A.
JGH Open, 2024/06
Free full text
251

Osteopathic Management of Chronic Pain Following Bilateral Periacetabular Osteotomy in Developmental Hip Dysplasia
Edgar, T., Heller, G. R., Hutson, M., Melin, D., Bardowell, A.
The AAO Journal, 2024/06
252

Manual Therapy Interventions in Patients With Chronic Obstructive Pulmonary Disease: A Comprehensive Narrative Review
Chilhate, P. K., Lalwani, L.
Cureus, 2024/06
Free full text
253

“I walk funny and I don’t know why,” Osteopathic manipulative treatment for an adult female with congenital bilateral Femoral Neck Anteversion (FNA)
Fredrickson, T., Broussard, D., Waters, H.
The AAO Journal, 2024/06
254

Osteopathie, was bist du?: Homo- und Heterogenität zwischen osteopathischen und manualmedizinischen Techniken
(Osteopathy, what are you?: Homogeneity and heterogeneity between osteopathic and manual medicine techniques)
Engel, M.
Osteopathische Medizin, 2024/06
Free full text
255

Stagnating the Symptomatic Progression of Primary Lateral Sclerosis
Geyer-Roberts, E., Desai, B., Perez, J., Grote, J., Helderlein, P., Posey, A.
The AAO Journal, 2024/06
256

Development of an Osteopathic Manipulative Treatment Clinician-Parent Home Care Education Intervention for Children with Otitis Media
Krzykwa, E., Pietrantoni, D., Waters, H.
The AAO Journal, 2024/06
257

Transforming Fibromyalgia Care: An Osteopathic Route to Improving Quality of Life
Kurian, A., Schneider, N., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06
258

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06
259

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06
260

A case report of improvement of isolated abducens nerve palsy following osteopathic manipulative treatment
Maddie, N., Keys, J.
The AAO Journal, 2024/06
261

Effects of OMT on Blood Glucose and Insulin Sensitivity in Adult Male Rats
Petrillo, G., Staudt, M., Lobo, S., Cai, W., Keys, J.
The AAO Journal, 2024/06
262

OMT in the 21st century: current use of technologies in manual therapy education and opportunities for innovation
Pietrantoni, D., Krzykwa, E., Broussard, D., Fredrickson, T., Waters, H., Mehra, R.
The AAO Journal, 2024/06
263

Osteopathische Behandlung neuropathischer Nacken- und Beckenbodenschmerzen
(Osteopathic treatment of neuropathic neck and pelvic floor pain)
Peuker, E.
Osteopathische Medizin, 2024/06
Free full text
264

Osteopathic Manipulative Treatment in Occipital Neuralgia
Ring, A., Llanio, L., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06
265

An Osteopathic Approach to Cervicogenic Vertigo
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2024/06
266

Severe Eczema and Hair Growth Improvements with Osteopathic Manipulative Treatment (OMT) in Pediatric Patient: A Case Study
Sanchez, E., Papadopoulos, D., Yao, S. C., Abu-Sbaih, R.
The AAO Journal, 2024/06
267

An Osteopathic Approach to Temporomandibular Dysfunction Secondary to A Motor Vehicle Accident
Schneider, N., Kurian, A., Widboom, N., Qureshi, Y.
The AAO Journal, 2024/06
268

An Osteopathic Approach to Eyelid Myokymia
Shih, S., Rundquist, L., Qureshi, Y.
The AAO Journal, 2024/06
269

Effect of Osteopathic Manipulative Treatment (OMT) for Symptomatic Headache Relief in Long-COVID Patient: A Case Report
Unser, K., Thomas, A., Cornwell, S., Yao, S. C., Keys, J.
The AAO Journal, 2024/06
270

Osteopathic Manipulative Medicine and Disorders: An Overview of Peer-Reviewed Publications 2018-2022
White, C., Xie, Y., Bigham, J., Stanczak, A., Ninan, D., Hu, C. A.
Cureus, 2024/06
Free full text
271

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06
272

Reducing Blood Pressure: Use of Osteopathic Manipulative Treatment (OMT) as Adjunct Therapy in Treating Uncontrolled Hypertension
Voas, A., Wirth, K., Delaney, C., Li, V., Figueroa, J. S.
The AAO Journal, 2024/06
273

Case Study: The Effect of Osteopathic Manipulation on Diabetic Gastroparesis
Yazdi, S. A., Tucker, D., Hwang, G., Majeed, A., Hsubrook, J. H., Penq, N.
The AAO Journal, 2024/06
274

Berücksichtigung sozialer Faktoren in der Patient*innen-Osteopath*innen-Beziehung Eine qualitative Interviewstudie vor der Theorie des Enaktivismus
Mayrl, E.
Unpublished MSc thesis, 2024/06
275

Increased Alertness in Comatose Patient After Osteopathic Manipulative Treatment: A Case Report
Garcia, A. E., Kay, K., Perera, M. X., Martinez, E. S., Onyi, S., Nourani, B., Loveless, B.
The AAO Journal, 2024/06
276

An Alternative Approach to Median Arcuate Ligament Syndrome
Geyer-Roberts, E., Wallace-Ross, J.
The AAO Journal, 2024/06
277

Successful Treatment using OMT for Chronic GERD in a Pediatric Patient
Shams, S., Chohan, M. M., King, A.
The AAO Journal, 2024/06
278

Osteopathic Approach to the Voice
Surve, S.
The AAO Journal, 2024/06
279

Post-surgical Median Arcuate Ligament Syndrome (MALS) Symptom Exacerbation Treated With Osteopathic Manipulative Treatment (OMT): A Case Report
Volokitin, M., Bergman, A.
Cureus, 2024/06
Free full text
280

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic low back pain: a single-blinded randomized controlled trial
Popovich, J. M., Cholewicki, J., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan, A.
Journal of Osteopathic Medicine, 2024/05
Free full text
281

Immediate Effects of Integrative Health and Medicine Modalities Among Outpatients With Moderate-To-Severe Symptoms
Rodgers-Melnick, S. N., Srinivasan, R., Rivard, R. L., Adan, F., Dusek, J. A.
Global Advances in Integrative Medicine and Health, 2024/05
Free full text
282

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05
283

Efficacy of Osteopathic Manipulative Treatment for Pain Reduction in Patients With Patellofemoral Pain Syndrome: A Meta-Analysis of Randomized Controlled Trials
Delgadillo, B. E., Bui, A., Debski, A. M., Miller, B., Wu, S. S.
Cureus, 2024/05
Free full text
284

The Effects of Osteopathic Manipulative Treatment (OMT) on Postoperative Length of Stay: A Meta-Analysis
Henwood, L., Le Donne, M. E., Vaughn, A., Kamil, S., Harrington, A., Scott, R.
Cureus, 2024/05
Free full text
285

Effects of Osteopathic Manipulative Treatment Alone or in Combination With Respiratory Training on Chest Wall Expansion, Functional Mobility, and Dyspnea Level in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
American Journal of Respiratory and Critical Care Medicine, 2024/05
286

The Efficacy of Early Osteopathic Therapy in Restoring Proper Sucking in Breastfed Infants: Preliminary Findings from a Pilot Study
Parodi, A., Ruffa, R., De Felice, V., Sartini, M., Cristina, M. L., Martino, B., Bianco, F., Di Stefano, R., Mazzella, M.
Healthcare, 2024/05
Free full text
287

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05
288

Implementing paper-based patient-reported outcome collection within outpatient integrative health and medicine
Srinivasan, R., Rodgers-Melnick, S. N., Rivard, R. L., Kaiser, C., Vincent, D., Adan, F., Dusek, J. A.
PLoS One, 2024/05
Free full text
289

Multi-modal Assessment of Myofascial Trigger Point Response to Osteopathic Manipulation in the Anterior Forearm
Pedapati, C.
Unpublished PhD thesis, 2024/05
290

Manual Therapy of Dysphagia in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
De Marchi, I., Buffone, F., Mauro, A., Bruini, I., Vismara, L.
Medicina, 2024/05
Free full text
291

Effect of osteopathic manipulative treatment and Bio-Electro-Magnetic Energy Regulation (BEMER) therapy on generalized musculoskeletal neck pain in adults
Palmer, G. M., Dominick, N., Kane, M., Bawek, S., Burch, B., Sanders, T., Phrathep, D., Myers, N., Lorenzo, S.
Journal of Osteopathic Medicine, 2024/04
Free full text
292

Effect of manual osteopathic techniques on the autonomic nervous system, respiratory system function and head-cervical-shoulder complex—a systematic review
Stępnik, J., Czaprowski, D., Kędra, A.
Frontiers in Medicine, 2024/04
Free full text
293

Lumbar Spinal Stenosis: Diagnosis and Management
Webb, C. W., Aguirre, K., Seidenberg, P. H.
American Family Physician, 2024/04
294

Overview of Treatment Options for Mild Traumatic Brain Injury: A Literature Review
Patel, H., Polam, S., Joseph, R.
Cureus, 2024/04
Free full text
295

Quelle est la place de la respiration du·de la patient·e lors d’une consultation ostéopathique chez les ostéopathes pratiquant en Suisse : une étude qualitative phénoménologique
(What is the place of the patient's breathing during an osteopathic consultation among osteopaths practicing in Switzerland: a phenomenological qualitative study?)
Gremaud, L., Guggisberg, F., Marti, J., Morisetti, L.
Unpublished MSc thesis, 2024/04
Free full text
296

How do Australian osteopaths manage migraines? Outcomes from a national practice-based research network
Fleischmann, M., Vaughan, B., Campbell, C., Ekberg, J., Evans, M., Green, M., Ong, A., Pitrone, G., Lane, R., Adams, J.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text
297

A framework for the interpretation of heart rate variability applied to transcutaneous auricular vagus nerve stimulation and osteopathic manipulation
Kania, A., Roufail, J., Prokop, J., Stauss, H. M.
Physiological Reports, 2024/03
Free full text
298

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03
299

Остеопатическая коррекция в комплексной реабилитации детей, перенесших кохлеарную имплантацию
(Osteopathic correction in complex rehabilitation of children who have undergone cochlear implantation)
Belash, V. O., Revina, M. B.
Russian Osteopathic Journal, 2024/03
300

The effectiveness of manipulation in combination with exercise for patients with coccydynia: Six months follow-up of a randomized controlled trial
Tufekci, O., Yilmaz, K., Gercek, H., Unuvar, B. S.
International Journal of Osteopathic Medicine, 2024/03
301

Остеопатическая коррекция в комплексной терапии детей с астигматизмом
(Osteopathic correction in the complex therapy of children with astigmatism)
Kiryanova, E. V., Gurichev, A. A.
Russian Osteopathic Journal, 2024/03
302

Реабилитация после тяжелого течения гаффской болезни
(Rehabilitation after severe gaff disease)
Lebedeva, D. I., Turovinina, E. F., Marchenko, A. N., Aptekar, I. A., Raspopova, Y. I., Suvorov, A. Y., Bychenko, S. M.
Russian Osteopathic Journal, 2024/03
303

Osteopathic Approach to a Patient with Recurring Low Back Pain following OMT results in Diagnosis of Underlying Gynecological Etiology: A Case Report
Berkowitz, M. R.
The AAO Journal, 2024/03
Free full text
304

The Use of Osteopathic Manipulative Treatment for a Case of Cervical Radiculopathy
Heineman, K.
The AAO Journal, 2024/03
Free full text
305

Влияние комплексного лечения с включением остеопатической коррекции на интенсивность боли и качество жизни пациентов с хроническим тонзиллитом
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushkin, S. A.
Russian Osteopathic Journal, 2024/03
306

An osteopathic approach for a patient with sequela after treatment for a cheek squamous cell carcinoma
Wehner, B. L., Calla, R.
The AAO Journal, 2024/03
Free full text
307

The Effects of Patient-specific Sequenced Osteopathic Manipulative Treatment by AGR on Quality of Life
Yang, Y., Stiles, E., Kingery, J.
The AAO Journal, 2024/03
308

Osteopathic techniques and manual rotation of the fetal head successfully resolve mechanical dystocia
Miletić, A. I., Habek, D., Medić, F.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/03
309

Fallbericht einer psychosomatischen Osteopathie
(Case report of psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2024/03
Free full text
310

Osteopathische Behandlungsmöglichkeiten chronisch entzündlicher Darmerkrankungen: Eine qualitative Analyse von Interviews
(Osteopathic treatment options for chronic inflammatory bowel disease: A qualitative analysis of interviews)
Pestonit, J. F., Hesse, T.
Osteopathische Medizin, 2024/03
Free full text
311

Osteopathisch-manipulative Behandlung bei herzchirurgischen Patient*innen: Eine systematische Übersicht
(Osteopathic-manipulative treatment in cardiac surgery patients: A systematic review)
Rorris, F.P., Skouteli, E.A. T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
Osteopathische Medizin, 2024/03
Free full text
312

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
313

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
314

A Survey Assessment of Neurosurgeons’ Interest in Osteopathic Medicine and Its Integration Into Their Practice.
Kolmetzky, D W, Gooder, D B, Polly, E S, Glisan, S. N., Al-Atrache, Z., Badger, C. A., Yocom, S. S., Turtz, A. R., Allison, D. L.
Cureus, 2024/03
315

Osteopathic manipulative treatment for pediatric Long-COVID headache: A case report
Danto, S. E., Danto, J. B.
International Journal of Osteopathic Medicine, 2024/03
316

Utility of Osteopathic Manipulation Treatment in MTBI Patients With PPCS and Cervicogenic & Vestibuloocular Profiles
Chen, A., Gross, A., Marshall, J., Anilkumar, A., Patel, N., Maes, L., Mulumba, D., Dusenberry, B.
Clinical Journal of Sport Medicine, 2024/03
317

Investigation of Immediate Effects of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S., Matthias, A., Roush, A., Wilson, H., Nicholas, J., Edwards, C., Mangum, K., Pickett, B.
Clinical Journal of Sport Medicine, 2024/03
318

Meta-epidemiologic review: Blinding and sham treatment in clinical trial design for osteopathic manipulative treatment research
Irving, R., Schmidt, E., Stone, M., Fleming, R. K., Xie, J. Y.
International Journal of Osteopathic Medicine, 2024/03
319

Effect of Osteopathic Manipulation in an Autism Spectrum Child With Speech Impairment and Attention Deficit: A Case Report
Sharath, H. V., Raghuveer, R., Qureshi, M. I., Warghat, P. A., Desai, S., Brahmane, N. A.
Cureus, 2024/03
Free full text
320

Effect of physiotherapy on infertility treatment in polycystic ovary syndrome patients
Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jędrzejczyk, S., Jerzak, M., Jerzak, M.
Przegląd Menopauzalny, 2024/03
321

Osteopathic manipulative treatment for autism spectrum disorder: Three case reports
Wolf, K., Widjaja, F., O'Keefe, W., Chen, Y., Breard, M., Parenteau, C., Keys, J., Riemer, R., Hendren, R. L.
International Journal of Osteopathic Medicine, 2024/03
322

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03
323

Effects of osteopathic manipulative treatment on maternal-fetal hemodynamics in third trimester pregnant women: A prospective study
Arruda Correia, M. L., Peixoto Filho, F. M., Gomes Júnior, S. C., de Jesus, G. R.
PLoS One, 2024/03
Free full text
324

Potential mechanisms for osteopathic manipulative treatment to alleviate migraine-like pain in female rats
Byrd, K., Lund, M., Pan, Y., Chung, B. H., Child, K., Fowler, D., Burns-Martin, J., Sanikommu, M., Henderson, H., Gregory, C., Fleming, R. K., Xie, J. Y.
Frontiers in Pain Research, 2024/02
Free full text
325

Osteopathic approach as an additional therapy of infertility in women with PCOS
Jędrzejczyk, S., Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jerzak, M., Jerzak, M.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/02
326

Osteopathic Manipulative Treatment for Chronic Neck Stiffness After a Motor Vehicle Collision: A Case Report
Jost, J. M., Stoll, V. K., Waters, H. B.
Cureus, 2024/02
Free full text
327

The endogenous oxytocin after manipulative osteopathic treatment in full-term pregnant women
Ragusa, A., Svelato, A., Fogolari, M., Ficarola, F., Plotti, F., De Luca, C., D'Avino, S., Davini, F., De Cesaris, M., Messina, G., Bertolini, A., Marci, R., Angeletti, S., Angioli, R., Terranova, C.
European Review for Medical and Pharmacological Sciences, 2024/02
328

Application Of Osteopathic Treatment for Non-Pain–Related Discomforts of Pregnancy: A Literature Review
Gomperts, J., Carroll, L., Powers, B., Rodriguez, A.
Osteopathic Family Physician, 2024/02
329

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02
330

Osteopathic Approach in the Stimulation of the Endocannabinoid System: A Case Report
Buonomini, C., Bonetti, O., Novelli, E.
Cureus, 2024/02
331

Transrectal osteopathic manipulation treatment for chronic coccydynia: feasibility, acceptability and patient-oriented outcomes in a quality improvement project
Nourani, B., Norton, D., Kuchera, W., Rabago, D.
Journal of Osteopathic Medicine, 2024/02
Free full text
332

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text
333

Interdisciplinary Approach to Orthodontic Treatment Involving an Osteopath and a Dentist (Protocol)
Aptekar, I. A., Abramova, E. V., Postnikov, M. A., Kopetsky, I. S., Eremin, D. A., Postnikova, E. M., Poluianova, E. B., Aptekar, V. I., Muravyov, I. O.
Bulletin of Russian State Medical University, 2024/02
Free full text
334

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text
335

Osteopathic Manipulative Treatment in Dysmenorrhea: A Systematic Review
Bonner, P. E., Paul, H. A., Mehra, R. S.
Cureus, 2024/01
Free full text
336

Wie wirksam ist die osteopathische Behandlung von Kindern?
(How effective is osteopathic treatment for children?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
337

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
338

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
339

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
340

Integrating Osteopathic Principles for Enhanced Dermatological Outcomes: A Literature Review
Ventura, N., Soti, V.
Cureus, 2024/01
Free full text
341

Peut-on protocoliser l’ostéopathie? Doit-on toujours manipuler L5 en cas de sciatalgie type L5?
(Could Osteopathy Be Protocolized? Should We always Manipulate L5 in Case of L5 Sciatica?)
Bœuf, M., Brun, L.
Douleur et Analgesie, 2024/01
342

Assessment of Long-term Effects of Adding Osteopathic Manipulative Treatment to Neck Exercises for Individuals With Non-specific Chronic Neck Pain: A Randomized Trial
Groisman, S., da Silva, L., Sanches, T., Rocha, C., Malysz, T., Jotz, G.
Journal of Chiropractic Medicine, 2023/12
343

„Alles im Griff” – Osteopathischer Universalgriff für das Kniegelenk
(“Everything under control“ - Osteopathic universal grip for the knee joint)
Engel, M.
Osteopathische Medizin, 2023/12
344

Investigating the current published literature where osteopathic manual therapy is used as an intervention: A scoping review
Ryan, H., Friedlander, T., Anderson, H., Mason, J.
International Journal of Osteopathic Medicine, 2023/12
345

Osteopathic Manipulative Treatment for Chronic Bronchiectasis: A Case Report
Abend, D., Powell, L., Sivanandam, A., Nayar, R.
Osteopathic Family Physician, 2023/12
346

An Osteopathic Approach to Urinary Incontinence Including Biopsychosocial Aspects and Multiple Modalities for a Holistic Approach to Optimize Ongoing Care
Trivelas, N., Slaughter, K., Zaremski, K., Kirila, C.
Osteopathic Family Physician, 2023/12
347

Применение остеопатической коррекции в терапии пациентов с седалищной нейропатией
(The use of osteopathic correction in the treatment of patients with sciatic neuropathy)
Belash, V. O., Frolov, V. A.
Russian Osteopathic Journal, 2023/12
Free full text
348

Влияние общего остеопатического лечения на тонус мышц по данным электромиографии
(The effect of general osteopathic treatment on muscle tone according to electromyography data)
Cherednikova, N. V., Zhang, V. F., Potekhina, Y. P., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/12
Free full text
349

Возможность обратимости фиброза печени под влиянием комплексного лечения
(The possibility of reversibility of liver fibrosis under the influence of complex treatment)
Kozhokina, S. G.
Russian Osteopathic Journal, 2023/12
Free full text
350

Osteopathic Manipulative Treatment for the Management of Irritable Bowel Syndrome: A Case Report
Heineman, K.
The AAO Journal, 2023/12
Free full text
351

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text
352

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12
353

Preliminary Evaluation of an Osteopathic Manipulative Treatment to Prevent Motion Sickness
Thomas, V. A., Kelley, A. M., Lee, A., Fotopoulos, T., Boggs, J., Campbell, J.
Aerospace Medicine and Human Performance, 2023/12
354

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/12
Free full text
355

The Influence of Osteopathic Manipulative Treatment (OMT) on Cognitive Performance and Recovery Following a Sport-Related Concussion
Bennett, R., Peart, Z., Brett, J., Posey, A.
Journal of Osteopathic Medicine, 2023/12
356

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12
357

Safety and Efficacy of Osteopathic Manipulative Treatment (OMT) in the Pediatric Oncology Inpatient Setting
Brown, A., Hoffman, L., Eyassu, E., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
Journal of Osteopathic Medicine, 2023/12
358

OMT Alleviated Migraine-Like Pain via Blockade of Trigeminal Activation
Child, K., Fowler, D., Pan, Y., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2023/12
359

Retrospective Study of Osteopathic Manipulative Treatment Use for Pain in Patients with Ehlers Danlos Syndromes and Hypermobility Spectrum Disorder (EDS/HSD)
Chung, M. J., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
360

Investigation of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S. P., Matthias, A., Roush, A. J., VanderMerwe, D., Starr, E. G., Wong, W. J., Parker, L. M., Nicholas, J. M., Wilson, H.
Journal of Osteopathic Medicine, 2023/12
361

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
362

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12
363

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12
364

The Efficacy of Osteopathic Manipulation Treatment (OMT) on Post-Operative Outcomes: An Abstract
Reddy, P., Santhakumar, K.
Journal of Osteopathic Medicine, 2023/12
365

Assessing Correlation Between Manual Dexterity, Specialty Choice and Desire to Practice OMT in Newly Admitted Osteopathic Medical Students
Rome, V., Brolis, N.
Journal of Osteopathic Medicine, 2023/12
366

Efficacy of Osteopathic Manipulation Therapy in the Treatment of Post-concussive Versus Primary Migraines
Song, J., Hall, T., Waddington, M.
Journal of Osteopathic Medicine, 2023/12
367

Analyzing ChatGPT’s Proficiency In Multiple Choice Osteopathic Manipulative Medicine Questions: Insights and Implications
Sundin, A., Gawash, A., Zia, H., Lo, D. F., Averell, N., King, A., Powell, L.
Journal of Osteopathic Medicine, 2023/12
368

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
Free full text
369

Anorexie mentale et médiations somatiques : évaluations croisées de l’ostéopathie et de la psychomotricité sur les préoccupations corporelles
(Osteopathy and Anorexia Nervosa: Cross-evaluations of osteopathy and psychomotricity on bodily concerns)
Mattatia, J., Gaha, N., Cottin, L., Mattatia, D., Morelle, Q., Truong, R., Saussé-Corbière, L., Yi, M.K.
Annales Médico-psychologiques, revue psychiatrique, 2023/11
370

Osteopathic Manipulative Treatment on Predominantly African American Hospitalized Coronavirus Disease 2019 Patients during Michigan’s First Wave.
Soni, E., Kattan, M., Jackson, N. M., Mainor, I., Corser, W.
MI Medical Education and Health Bulletin, 2023/11
Free full text
371

Osteopathie bei Spannungskopfschmerzen - Eine systematische Übersichtsarbeit
(Osteopathy for tension-type headache - a systematic review)
Gollonitsch, P.
Unpublished MSc thesis, 2023/11
Free full text
372

Ein systematischer Überblick über die Wirkung der Osteopathie auf die Atemfunktion bei gesunden und kranken Erwachsenen
(A Systematic Review on the Effect of Osteopathic Treatment on Respiratory Function in Healthy and Sick Adults)
Haas, E.
Unpublished MSc thesis, 2023/11
373

Der Einfluss des „general osteopathic treatment“ (GOT) auf das Gangbild, die Funktionalität und posturale Kontrolle von Schlaganfallpatient*innen. Eine randomisierte kontrollierte Pilotstudie
(The influence of “general osteopathic treatment“ (GOT) on gait, functionality and postural control in stroke patients. A randomized controlled pilot study)
Mühlbauer, T.
Unpublished MSc thesis, 2023/11
374

Effekte von Osteopathie auf Migräne
(Effects of osteopathy on migraine)
Pöchlauer-Schneck, J.
Unpublished MSc thesis, 2023/11
375

Wirksamkeit osteopathischer Techniken bei Endometriose
(Efficacy of osteopathic techniques in endometriosis)
Schiche, S.
Unpublished MSc thesis, 2023/11
376

Hat eine auf Körperflüssigkeit und Diaphragmen basierende osteopathische Behandlung in Kombination mit Physiotherapie eine bessere Wirkung auf die gesundheitsbezogene Lebensqualität bei ambulant betreuten MS-PatientInnen als ausschließlich physiotherapeutische Behandlung?
(Does body fluid and diaphragm-based osteopathic treatment combined with physical therapy have a better effect on health-related quality of life in outpatients with MS than physical therapy alone?)
Shikha, K.
Unpublished MSc thesis, 2023/11
377

Welchen Einfluss hat eine osteopathische Behandlung auf Stress?
(What is the impact of osteopathic treatment on stress?)
Soika, V.
Unpublished MSc thesis, 2023/11
378

Die Wirksamkeit osteopathischer Interventionen auf die Parameter FEV1 and FVC gemessen mittels Spirometrie
(Effectiveness of osteopathic interventions on the spirometric values FEV1 and FVC)
Söllradl, C.
Unpublished MSc thesis, 2023/11
379

Die Wirksamkeit der osteopathischen Therapie als Komplementärmedizin bei PatientInnen mit einer kardiovaskulären Erkrankung Systematischer Review
(The effectiveness of osteopathic manipulative treatment as complementary medicine for patients with cardiovascular disease A systematic review)
Tänzer, M. C.
Unpublished MSc thesis, 2023/11
Free full text
380

Pericardial Adhesion and Chronic Non-Specific Neck Pain following Thoracentesis: An Osteopathic Approach
Bordoni, B., Escher, A.
Clinics and Practice, 2023/10
Free full text
381

Osteopathic Manipulative Medicine and Its Role in Psychiatry
Bowes, M. R., Speicher, M. R., Tran, L. T., Santiago, P. N.
Cureus, 2023/10
Free full text
382

Effect of acupuncture combined with rehabilitation on Postoperative gastrointestinal dysfunction after abdominal operation
Xing, W.
Clinical Nutrition ESPEN, 2023/10
383

A biopsychosocial approach as a part of an osteopathic intervention in the management of chronic prostatitis/chronic pelvic pain: A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2023/10
384

The Use of Osteopathic Manipulative Treatment for Treatment of Sore Throat, Headache, and Facial Pain: A Case Report
Berkowitz, M. R.
The AAO Journal, 2023/09
Free full text
385

Case History #4
Coffey, D.
The AAO Journal, 2023/09
Free full text
386

Diagnosis and Treatment of a Dynamic Strain Vector after a Motor Vehicle Accident
Gustowski, S.
The AAO Journal, 2023/09
Free full text
387

Resolution of Stridor, Gastritis and Cephalgia in an Adolescent with Reflex Sympathetic Dystrophy Following Osteopathic Manipulative Treatment—A Case Report
Habenicht, A. L.
The AAO Journal, 2023/09
Free full text
388

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text
389

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09
390

Osteopathic treatment for cam-type Femoroacetabular impingement syndrome: A case report
Kilic, R. T., Yosmaoglu, H. B., Bayrakci Tunay, V.
International Journal of Osteopathic Medicine, 2023/09
391

Quantitative ultrasound to assess efficacy of treatment for neck somatic dysfunctions: a feasibility study
Tran, A., Ngo, T., Roberts, T., Ko, E., Holmgren, J. G., Edwards, C., Coleman, M., Gao, J.
Journal of Osteopathic Medicine, 2023/09
Free full text
392

The role of manual therapy for osteopaths in the management of temporomandibular disorders: A qualitative study
McComish, N.
Unpublished MSc thesis, 2023/09
Free full text
393

Der Einwärtsgang – Physiologie oder Pathologie?
(The inward gait - physiology or pathology?)
Halasz, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
394

Возможности немедикаментозных методов лечения при синдроме хронической тазовой боли у мужчин (систематический обзор)
(Possibilities of non-drug methods of treatment for chronic pelvic pain syndrome in men (systematic review))
Krikunov, A. I., Potekhina, Y. P.
Russian Osteopathic Journal, 2023/09
Free full text
395

Эффективность остеопатического лечения пациентов, страдающих фибромиалгией (обсервационное исследование)
(Observational study of the effects of an osteopathic treatment for patients with fibromyalgia)
Laroche, F., Bellan, E., Doléac, M., Meslé, R., Marty, M., Rostaing, S.
Russian Osteopathic Journal, 2023/09
Free full text
396

Изменение клинического статуса пациента с дисфункцией височно-нижнечелюстного сустава после остеопатической коррекции соматических дисфункций
(Change in the clinical status of a patient with dysfunction of the temporomandibular joint after osteopathic correction of somatic dysfunctions)
Nesterov, A. M., Tsymbalov, E. E., Nikulina, M. A., Kantsepolsky, A. N.
Russian Osteopathic Journal, 2023/09
Free full text
397

Исследование возможности применения остеопатической коррекции для лечения пациентов с неэрозивной гастроэзофагеальной рефлюксной болезнью
(Study of the possibility of using osteopathic correction for the treatment of patients with non-erosive gastroesophageal reflux disease)
Pirogov, R. V., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/09
Free full text
398

Osteopathic Manipulative Therapy (OMT) as an adjunct to postoperative care for patients with gynecologic malignancies (174)
Ettorre, V., Wagreich, A., Meelheim, B., Torres, J.
Gynecologic Oncology, 2023/09
399

Influence of Osteopathic Manipulative Treatment on the Quality of Life and the Intensity of Lumbopelvic Pain in Pregnant Women in the Third Trimester: A Prospective Observational Study
Correia, M. L. A., Peixoto Filho, F. M., Gomes Júnior, S. C.
Healthcare, 2023/09
Free full text
400

Osteopathic Manual Therapy for Infant Colic: A Randomised Clinical Trial
Martínez-Lentisco, M. D. M., Martín-González, M., García-Torrecillas, J. M., Antequera-Soler, E., Chillón-Martínez, R.
Healthcare, 2023/09
Free full text
401

Evaluation of the effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in chronic nonspecific low back pain. A protocol for a randomised controlled trial
Armbrust, D., Fonseca, C. L., Lopes Dumont, A. J., Viegas da Trindade, A. M., Neto, H. P., Oliveira, C. S.
International Journal of Osteopathic Medicine, 2023/09
402

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09
403

The biomechanical links between pelvic floor dysfunction and testicular pain: A clinical review
Jackson, C., Fawcett, L.
Osteopathic Family Physician, 2023/09
404

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text
405

A Novel Approach to Assessing and Conservatively Treating Anterior Cutaneous Nerve Entrapment Syndrome: A Case Study
Newman, D. P., Holkup, S. M., Masi, E. L., Soto, A. T.
Cureus, 2023/09
Free full text
406

Osteopathic Manipulative Treatment for a Chronic Rotator Cuff Tear: A Case Report
Scypinski, L. J., Bonitz, T. J., Lomiguen, C. M., Chin, J.
Cureus, 2023/09
Free full text
407

Die Schilddrüse aus der Sicht der Osteopathie: Teil 3: Behandlung
(The thyroid gland from the point of view of osteopathy: Part 3: Treatment)
Frühwein, J.
Osteopathische Medizin, 2023/09
408

Fallbericht: Phänodynamisch-osteopathische Behandlung eines Hygroms
(Case report: Phenodynamic-osteopathic treatment of a hygroma)
Weber, K.H.
Osteopathische Medizin, 2023/09
409

The process and outcomes of chronic low back pain treatment provided by osteopathic and allopathic physicians: a retrospective cohort study
Licciardone, J. C., Kellerlee, J., Joseph, M., Mohammad, M. B., Kim, K. G., Jain, J., Aryal, S.
Journal of Osteopathic Medicine, 2023/08
Free full text
410

Osteopathic manipulative treatment for concussions and postconcussive syndrome in athletes: a literature review
Thomas, K. D., Lombard, Z. K., Shadiack, A. L.
Journal of Osteopathic Medicine, 2023/08
Free full text
411

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text
412

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text
413

Effects of the Fourth Ventricle Compression Technique and Rib Raising Osteopathic Technique on Autonomic Nervous System Activity Measured by Heart Rate Variability in 35 Healthy Individuals
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2023/08
Free full text
414

Awareness and interest in osteopathic manipulative treatment in allopathic medical students
Darby, A., Parascando, J. A., Lipinski, M., Lipinski, C., Mendez-Miller, M., Berg, A., Rabago, D., Oser, T. K.
Journal of Osteopathic Medicine, 2023/08
Free full text
415

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text
416

Systematic review and meta-analysis showed that complementary and alternative medicines were not effective for infantile colic
Cabanillas-Barea, S., Jiménez-del-Barrio, S., Carrasco-Uribarren, A., Ortega-Martínez, A., Pérez-Guillén, S., Ceballos-Laita, L.
Acta Paediatrica: Nurturing the Child, 2023/07
Free full text
417

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text
418

Effectiveness of Osteopathic Manipulative Treatment in Treating Symptoms of Irritable Bowel Syndrome: A Literature Review
Lotfi, C., Blair, J., Jumrukovska, A., Grubb, M., Glidden, E., Toldi, J.
Cureus, 2023/07
Free full text
419

Cambios físicos y metabólicos desencadenados tras la manipulación osteopática
(Physical and metabolic changes triggered by osteopathic manipulation)
Melo, M., Alberto, R.
Unpublished MSc thesis, 2023/07
Free full text
420

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text
421

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07
422

Effectiveness of visceral fascial therapy targeting visceral dysfunctions outcome: systematic review of randomized controlled trials
da Silva, F. C., Vieira, L. S., Santos, L V., Gaudreault, N., Cruvinel-Júnior, R H., Santos, G M.
BMC Complementary Medicine and Therapies, 2023/07
Free full text
423

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06
Free full text
424

An Osteopathic Approach to Dizziness Secondary to Meniere’s Disease
Grote, J., Perez, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
425

Operative Herangehensweise bei und osteopathische Behandlung nach Hüft-TEP-Implantation
(Operative approach to and osteopathic treatment after hip TEP implantation)
Grasmück, J., Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
426

Der biodynamische Behandlungsansatz in der osteopathischen Praxis – eine qualitative Interviewstudie
(The biodynamic treatment approach in osteopathic practice - a qualitative interview study)
Grasmück, J., Müller, F., Kienzler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
427

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
Free full text
428

Die Lebendigkeit des Selbst – das gesunde Immunsystem
(The vitality of the self - the healthy immune system)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
429

Resolution of a Plica Band Syndrome with Osteopathic Manipulative Treatment
Barr, J., Heller, G.
The AAO Journal, 2023/06
Free full text
430

An Osteopathic Approach to Chronic Inflammatory Demyelinating Polyneuropathy
Baxter, C., Grote, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
431

Osteopathic Management of Pediatric Feeding Disorder, Oral Aversion, and Growth Faltering: A Case Report
Beveridge, E., Magoun, M. A.
The AAO Journal, 2023/06
Free full text
432

Nervous System Under Attack
Blaukovitch, C., Unger, M., Thorsvik, N., Heller, G.
The AAO Journal, 2023/06
Free full text
433

Happy Feet are Dancing Feet, Response to OMT in a Patient with Morphea Profunda: A Case Report
Bomani-Bailey, A., Ettlinger, H.
The AAO Journal, 2023/06
Free full text
434

Comparison of Tone and Stiffness Changes to Lumbar Paraspinal Muscle with Varying Osteopathic Treatment Modalities (254)
Companion, N., Guha, A., Naeem, A., Abu-Sbaih, R., Keys, J., Yao, S.
The AAO Journal, 2023/06
Free full text
435

The Effects of Osteopathic Manipulative Treatment (OMT) on an Infant with Failure to Thrive (FTT); A Case Study
Cornwell, S., Yao, S., Abu-Sbaih, R.
The AAO Journal, 2023/06
Free full text
436

Osteopathic Manipulative Treatment Reduces Pain and Improves Range of Motion in Patients with Chronic Neck Pain
Daly, E., Prodoehl, J., Bolch, C., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2023/06
Free full text
437

Tackling Structure and Function with an Osteopathic Approach: A Patient with a Herniated Lumbar Disc and a Small Hemipelvis
Danto, S. E., Danto, J. B.
The AAO Journal, 2023/06
Free full text
438

Stop Chasing the Pain: An Osteopathic Approach to Treating Migrating Pain Caused by Lumbar Radiculopathy- the Importance of Treating the Cause not the Symptoms
Desai, B., Baxter, C., Widboom, N.
The AAO Journal, 2023/06
Free full text
439

Drug Induced Tibial Nerve Neuropathy in Former Collegiate Baseball Player
Dickey, Z., Turnbull, J., Sharma, N., Aldret, S.
The AAO Journal, 2023/06
Free full text
440

Cranial Osteopathic Manipulative Treatment for Post-COVID Syndrome
Drakeley, C., Shah, R., Waters, H., Mehra, R., Kumaran, N., Johnson, T.
The AAO Journal, 2023/06
Free full text
441

Stalled out: An Osteopathic Approach To A Post-Traumatic Gastroparesis
Fisher, B., Vijayakar, R., Coppinger, J., Motashaw, V.
The AAO Journal, 2023/06
Free full text
442

An Osteopathic Approach to Shoulder Injury Following Post-Hemorrhage Hemiparesis
Geyer-Roberts, E., Helderlein, P., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
443

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06
444

An Osteopathic Approach to Dizziness Secondary to Meniere’s Disease
Grote, J., Perez, J., Wallace-Ross, J.
The AAO Journal, 2023/06
445

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
446

Cranial for Chronic pain: The efficacy of osteopathic manipulative treatment (OMT) in the management of chronic post-traumatic headache (CPTHA)
Helderlein, P., Geyer-Roberts, E., Widboom, N.
The AAO Journal, 2023/06
Free full text
447

Intersegmental sacral dysfunction as primary etiology of low back pain in a college athlete: A case study
Householder, L., Veach, A., Diefenderfer, J.
The AAO Journal, 2023/06
Free full text
448

Treatment of A Pediatric Patient with Right Eye Esotropia using Osteopathic Manipulative Treatment
Inouye, K., Magoun, M. A.
The AAO Journal, 2023/06
Free full text
449

International Overview of Osteopathic Manipulative Treatment in Infants with Nonsynostotic Plagiocephaly: A Scoping Review to Aid in the Inclusion of OMT into the Current Evidence-Based Treatment Guidelines
Jimenez, R., Cao, G., Bomstad, C., Myxter, K., Lozano, A., Tran, M.T., Roettger, V., Gubler, K. D., Brooks, B., Branda, A.
The AAO Journal, 2023/06
Free full text
450

The Effects of Osteopathic Manipulative Treatment (OMT) on Rare Diseases- Gordon Syndrome
Johnson, T. A., Waters, H.
The AAO Journal, 2023/06
Free full text
451

Osteopathic Manipulative Treatment for Enhanced Functional Recovery in Stroke Survivors
Kumaran, N., Drakeley, C., Waters, H., Mehra, R.
The AAO Journal, 2023/06
Free full text
452

Use of Micronized Lipoaspirate with Platelet-rich Plasma Injection and 3D Tenotomy for Treatment of a Longitudinal Peroneal Brevis Tear
Lambert, M., Fremarek, N., Kozar, A.
The AAO Journal, 2023/06
Free full text
453

The 5 Models of Osteopathic Medicine, An Approach to Transgendered Care: A Case Report
Lentz, A., Koehler, T., Caldwell, G., Fremarek, N.
The AAO Journal, 2023/06
Free full text
454

Case Study on the Effect of Osteopathic Manipulation on Gallbladder Ejection Fraction
Lin, E., Montalvo, E., Garcia Garcia, D., Adams, N., Sparks, C., Gibson, J., Seals, R.
The AAO Journal, 2023/06
Free full text
455

Effect of Muscle Energy Technique (MET) on muscle parameters and lower extremity functionality in a Parkinson’s Disease (PD) patient: A case report
Macmillan, G., Radigan, R., Finkelstein, A., Yao, S.
The AAO Journal, 2023/06
Free full text
456

Osteopathic Treatment of Chronic Chest Pain After Trauma
Martini, J., Veach, A.
The AAO Journal, 2023/06
Free full text
457

Effects of OMT on Running Performance and Recovery
Matz, O., Gustafson, H., Hartwell, L., Rudberg-Post, L., Lewis, D.
The AAO Journal, 2023/06
Free full text
458

Osteopathic Manipulative Treatment for Chemotherapy-Induced Abdominal Pain and Anorexia in Glioblastoma Multiforme
McIntire, R., Terry, R., Gebhardt, G.
The AAO Journal, 2023/06
Free full text
459

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study, Part 2
Miranda, E., Feketeova, E., Giza, J.
The AAO Journal, 2023/06
Free full text
460

An Osteopathic Approach to Dysmenorrhea
Paul, H., Bonner, P., Mehra, R.
The AAO Journal, 2023/06
Free full text
461

A Case of Chronic Postoperative Abdominal Wall Pain Successfully Treated with the Fascial Distortion Model
Pelletier, J., Boucher, J.
The AAO Journal, 2023/06
Free full text
462

Osteopathie in Österreich: Wirksamkeit und Sicherheit bei Schmerzen des Bewegungsapparats und Überblick über Ausbildung und Qualitätsanforderungen
(Osteopathy in Austria: Effectiveness and safety in treating pain of the musculoskeletal system and overview of training and quality requirements)
Gassner, L., Hofer, V.
Osteopathische Medizin, 2023/06
Free full text
463

The Effect of OMT on Insulin Sensitivity and Glucose Control in Rodent Models: A Pilot Study
Petrillo, G., Cai, W., Keys, J.
The AAO Journal, 2023/06
Free full text
464

An Osteopathic Approach To Refractory Sternal Pain
Risov, D., Geer, R.
The AAO Journal, 2023/06
Free full text
465

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
Free full text
466

Palpatory tests in manual therapies: an international survey on osteopathic clinical practice
Novelli, E., Molinari, L., Consolo, S., Mingrone, L.
Journal of Complementary and Integrative Medicine, 2023/06
Free full text
467

An Osteopathic Approach to Plagiocephaly in the Absence of Pre-Post Sphenoid Fusion
Rosten, C., Nixon, K., Jons-Cox, L.
The AAO Journal, 2023/06
Free full text
468

Releasing the Restriction: A Study of Myofascial Release to Improve Pain and Range of Motion in Post-Cesarean Section Patients in the Peruvian Amazon
Scott, G., Gordon, T.
The AAO Journal, 2023/06
Free full text
469

Refractory Temporomandibular Joint Pain Resolved with Intraoral Osteopathic Manipulative Treatment
Shah, R., Drakeley, C., Mehra, R.
The AAO Journal, 2023/06
Free full text
470

Ultrasound Assessment of OMT on Diaphragm Motion
Snow, N., DeDi, C., Rathjen, S., Redden, D. T., Kozar, A., Robinson, L.
The AAO Journal, 2023/06
Free full text
471

26.2 Miles: A Case Study of Osteopathic Manipulative Treatment in Marathon Training
Sofka, M., Giovanis, A.
The AAO Journal, 2023/06
Free full text
472

Symptomatic Mitigation of a Rare Case of Chronic Active Epstein-Barr Virus (CAEBV)Disease Using Lymphatic Osteopathic Manipulative Treatment
Song, Y., Waddington, M.
The AAO Journal, 2023/06
Free full text
473

Approaching the barrier: Improved pediatric resident knowledge and confidence in osteopathic manipulative medicine after a resident-led educational intervention
Tyler, S., McMunn, R., Ruedinger, E.
The AAO Journal, 2023/06
Free full text
474

Effects of Osteopathic Manipulative Treatment (OMT) on Functional Impairment in Limb Girdle Muscular Dystrophy Patient: A Case Report (271)
Unser, K., Yao, S.
The AAO Journal, 2023/06
Free full text
475

Faszien als sensorisches und emotionales Organ: Emotionen, Faszien und Immunsystem
(Fasciae as sensory and emotional organ: Emotions, fasciae and immune system)
Schleip, R., Bartsch, K.
Osteopathische Medizin, 2023/06
Free full text
476

Osteopathic Manipulative Medicine as an Adjuvant Treatment for Hemicrania Continua: A Case Study
Van Fossen, E., Kanithi, M., Jelneck, S., Ferguson, D., Tran, J., Bui, N., Hassan, D., Gordon, T.
The AAO Journal, 2023/06
Free full text
477

A Case Study of Osteopathic Manipulative Treatment (OMT) in Deformational Plagiocephaly (DP)
Vega, K., Ettlinger, H.
The AAO Journal, 2023/06
Free full text
478

Banging Out Concussions: The Role of Osteopathic Manipulative Treatment in Post-Concussion Syndrome in Children
Wajid, A., Ettlinger, H.
The AAO Journal, 2023/06
Free full text
479

Osteopathic Manipulative Treatment of Chronic Pelvic Pain due to High-Tone Pelvic Floor Dysfunction
Barnett, M. E., Henderson, K. K., Elliott-Burke, T. L., Heinking, K. P.
Osteopathic Family Physician, 2023/06
480

Incorporation of an osteopathic-focused lecture series into an already established pediatric residency curriculum
Wysong, M., Copenheaver, D., Powers, L., Flaherty, R.
The AAO Journal, 2023/06
Free full text
481

Effect of OMT on post-anoxic brain injury resulting in intractable myoclonus
Zhong, X., Campo, Z., Torrents, M.
The AAO Journal, 2023/06
482

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06
483

OSCAR (Osteopathic Single CAse Research) – Assessing the effect of standard and biopsychosocial osteopathic management for patients with non-specific low back pain: Protocol for a Single Case Experimental Design (SCED)
Draper-Rodi, J., Abbey, H., Brownhill, K., Vogel, S.
International Journal of Osteopathic Medicine, 2023/06
484

Влияние остеопатической коррекции на объем движения и качество жизни у пациентов с артрозом плечевого сустава I–II степени
(Influence of osteopathic correction on range of motion and quality of life in patients with arthrosis of the shoulder joint of I–II degrees)
Avzaletdinov, B. K., Akhmetov, B. H.
Russian Osteopathic Journal, 2023/06
Free full text
485

Соматическая дисфункция. Клинические рекомендации 2023
(Somatic Dysfunction. Clinical Guidelines 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
Free full text
486

Сила давления на ткани при различных остеопатических техниках (пилотное исследование)
(Pressure force on tissues in various osteopathic techniques (pilot study))
Mokhov, D. E., Tregubova, E. S., Potekhina, Y. P., Smirnova, L. M., Kolyshnitsyn, N. Y., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/06
Free full text
487

Влияние общего остеопатического лечения на качество жизни людей пожилого возраста
(The influence of general osteopathic treatment on the quality of life of elderly people)
Usupbekova, B. S., Zhusupbekova, N. E., Shyikymanarov, E. S.
Russian Osteopathic Journal, 2023/06
Free full text
488

Возможности применения остеопатической коррекции для лечения детей с синдромом дефицита внимания и гиперактивности
(The possibilities of osteopathic correction using for the treatment of children with attention deficit hyperactivity disorder)
Zaev, A. I., Stenkova, O. V.
Russian Osteopathic Journal, 2023/06
Free full text
489

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
490

Use of osteopathic manipulative treatment in management of intractable singultus and associated symptoms
Bloch, R. R., Kempa, M. R., Lippert, J. A.
International Journal of Osteopathic Medicine, 2023/06
491

Exploring the effects of standardized soft tissue mobilization on the viscoelastic properties, pressure threshold and touch threshold of the caesarean section scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2023/06
492

Utilization and Reimbursement Trends of Osteopathic Manipulative Treatment for Medicare Patients: 2000-2019
Starr, E., Smith, J. F., Hanson, R. B., Woolstenhulme, J. B., Roush, A. J., Sperry, N. B., Wilde, B., Brooks, A., Zapata, I.
Journal of Osteopathic Medicine, 2023/06
Free full text
493

What complementary and alternative medicine therapy recommendations exist across clinical practice guidelines for low back pain? A systematic review
Mohiuddin, U., Ng, J.
Journal of Complementary and Integrative Medicine, 2023/06
494

Pharmacology Education, Osteopathic Principles Integration, Osteopathic Manipulation Treatment relations: Osteopathic Graduating Seniors' Perception
Eldeeb, K.
Journal of Pharmacology and Experimental Therapeutics, 2023/06
495

Osteopathy in the Early Diagnosis and Management of Degenerative Cervical Myelopathy: National Survey
Brannigan, J. F. M., Mowforth, O. D., Rogers, M., Wood, H., Karimi, Z., Kotter, M. R. N., Davies, B. M.
JMIR Formative Research, 2023/05
Free full text
496

The Short-Term and Long-Term Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D. Y., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
497

Serological Assessment of the Effectiveness of Osteopathic Manipulative to Augment the Covid-19 Vaccine Immune Response
Martinez, E., Loveless, B., Crone, P., Szurmant, H., Fuchs, S., Sanchez, J.
Journal of Investigative Medicine, 2023/05
498

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
499

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05
500

Evaluation of Osteopathic Manipulative Treatment in Patients with Chikungunya Fever in the Chronic Phase: A Randomized Controlled Trial
Tenorio, L., Mello, K., Maia, M., Valença, A., Duarte, Â., Marques, C.
Journal of Clinical Rheumatology, 2023/05
501

Manejo de la espondilolistesis lumbar desde la osteopatía. Una revisión bibliométrica
(Management of lumbar spondylolisthesis from osteopathy. A bibliometric review)
Apolinar Cruz, G. A.
Unpublished MSc thesis, 2023/05
Free full text
502

Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine
Alvarez, G., Lucas, S., Roura, S.
Journal of Osteopathic Medicine, 2023/05
Free full text
503

Osteopathic manipulative treatment of patients with chronic low back pain in the United States: a retrospective cohort study
Licciardone, J. C., Moore, S., Fix, K., Blair, L. G., Ta, K.
Journal of Osteopathic Medicine, 2023/05
Free full text
504

Osteopathic Manual Treatment Compared to Kaltenborn-Evjenth Orthopedic Manual Therapy for Chronic Low Back Pain: A Randomized Study
Lizis, P., Kobza, W., Jaszczur-Nowicki, J., Wisniewski, D.
Alternative Therapies in Health and Medicine, 2023/05
505

Efficacy of the Osteopathic Pedal Pump in Reducing Lower Limb Volume in Older Adults with Lymphedema
Parikh, S. H., Adams, J. S., Goodwin, B. J., McLaughlin, M. H., Noll, D. R.
Journal of the American Geriatrics Society, 2023/04
506

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: Randomized controlled trial
Boas Fernandes, W. V., Politti, F., Blanco, C. R., Garcia Lucareli, P. R., Gomes, C. A. F. d. P., Corrêa, F. I., Corrêa, J. C. F.
Journal of Bodywork and Movement Therapies, 2023/04
507

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text
508

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text
509

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text
510

Validation of subjective manual palpation using objective physiological recordings of the cranial rhythmic impulse during osteopathic manipulative intervention
Pelz, H., Müller, G., Keller, M., Mathiak, K., Mayer, J., Borik, S., Perlitz, V.
Scientific Reports, 2023/04
Free full text
511

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
512

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
513

Osteopathic Findings and Treatment of Patient with Crohn's Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text
514

Метод коррекции соматических дисфункций
(Method for correcting somatic dysfunctions)
Aptekar, I. A.
Russian Osteopathic Journal, 2023/03
Free full text
515

Влияние остеопатической коррекции на ликвородинамику у пациентов с головной болью напряжения
(The influence of osteopathic correction on liquorodynamics in patients with tension-type headache)
Belash, V. O., Starostenko, V. A.
Russian Osteopathic Journal, 2023/03
Free full text
516

Communication strategies in psychologically informed osteopathic practice: A case report
Abbey, H.
International Journal of Osteopathic Medicine, 2023/03
517

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text
518

Die osteopathische Technik – ein Metakonzept
(The osteopathic technique - a meta concept)
Engel, M.
Osteopathische Medizin, 2023/03
519

Covid-19 Fatigue: Diagnosis and Treatment for the Osteopathic Physician
Foss, V. B., Maddie, N., Frankini, E. L., Landman, S., Maccagnano, J., Yao, S. C.
Osteopathic Family Physician, 2023/03
520

Abwertung als Ziel: Über den Artikel „Die Scheinwirkung der Osteopathie” von Edzard Ernst
(Devaluation as a Goal: About the Article “The Sham Effect of Osteopathy“ by Edzard Ernst)
Franke, H.
Osteopathische Medizin, 2023/03
521

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03
522

A Case Study of Postural Imbalance with Lymphatic Congestion Which Responded to OMT
Lockhart, W. C.
The AAO Journal, 2023/03
Free full text
523

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text
524

Response to “Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine“
Rehman, Y., Kirsch, J., Snider, K. T.
Journal of Osteopathic Medicine, 2023/03
Free full text
525

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03
526

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03
527

Osteopathic Findings and Treatment of Patient with Crohn’s Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text
528

Osteopathische Behandlung von Säuglingen mit infantiler Kolik/exzessivem Schreien: Eine prospektive, multizentrische, kontrollierte randomisierte Studie
(Osteopathic treatment of infants with infantile colic/excessive crying: A prospective, multicenter, controlled randomized trial.)
Zimmer, M., Göpfert, J., Laux, P., Langenmair, S.
unpublished D.O. thesis, 2023/03
529

Гониометрическая оценка применения остеопатической техники активного вытяжения со специфической точкой фиксации. Влияние на подвижность плечевого пояса
(Goniometric effects of an osteopathic technique, active stretching with specific, fixation on the mobility of the Scapular Waist)
Campillar, M. A.
Russian Osteopathic Journal, 2023/03
Free full text
530

Результаты остеопатической коррекции по данным стабилографии у пациентов с ампутацией нижних конечностей на уровне голени
(Results of osteopathic correction according to the stabilography data in patients with lower limb amputation at the transtibial level)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2023/03
Free full text
531

Обоснование эффективности остеопатической коррекции при лечении пациентов, страдающих постпункционным синдромом
(Substantiation of the effectiveness of osteopathic correction in the treatment of patients suffering from post-puncture syndrome)
Krivenya, M. S., Gorobets, L. V.
Russian Osteopathic Journal, 2023/03
Free full text
532

Результаты остеопатического лечения дисфункции височно-нижнечелюстного сустава (метаанализ)
(Results of the osteopathic treatment of the temporomandibular joint dysfunction (meta-analysis))
Milutka, Y. A., Dyachkova, Y. Y., Evdokimova, A. V.
Russian Osteopathic Journal, 2023/03
Free full text
533

Возможность применения остеопатической коррекции при синдроме хронической тазовой боли
(The possibilities of using osteopathic correction for chronic pelvic pain syndrome)
Sharapov, I. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/03
Free full text
534

Остеопатическая реабилитация пациентов, перенесших внебольничную пневмонию
(Osteopathic rehabilitation of patients after community-acquired pneumonia)
Usupbekova, B. S., Sartmyrzaeva, S. S., Murzakhmetova, S. A.
Russian Osteopathic Journal, 2023/03
Free full text
535

Патогенетические предпосылки применения остеопатической коррекции при хроническом тонзиллите
(Pathogenetic prerequisites for the use of osteopathic correction in chronic tonsillitis)
Vedyashkina, A. S., Potekhina, Y. P., Mokhov, D. E.
Russian Osteopathic Journal, 2023/03
Free full text
536

Обоснование применения остеопатической коррекции в комплексной реабилитации пациентов после операции реконструкции передней крестообразной связки
(Substantiation of the application of osteopathic correction in the complex rehabilitation of patients after anterior cruciate ligament reconstruction surgery)
Vorobyev, S. V., Dolinina, O. Y., Mokhov, A. D., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/03
Free full text
537

Osteopathic intervention for infants with breastfeeding difficulty: A retrospective case series
Greenwood, K., Engel, R., Grace, S.
International Journal of Osteopathic Medicine, 2023/03
538

Kann mittels Osteopathie der Hormonstatus von infertilen Frauen mit Polyzystischem-Ovarial-Syndrom (PCOS) beeinflusst werden?
(Is it possible to influence the hormone levels of infertile women with polycystic ovarian syndrome (PCOS) by osteopathic treatments?)
Hartl, V.
Unpublished MSc thesis, 2023/03
539

Die klinische Wirksamkeit des Fasziendistorsionsmodells
(Clinical Efficacy of the Fascial Distortion Model)
Honc, C.
Unpublished MSc thesis, 2023/03
Free full text
540

Der Effekt einer Stillpunktinduktion am Sakrum auf das vegetative Nervensystem, im Vergleich zu einer Scheinbehandlung, gemessen anhand der Herzratenvariabilität (HRV)
(The Effect of a sacrum stillpoint induction on the autonomic nervous system compared to a sham treatment, as measured by heart rate variability (HRV))
Franzin, K.
Unpublished MSc thesis, 2023/03
541

Effekt einer Unwinding-Technik des zervikothorakalen Diaphragmas auf die Herzratenvariabilität (HRV) im Vergleich zu einer Scheinbehandlung
(Effect of an unwinding technique of the cervicothoracic diaphragm on the heart rate variability (HRV) compared to a sham treatment)
Gwendolyn, A.
Unpublished MSc thesis, 2023/03
542

Osteopathie bei Frauen mit Blasenentleerungsstörung sowie Blasenspeicherstörungen
(Effect of osteopathy on bladder storage dysfunctions and voiding difficulties in women)
Schwarzenlander, U.
Unpublished MSc thesis, 2023/03
543

Effektivität einer craniosacralen Behandlung bei Multiple-Sklerose-PatientInnen mit Störungen im Urogenitaltrakt im Vergleich zur physiotherapeutischen Behandlung mittels aktiver Beckenbodenübungen
(Effectiveness of a craniosacral treatment on patients with multiple sclerosis with problems of the urogenital system compared with pelvic floor training)
Karner, A.
Unpublished MSc thesis, 2023/03
544

Effektivität von osteopathischen Techniken und Behandlungen bei COPD. Systematisches Review
(Effectiveness of osteopathic techniques and treatments in patients with COPD. A systematic review)
Safran, T.
Unpublished MSc thesis, 2023/03
545

Die Wirksamkeit der Osteopathie auf die Okulomotorik nach einer Gehirnerschütterung
(The effectiveness of osteopathy on oculomotor function after concussion)
Dalder, K.
Unpublished MSc thesis, 2023/03
546

Der Einfluss einer visceralen Behandlungstechnik auf die Beweglichkeit der Halswirbelsäule
(The influence of a visceral treatment technique on the mobility of the cervical spine)
Koch, K.
Unpublished MSc thesis, 2023/03
547

Der Einfluss der Osteopathie auf infantile nicht-synostotische Plagiozephalie
(The Influence of Osteopathy on infantile non-synostotic Plagiocephaly)
Archam, S.
Unpublished MSc thesis, 2023/03
548

Osteopathic Manipulation as a Method of Cortisol Modification: A Systematic Review
Thibaut, D., Santarlas, V., Hoppes, J., Vásquez-Castillo, A., Morrow, A., Oviedo, E., Toldi, J.
Cureus, 2023/03
Free full text
549

Osteopathische Behandlung bei Rückenschmerzen. Akuter, nicht- spezifischer
(Osteopathic Manipulative Treatment for acute, non-specific Low Back Pain)
Jankovic-Preslmayer, M.
Unpublished MSc thesis, 2023/03
550

Die Messung der vertikalen Sprunghöhe bei VolleyballerInnen nach einer osteopathischen Behandlung
(Vertical jump height of volleyball players after an osteopathic treatment)
Archer, K.
Unpublished MSc thesis, 2023/03
551

Weibliche Genitalverstümmelung und Osteopathie
(Female genital mutilation and osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
552

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text
553

The Impact of Complementary and Integrative Medicine Following Traumatic Brain Injury: A Scoping Review
Kim, S., Mortera, M. H., Wen, P. S., Thompson, K. L., Lundgren, K., Reed, W. R., Sasson, N., Towner Wright, S., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
The Journal of Head Trauma Rehabilitation, 2023/02
Free full text
554

Abordaje de Manejo de dolor en Niños desde la perspectiva de la Medicina Alternativa
(Approach to Pain Management in Children from an Alternative Medicine Perspective)
Sierra Sánchez, A. P.
Unpublished MSc thesis, 2023/02
Free full text
555

Effectiveness of osteopathic treatment in patients with Lower Urinary Tract Symptoms (LUTS)
Arora, A., Ghosh, T.
Biomedicine, 2023/02
556

Einklemmungsphänomene als Ursache für eine Parese des N. abducens
(Entrapment phenomena as a cause of abducens nerve paresis)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
557

Fragen und die Existenz verschiedener Wahrheiten
(Questions and the existence of various truths)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
558

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
559

Neck pain service utilization and costs: association with timing of non-pharmaceutical services for individuals initially contacting a primary care provider. A retrospective cohort study
Elton, D., Zhang, M.
medRxiv, 2023/01
Free full text
560

An exploration of the experience of osteopaths managing individuals with endometriosis
Zeigler, Z. L.
Unpublished MSc thesis, 2023/01
Free full text
561

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text
562

“It's all about the story”. Osteopaths' experiences of exploring menopausal symptoms: A qualitative interview study
Gelli, N., Abbey, H.
International Journal of Osteopathic Medicine, 2023/01
563

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text
564

Concussion-related visual memory and reaction time impairment in college athletes improved after osteopathic manipulative medicine: a randomized clinical trial
Mancini, J. D., Angelo, N., Abu-Sbaih, R., Kooyman, P., Yao, S.
Journal of Osteopathic Medicine, 2023/01
Free full text
565

Effectiveness of osteopathic manipulative treatment in cardiovascular function: a systematic review protocol
Vanier, C., Johnston, K., DeArmond, M., Salloum, L., Arjmand, S., Toder, E., Ioudina, M.
JBI Evidence Synthesis, 2023/01
Free full text
566

What are the current rehabilitative approaches to ACL recovery post reconstruction surgery that osteopaths may implement?: A scoping review
Caughey, C.
Unpublished MSc thesis, 2023/01
Free full text
567

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Wang, M. Y., Ferguson, H., Bingham, J., Senger, B., Swogger, S. E., Johnston, R., Snider, K. T.
Journal of Osteopathic Medicine, 2023/01
568

(Osteopathy as a treatment proposal for patients with temporomandibular disorders: a systematic review)
Pereira de Paula, R., Oliveira da Silva Almeida, D., Garcia de Paula, G., Moreira Alves, L., Oliveira Silva, M., Rodrigues da Cunha, M., Iatecola, A., Ramos Fernandes, V.A., Rodrigues Silva, V., de França, E., Barroso Hirota, V.
Revista Multidisciplinar da Saúde, 2023
Free full text
569

Revisión sistemática: análisis de la terapia osteopática en la tendinitis del manguito rotador
(Analysis of the efficacy of osteopathic therapy in the treatment of rotator cuff tendinitis. A systematic review)
Sanchez, C., Alexandra, Y.
Unpublished MSc thesis, 2023
Free full text
570

The intersection of the two complimentary fields of preventive cardiology and integrative cardiology: A Fellow's voice
Cheung, B.
American Journal of Preventive Cardiology, 2022/12
Free full text
571

Corrigendum to “Treatment of infant colic with craniosacral therapy. A randomized controlled trial“ [Complement Ther Med 71 (2022) 102885]
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/12
Free full text
572

COVID-19 in Patients with Asthma: Review and Implications for Care of Adult Patients with an Osteopathic Component
Frasca, D. J., Wolf, S.
Osteopathic Family Physician, 2022/12
Free full text
573

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12
574

Wirksamkeit der osteopathischen Behandlung bei pädiatrischen Beschwerden: Eine systematische Übersichtsarbeit
(Effectiveness of osteopathic manipulative treatment in pediatric complaints: A systematic review)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2022/12
Free full text
575

ObiH – Osteopathie bei infantiler Haltungs asymmetrie und Plagiozephalie (Teil 2)
(ObiH - Osteopathy for infantile postural asymmetry and plagiocephaly (Part 2))
Klemm, S., Spiertz, M., Asche, M.
Osteopathische Medizin, 2022/12
576

Osteopathie als personenzentrierte und integrierende Behandlungsmethode (Teil 2)
(Osteopathy as a person-centered and integrative treatment method (Part 2))
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/12
577

Osteopathische Geriatrie. Teil 2: Behandlung - Prinzipien und Methoden
(Osteopathic geriatrics. Part 2: Treatment - Principles and methods)
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/12
578

The Role of Osteopathic Manipulative Medicine in the Rehabilitation of a Competitive Dancer after a Major Abdominal Surgery
Berenbeim, G., Figueroa, J.
The AAO Journal, 2022/12
Free full text
579

ObiH – Osteopathie bei infantiler Haltungs asymmetrie und Plagiozephalie (Teil 1)
(ObiH - Osteopathy for infantile postural asymmetry and plagiocephaly (Part 1))
Spiertz, M., Asche, M., Klemm, S.
Osteopathische Medizin, 2022/12
580

Effects of osteopathic manipulative treatment associated with pain education and clinical hypnosis in individuals with chronic low back pain: study protocol for a randomized sham-controlled clinical trial
Luchesi, G. L. S., da Silva, A. K. F., Amaral, O. H. B., de Paula, V. C. G., Jassi, F. J.
Trials, 2022/12
Free full text
581

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/12
582

Модель фасциальных дисторсий (FDM) Стивена Типальдоса с позиций современных исследований и терапевтических концепций
(Fascial Distortion Model (FDM) by Stephen Typaldos from the modern research and therapeutic concepts point of view)
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. E., Agasarov, L. G.
Russian Osteopathic Journal, 2022/12
583

Исследование возможности включения остеопатической коррекции в состав комплексной терапии синдрома тазовой боли у женщин в позднем послеродовом периоде
(Study of the possibility of osteopathic correction inclusion in the complex therapy of pelvic pain syndrome in women at the late postpartum period)
Chumakova, I. B., Nasibullina, R. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/12
584

Обоснование использования остеопатической коррекции в комплексном лечении пациентов с плечелопаточным болевым синдромом
(Substantiation of the possibility of using osteopathic correction in the complex treatment of patients with shoulder-shoulder pain syndrome)
Emelyanova, C. K., Zolkova, O. V., Kozlova, N. S.
Russian Osteopathic Journal, 2022/12
585

Использование аутоиммунологических показателей для оценки результатов остеопатической коррекции: пилотное исследование
(The use of autoimmunological parameters to evaluate the results of osteopathic correction: pilot study)
Ikhlef, A., Potekhina, Y. P., Tregubova, E. S., Kurbatov, O. I., Pukhalenko, A. I.
Russian Osteopathic Journal, 2022/12
586

Инфракрасная термография в исследовании результатов остеопатической коррекции у пациентов с ампутационными дефектами нижних конечностей
(Application of infrared thermography in the study of the osteopathic correction results in patients with amputation defects of the lower extremities)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2022/12
587

Возможности применения остеопатической коррекции у подростков с варикоцеле: пилотное исследование
(The possibilities of osteopathic correction using in adolescents with varicocele: a pilot study)
Kutsebo, Y. V., Shchuchkina, E. A., Kozlova, N. S.
Russian Osteopathic Journal, 2022/12
588

Остеопатическая коррекция в составе комплексного лечения дисфункции височно-нижнечелюстного сустава
(Osteopathic correction as part of the complex treatment of temporomandibular disorder)
Nesterov, A. M., Tsymbalov, E. E., Nikulina, M. A., Kantsepolsky, A. N.
Russian Osteopathic Journal, 2022/12
589

Эффекты остеопатической коррекции и возможности их исследования
(Effects of osteopathic correction and the possibility of their study)
Potekhina, Y. P., Tregubova, E. S., Mokhov, D. E.
Russian Osteopathic Journal, 2022/12
590

Остеопатическое лечение цервикалгии у врачей-стоматологов, испытывающих продолжительные профессиональные перегрузки
(Osteopathic treatment of cervicalgia in dentists experiencing prolonged professional overloads)
Usupbekova, B. S., Mombekova, S. A.
Russian Osteopathic Journal, 2022/12
591

Evaluation of Osteopathic Principles in Cadaveric Specimens Using Radiological Assessment
Siddiqi, I., Wang, A., Marino, M., Bowen, I., Miulli, D. E.
Cureus, 2022/12
Free full text
592

Pain and functional recovery from chronic low back pain over 12 months: implications for osteopathic medicine
Licciardone, J. C., Pandya, V.
Journal of Osteopathic Medicine, 2022/12
Free full text
593

Acupuncture and Osteopathic Medicine for Atopic Dermatitis – a Three-armed Randomized Controlled Explorative Clinical Trial
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Clinical and Experimental Dermatology, 2022/12
Free full text
594

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic neck pain: A single-blinded randomized controlled trial
Cholewicki, J., Popovich, J. M., Jr., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/12
595

The Touch Taboo: Origins for the Prohibition of Touch in Psychiatry and a Rational Osteopathic Approach
Huzij, T.
The AAO Journal, 2022/12
Free full text
596

Preliminary Results from a Randomized Controlled Trial on the Efficacy of Osteopathic Manipulative Medicine in Recovery from Concussions
Benedict, A. B., Torretta, C., Cholewicki, J., DeStefano, L. A., Fitton, N., Saffarian, M., Popovich, J. M., Zatkin, M., Lee, A., Sikorskii, A., Leslie, L., Shiver, Z.
Journal of Osteopathic Medicine, 2022/12
597

Effects of Osteopathic Manipulative Treatment on Primary Dysmenorrhea
Companion, N., Ahmed, E., Keys, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12
598

The Use of Osteopathic Manipulative Treatment (OMT) in the Management of Patients With Post-COVID Symptoms
Foss, V., Kaur, J., Stoukides, G., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12
599

Thomas L. Northup Lecture: Integrating Osteopathic Principles into Patient Care: An Approach for All Specialties
Snider, K.
The AAO Journal, 2022/12
Free full text
600

A Feasibility Study to Assess OMT for NAS
Householder, L., Glynn, B., Wadman, H., Hoffmann, K.
Journal of Osteopathic Medicine, 2022/12
601

Use of Osteopathic Manipulative Medicine in Treating Migraines
Lund, M., Pan, Y., Burns-Martin, J., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2022/12
602

Reduction in Stress Among Frontline Healthcare Workers Receiving Osteopathic Manipulation
Schnautz, R., Eilerman, A., Faherty, M.
Journal of Osteopathic Medicine, 2022/12
603

Impact of Osteopathic Manipulative Techniques on the Management of Dizziness Caused by Neuro-Otologic Disorders: Systemic Review and Meta-Analysis
Senger, B., Rehman, Y., Snider, K. T., Kirsch, J., Wang, M. Y.F., Johnston, R., Bingham, J., Ferguson, H., Swogger, S.
Journal of Osteopathic Medicine, 2022/12
604

Osteopathic Manipulative Treatment Efficacy in Mean HIT-6 Score Reduction in Tension-Type Headaches: A Meta-Analysis
Tran, E., Thomas, C., Zheng, T., Thalody, A., Winegar, A., Torelli, V., Wu, S. S.
Journal of Osteopathic Medicine, 2022/12
605

Efeitos do tratamento manipulativo osteopático nas manifestações musculoesqueléticas da fase crônica da febre Chikungunya : ensaio clínico randomizado
(Effects of osteopathic manipulative treatment on musculoskeletal manifestations in the chronic phase of Chikungunya fever: randomized clinical trial)
Tenório, L. C.
Unpublished MSc thesis, 2022/12
Free full text
606

A Randomized Controlled Trial of Osteopathic Manipulative Therapy to Reduce Cranial Asymmetries in Young Infants with Nonsynostotic Plagiocephaly
Bagagiolo, D., Priolo, C. G., Favre, E. M., Pangallo, A., Didio, A., Sbarbaro, M., Borro, T., Daccò, S., Manzoni, P., Farina, D.
American Journal of Perinatology, 2022/12
607

Diagnosis and management of headache disorders in osteopathic practice: A qualitative study
Tripodi, N., Cordina, J., Jaffre, D., Mason, K., McMahon, G., Xeureb-Graham, B., Yanovsky, R., Wospil, R.
International Journal of Osteopathic Medicine, 2022/12
608

Preliminary Effects of Osteopathic Manipulative Medicine on Reactive Oxygen Species in Parkinson’s Disease: A Randomized Controlled Pilot Study
Docherty, J., Leheste, J. R., Mancini, J, Yao, S.
Cureus, 2022/11
Free full text
609

Physiotherapists and Osteopaths' Attitudes: Training in Management of Temporomandibular Disorders
Saran, S., Saccomanno, S., Petricca, M. T., Carganico, A., Bocchieri, S., Mastrapasqua, R. F., Caramaschi, E., Levrini, L.
Dentistry Journal, 2022/11
Free full text
610

Le toucher en ostéopathie, une ouverture au dialogue et à la relation.
(Touch in osteopathy, an opening to dialogue and relationship)
Beaulieu, A.
Soins Pédiatrie/Puériculture, 2022/11
611

Osteopathic Manipulative Medicine for Chronic Pain in the Setting of Cerebral Palsy
Dixon, D. S., Elwert, N. C., McDermott, G. A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/11
612

Osteopathy: effectiveness and safety for musculoskeletal pain and overview of training and quality requirements. AIHTA Project Report No.: 144 2022
Gassner, L., Hofer, V.
HTA Austria – Austrian Institute for Health Technology Assessment GmbH, 2022/11
Free full text
613

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/11
Free full text
614

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11
615

Model-Base Estimation of Non-Invasive Ventilation Weaning of Preterm Infants Exposed to Osteopathic Manipulative Treatment: A Propensity-Score-Matched Cohort Study
Tarantino, A. G., Vismara, L., Buffone, F., Bianchi, G., Bergna, A., Vanoni, M., Tabbi, C., Bresesti, I., Agosti, M.
Healthcare, 2022/11
Free full text
616

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text
617

The Benefits of Integrative Medicine in the Management of Chronic Pain: A Review
Trivedi, H., Avrit, T. A., Chan, L., Burchette, M., Rathore, R.
Cureus, 2022/10
Free full text
618

Effect of osteopathic techniques on human resting muscle tone in healthy subjects using myotonometry: a factorial randomized trial
Bohlen, L., Schwarze, J., Richter, J., Gietl, B., Lazarov, C., Kopyakova, A., Brandl, A., Schmidt, T.
Scientific Reports, 2022/10
Free full text
619

Effects of osteopathic manipulative treatment of the pivots on lower limb function in young professional football players
Thomas, E., Petrucci, M., Barretti, M., Messina, G., Cavallaro, A. R., Bianco, A.
Journal of Bodywork and Movement Therapies, 2022/10
620

Osteopathic manipulative treatment use among family medicine residents in a teaching clinic
Caldwell, G., Zeng, L., Kaufman, J., Bates, J.
Journal of Osteopathic Medicine, 2022/10
Free full text
621

Postoperative Osteopathic Manipulative Treatment in Children with Esophageal Atresia: Potential Benefits on the Anthropometric Parameters
Manzotti, A., Alati, A., Galli, M., Cerritelli, F., Leva, C., Alberti, A., Stizzoli, A., Costanzo, S., Canonica, C. P. M., Destro, F., Zuccotti, G., Calcaterra, V., Pelizzo, G.
Pediatric Reports, 2022/10
622

Osteopathie in relatie tot menstruatieklachten bij een patiënte die lijdt aan endometriose en adenomyose. Een casestudie
(Osteopathy in relation to menstrual complaints in a patient who is suffering from endometriosis and adenomyosis. A case study)
den Braver- Scherpenzeel, M. R.
unpublished D.O. thesis, 2022/10
Free full text
623

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
624

Chronischer Reizhusten in der osteopathischen Praxis
(Chronic dry cough in osteopathic practice)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
625

Traumasensible Vorgehensweise in der osteopathischen Praxis
(Trauma-sensitive approach in osteopathic practice)
Heuer, I., Tann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
626

Die Rolle der Osteopathie im Geburtsprozess – eine qualitative Studie
(The role of osteopathy in the birth process - a qualitative study)
Janisz, M., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
627

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie – Teil 2
(Positional plagiocephaly: The role of brainstem sensitization in the pathophysiology of positional plagiocephaly - Part 2)
Zweedijk, R.
Osteopathische Medizin, 2022/09
628

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text
629

Zirkumventrikuläre Organe und phänodynamische Osteopathie
(Circumventricular organs and phenodynamic osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
630

Остеопатический статус лиц, перенесших новую коронавирусную инфекцию, через 3–6 мес после заболевания
(Osteopathic status in people who have had a new coronavirus infection, 3–6 months after the disease)
Aptekar, I. A., Abramova, E. V.
Russian Osteopathic Journal, 2022/09
631

Обоснование использования остеопатической коррекции при плановой подготовке больных к общей анестезии с интубацией трахеи
(Justification of the use of osteopathic correction in the planned preparation of patients for general anesthesia with tracheal intubation)
Kurnoskin, V. L., Kurbatov, O. I.
Russian Osteopathic Journal, 2022/09
632

Исследование эффективности остеопатической коррекции вальгусной деформации I пальца стопы I–II степени
(Study of the effectiveness of osteopathic correction of the Ist toe valgus deformity of the I–II degree)
Minakova, A. L., Ustinov, A. V.
Russian Osteopathic Journal, 2022/09
633

Современные подходы к остеопатической диагностике, её теоретические и практические основы
(Modern approaches to osteopathic diagnostics, its theoretical and practical foundations)
Mokhov, D. E., Potekhina, Y. P., Gurichev, A. A.
Russian Osteopathic Journal, 2022/09
634

Влияние остеопатической коррекции на качество жизни беременных
(The impact of osteopathic correction on the life quality of pregnant women)
Nenashkina, E. N.
Russian Osteopathic Journal, 2022/09
635

Мультидисциплинарный подход при лечении хронической головной боли напряжения на фоне COVID-19
(Multidisciplinary approach in the treatment of chronic tension headache on the background of COVID-19)
Novikov, Y. O., Akopian, A. P., Amigues, F. A.
Russian Osteopathic Journal, 2022/09
636

Влияние остеопатической техники сбалансированного лигаментозного натяжения (BLT) на LV при люмбалгии
(Effects of Balanced Ligamentous Osteopathic Technique over LV in low back pain)
Schenone, L. E.
Russian Osteopathic Journal, 2022/09
637

Обоснование экономической эффективности авторской мануальной методики вправления вывиха плеча
(Substantiation of the economic efficiency of the author′s manual repositioning method of the shoulder joint)
Slabospitskii, M. A., Mokhov, D. E., Limarev, V. V., Tkachenko, P. V., Tkachenko, A. N., Mansurov, D. S., Khaydarov, V. M.
Russian Osteopathic Journal, 2022/09
638

The Portuguese osteopaths attitudes towards a biomechanical or biopsychosocial model in the approach of chronic low back pain – A cross-sectional questionnaire-based survey
Dinis, M., Silva, C., Cruz, R., Esteves, J., Nunes, A.
International Journal of Osteopathic Medicine, 2022/09
639

Case Report on Visceral Manipulation in Adolescent Idiopathic Scoliosis
Chahab, M., Donnet, P., Hernandez, D.
International Journal of Therapeutic Massage and Bodywork, 2022/09
640

Interaktion zwischen Gehirn und Herz: Modifikation der Interaktion zwischen Gehirn und Herz bei chronischen Schmerzen durch osteopathische Behandlung
(Interaction between brain and heart: modification of brain-heart interaction in chronic pain by osteopathic treatment)
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Osteopathische Medizin, 2022/09
641

Osteopathie als personenzentrierte und integrierende Behandlungsmethode – Teil 1
(Osteopathy as a person-centered and integrative treatment method - Part 1)
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/09
642

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09
643

Osteopathische Behandlung von Patienten mit episodischer Migräne. Prospektive, multizentrische, kontrollierte randomisierte Studie
(Osteopathic treatment of patients with episodic migraine. Prospective, multicenter, controlled randomized study)
Stolzmann, K., Ziller, M., Britz, I., de Braganca, L., Thielen, F.
Unpublished D.O. thesis, 2022/09
644

Die Behandlung der idiopathischen Asymmetrie und lagebedingten Plagiozephalie bei Säuglingen im ersten Lebensjahr. Eine systematische Literaturrecherche
(The treatment of idiopathic asymmetry and positional plagiocephaly in infants in the first year of life. A systematic literature review)
Daake, B.
Unpublished D.O. thesis, 2022/09
645

Osteopathische Behandlung von Frauen mit Beckengürtelschmerz post partum (PPGP). Randomisierte kontrollierte Studie
(To evaluate the effectiveness of custom tailored osteopathic treatment in women suffering from pelvic girdle pain after childbirth.)
Richterink, J., Bruns, A.
Unpublished D.O. thesis, 2022/09
646

Lassen sich durch osteopathische Behandlungen von Patienten mit gastroösophagealem Reflux zusätzlich zur medikamentösen Standardbehandlung die Symptome verbessern? Randomisierte kontrollierte Studie
(Osteopathic treatment in addition to medical standard therapy in patients with Gastroesophageal Reflux Disease (GERD). A randomized controlled trial.)
Dannmeyer, A., Severin, F., Stisser, C.
Unpublished D.O. thesis, 2022/09
647

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text
648

Comparing In-person vs. Live-streamed Osteopathic Manual Medicine Lab Instruction
Ellis, M., Finneran, K., Jie, C., Lewis, D.
The AAO Journal, 2022/09
Free full text
649

Osteopathic Manipulative Treatment for Optic Pathway Glioma
Gordon, S., Hagopian, S.
The AAO Journal, 2022/09
Free full text
650

Treatment of infant colic with craniosacral therapy. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/09
Free full text
651

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text
652

Effectiveness of Osteopathic Manipulation Treatment in the Rehabilitation of Post-External Immobilization for a Supracondylar Fracture of the Distal Humerus: A Case Report
Paiva, A., Bruntmyer, H. C.
The AAO Journal, 2022/09
Free full text
653

Thoracic outlet syndrome due to first rib subluxation in a 69-year-old woman
Deveze, E., Daligault, M., Ammi, M., Picquet, J.
Annals of Vascular Surgery - Brief Reports and Innovations, 2022/09
Free full text
654

Investigating the safety and feasibility of osteopathic medicine in the pediatric oncology outpatient setting
Belsky, J. A., Stanek, J. R., Rose, M. J.
Journal of Osteopathic Medicine, 2022/08
Free full text
655

Effectiveness of osteopathic interventions in patients with non-specific neck pain: A systematic review and meta-analysis
Dal Farra, F., Buffone, F., Risio, R. G., Tarantino, A. G., Vismara, L., Bergna, A.
Complementary Therapies in Clinical Practice, 2022/08
656

“What you feel under your hands“: exploring professionals' perspective of somatic dysfunction in osteopathic clinical practice-a qualitative study
Arcuri, L., Consorti, G., Tramontano, M., Petracca, M., Esteves, J. E., Lunghi, C.
Chiropractic & Manual Therapies, 2022/08
Free full text
657

Osteopathic Treatment for Gastrointestinal Disorders in Term and Preterm Infants: A Systematic Review and Meta-Analysis
Buffone, F., Monacis, D., Tarantino, A. G., Farra, F., Bergna, A., Agosti, M., Vismara, L.
Healthcare, 2022/08
Free full text
658

The Role of Osteopathic Care in Gynaecology and Obstetrics: An Updated Systematic Review
Ruffini, N., D', Alessandro, G., Pimpinella, A., Galli, M., Galeotti, T., Cerritelli, F., Tramontano, M.
Healthcare, 2022/08
Free full text
659

Response to “Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine“
Marshall, S.
Journal of Osteopathic Medicine, 2022/08
Free full text
660

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text
661

Cranial osteopathic techniques and electroencephalogram (EEG) alpha power: a controlled crossover trial
Cella, M., Acella, E., Aquino, A., Pisa, V.
Journal of Osteopathic Medicine, 2022/08
Free full text
662

Effectiveness of Osteopathic Treatment on the Spinal Column as Measured by the Spinal Mouse®: A Case Series
Colati, R., Pagano, A.
Cureus, 2022/08
Free full text
663

Osteopathic Manipulative Treatment and the Management of Headaches: A Scoping Review
Jara Silva, C. E., Joseph, A. M., Khatib, M., Knafo, J., Karas, M., Krupa, K., Rivera, B., Macia, A., Madhu, B., McMillan, M., Burtch, J., Quinonez, J., Albert, T., Khanna, D.
Cureus, 2022/08
Free full text
664

Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine
Sookaromdee, P., Wiwanitkit, V.
Journal of Osteopathic Medicine, 2022/08
Free full text
665

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08
666

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07
667

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text
668

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text
669

Osteopathic Manipulative Treatment for Pediatric Conditions: An Update of Systematic Review and Meta-Analysis
Posadzki, P., Kyaw, B. M., Dziedzic, A., Ernst, E.
Journal of Clinical Medicine, 2022/07
Free full text
670

Interventions non-pharmacologiques et syndrome de l’intestin irritable: revue de la littérature et méthodologie des essais thérapeutiques pour l’évaluation de l’efficacité de l’ostéopathie
(Nonpharmacological interventions and irritable bowel syndrome: review of the literature and methodology of therapeutic trials for the evaluation of the effectiveness of osteopathy)
Amsallem, F.
Unpublished PhD thesis, 2022/07
Free full text
671

Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects
Gawrys, S. P., Bradshaw, J. T., Parker, L. M.
Journal of Osteopathic Medicine, 2022/07
Free full text
672

Osteopathic practice in the United Kingdom: A retrospective analysis of practice data
Plunkett, A., Fawkes, C., Carnes, D.
PLoS One, 2022/07
Free full text
673

Successful Osteopathic Manipulative Treatment of Foot Drop
Tafler, L., Katz, V., Kolesnikov, V., Singh, R.
Cureus, 2022/07
Free full text
674

Reduction and Resolution of a Hiatal Hernia Using Osteopathic Manipulative Treatment: A Case Report
Volokitin, M., Song, A., Peck, M. T., Milani, S.
Cureus, 2022/07
Free full text
675

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07
676

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07
677

Resolution of rosacea-associated persistent facial edema with osteopathic manipulative treatment
Jay, R., Rodger, J.
JAAD Case Reports, 2022/07
Free full text
678

Effectiveness of osteopathic manipulative treatment for pediatric conditions: A systematic review
Franke, H, Franke, J.D., Fryer, G.
Journal of Bodywork and Movement Therapies, 2022/07
679

Response to “Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects“
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2022/07
Free full text
680

Wirkung osteopathischer Behandlungen im 1. Lebensjahr
(Effect of osteopathic treatments in the 1st year of life)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
681

Técnicas osteopáticas para la liberación emocional: Monografía
(Osteopathic Techniques for Emotional Release: Monograph)
Vallecia Barragán, L. J.
Unpublished MSc thesis, 2022/07
Free full text
682

Osteopathic Manipulative Treatment for Refractory Gastroesophageal Reflux Disease (GERD)
Yassin, K., Mutter, C., Waters, H., Mehra, R.
The AAO Journal, 2022/06
Free full text
683

Holistic osteopathic approach to the care of veterans with post-traumatic stress disorder: Case report
Lovy, A., Berkowitz, M. R.
The AAO Journal, 2022/06
Free full text
684

The Effect of Osteopathic Manipulative Treatment in Pregnancy on Labor Duration: A Meta-Analysis
Zak, A., Streeter, E., Tran, N., Wales, A., Yep, M., Rowane, M.
The AAO Journal, 2022/06
Free full text
685

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie –Teil 1
(Positional plagiocephaly: the role of brainstem sensitization in the pathophysiology of positional plagiocephaly -Part 1)
Zweedijk, R.
Osteopathische Medizin, 2022/06
686

Reply to Kudus, A.L. Comment on “Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845“
Brandl, A., Egner, C., Schleip, R.
Life (Basel), 2022/06
Free full text
687

Остеопатическое лечение новорожденных и грудных младенцев: эффективность и связанные с ним риски (систематический обзор англоязычной и франкоязычной литературы)
(Osteopathic treatment of newborns and infants: efficiency and associated risks (a systematic review of literature in English and in French))
Maroye, L., Klein, P., Dethier, C., Dugailly, P.M.
Russian Osteopathic Journal, 2022/06
688

Применение остеопатической коррекции в комплексной реабилитации пациентов с острым нарушением мозгового кровообращения
(The use of osteopathic correction in the complex rehabilitation of patients with acute cerebrovascular accident)
Belash, V. O., Gritsay, E. O., Musina, T. S.
Russian Osteopathic Journal, 2022/06
689

Остеопатический статус родильниц после спинномозговой анестезии и возможности его коррекции
(Osteopathic status of maternity patients after spinal anesthesia and the possibility of its correction)
Bobrova, A. S., Shkryabina, A. M., Khatkevich, A. K., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/06
690

Comment on Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845
Kudus, A. L.
Life (Basel), 2022/06
Free full text
691

Osteopathy and physiotherapy compared to physiotherapy alone on fatigue in long COVID: Study protocol for a pragmatic randomized controlled superiority trial
Certain Curi, A. C., Antunes Ferreira, A. P., Calazans Nogueira, L. A., Mello Meziat Filho, N. A., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2022/06
Free full text
692

Возможность применения остеопатических методов коррекции в терапии лицевой боли
(The possibility of osteopathic correction methods in the treatment of facial pain)
Popov, A. S.
Russian Osteopathic Journal, 2022/06
693

The influence of cultural philosophies on clinical practice of spinal manipulation: A comparison in Chinese manipulative therapy versus New Zealand osteopathy for the treatment of musculoskeletal disorders
Zhao, Y.
Unpublished MSc thesis, 2022/06
694

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06
695

Osteopathic Evaluation and Positional Plagiocephaly: A Descriptive Study on a Population of Children with ASD
Di Renzo, M., Laurenti, A., Di Castelbianco, F. B., Vanadia, E., Petrillo, M., D’Errico, S., Ferrara, R., Racinaro, L., Rea, M.
American Journal of Pediatrics, 2022/06
Free full text
696

Comparison of the Effect of Osteopathic Manipulations and Exercises on the Myoelectric Activity of the Pelvic Floor: A Randomized Controlled Trial
Arcanjo, G. N., Pires, Jlvr, Jacinto, M. E. M., Colares, J. M., Belo, L. M. C., Lima, P. O. P., Vilaça-Alves, J.
Journal of Chiropractic Medicine, 2022/06
697

Adjunctive osteopathic therapy for hospitalized COVID-19 patients: A feasibility-oriented chart review study with matched controls
Lennon, R. P., Dong, H., Zgierska, A. E., Demetriou, T., Croad, J., Livelsberger, C., Hodge, L., Mendez-Miller, M., Darby, A., Rabago, D.
International Journal of Osteopathic Medicine, 2022/06
698

Tongue stretching: technique and clinical proposal
Buscemi, A., Coco, M., Rapisarda, A., Frazzetto, G., Di Rosa, D., Feo, S., Piluso, M., Presente, L. P., Campisi, S. S., Desirò, P.
Journal of Complementary and Integrative Medicine, 2022/06
Free full text
699

Effect of Physique on Medical Students’ Perceived Physical Ability to Perform Osteopathic Manipulative Treatment (OMT)
Than, S., Santos, L., Lin, X., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text
700

The Successful Use of Osteopathic Manipulative Treatment (OMT) for Positional Plagiocephaly: Now He's an Ambi-turner!
Harris, Z., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
701

Abnormal Foot Progression Angle Kinematics in Cervical Dystonia Improved After Osteopathic Manipulative Medicine: A Prospective Case Series
Mancini, J., Oliff, Z., Abu-Sbaih, R., Simone, J., LaRosa, A., Mody, S., Li, T. S., Leder, A.
Cureus, 2022/06
Free full text
702

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text
703

A long COVID patient and their experience of osteopathic care: A case report
Monro, M.
International Journal of Osteopathic Medicine, 2022/06
704

An Osteopathic Manipulative Treatment (OMT) Evaluation and Treatment Protocol to Improve Gastrointestinal Function
Heineman, K.
The AAO Journal, 2022/06
Free full text
705

Исследование эффективности остеопатической коррекции пекталгического синдрома у студентов
(Study of the osteopathic correction effectiveness of pectalgic syndrome in students)
Valiullova, L. V., Gilmutdinova, G. R., Safiullina, A. A.
Russian Osteopathic Journal, 2022/06
706

Сравнительный анализ остеопатической коррекции и стандартной комплексной реабилитации пациентов с посттравматическими контрактурами суставов верхней конечности
(Comparative analysis of osteopathic correction and standard comprehensive rehabilitation of patients with posttraumatic contractures of the upper limb joints)
Zamanov, A. R., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2022/06
707

Osteopathic Manipulation of Pelvic Floor Muscle Dysfunction Improves Chronic Lower Back Pain
Torres, J.
The AAO Journal, 2022/06
Free full text
708

Исследование потребительских ожиданий и требований к качеству услуг по остеопатии у родителей несовершеннолетних пациентов
(A study of consumer expectations and requirements for the quality of osteopathic services in parents of minor patients)
Vinitskaya, T. V.
Russian Osteopathic Journal, 2022/06
709

Response to Osteopathic Manipulative Treatment in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
Bomani-Bailey, A., Xu, T., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
710

Variations in Average Cranial Rhythmic Impulse Rates
Crider, T., Grimm, J., Kozar, A., Tobey, A. H.
The AAO Journal, 2022/06
Free full text
711

An Osteopathic Approach to Secondary Enuresis and Encopresis: Recovering Autonomic Stability
Goodman, F., Ammons, R., Gebhardt, G., Largent, J.
The AAO Journal, 2022/06
Free full text
712

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
713

SCIWORA: A Pediatric Case
Masterson, C., Byrd, A., Gebhardt, G.
The AAO Journal, 2022/06
Free full text
714

The effect of longitudinal osteopathic experiences on family medicine resident confidence and utilization of osteopathic manipulative treatment
Matsushita, S., Lee, E., Pipitone, O., Vester, A.
The AAO Journal, 2022/06
Free full text
715

Nurturing the Breath of Life: A Retrospective Analysis of the Effect of Osteopathic Manipulative Treatment on Patients Ventilated for COVID-19
Murphy, S., Mercer, A., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
716

A Randomized Pilot Study Comparing Bilirubin Levels of Newborns Treated with Osteopathic Manipulative Treatment (OMT) Versus Routine Newborn Care Alone
Stephenson, C. M., Fremarek, N., Lentz, A., Klene-Bowns, A., Boeve, M., Brinsky, K., Chatterley, L., Yarling, C., Caldwell, G., Grundwaldt, D.
The AAO Journal, 2022/06
Free full text
717

Osteopathic Manipulative Treatment plus Phototherapy in the Management of Neonatal Hyperbilirubinemia: A Case Report
Zylinski, B. L., Stephenson, C. M., Dean, A. L., Rajala, J. W., Miller, D. J.
The AAO Journal, 2022/06
Free full text
718

Picking Apples and Somatic Dysfunctions: A Case Study of Osteopathic Manipulative Treatment in the Farmworker Community
Ackerman, K., Gavin, K., Johnson, D.
The AAO Journal, 2022/06
719

The Effects of a Novel Virtual Reality Osteopathic Manipulative Medicine Program on First Year Practical Exam Scores
Ahmed, E., Jose, J., Stout, R., Yao, S. C.
The AAO Journal, 2022/06
Free full text
720

Augmentation of Immune Response to COVID-19 mRNA Vaccination Through Osteopathic Manipulative Treatment
Ahn, B., Martinez, E., Hadiprodjo, H., Jackson, C., Gutierrez, M., Crone, P., Loveless, B., Fuchs, S., Szurmant, H., Sanchez, J.
The AAO Journal, 2022/06
Free full text
721

Utilizing Osteopathic Manipulative Techniques to Mitigate Fall Risk Among Hospitalized Elderly Patients: A Literature Review
Arshad, U., Baum, B., Carter, R., Gustowski, S.
The AAO Journal, 2022/06
Free full text
722

Upper Cross Syndrome and a Guarded Heart: Posture in a Case of Depression
Benzell, J. A., Abend, D., Bailey, J., Cooley, D., King Channell, M.
The AAO Journal, 2022/06
Free full text
723

Osteopathic Manipulative Treatment of Individual with Intractable Singultus
Bloch, R., Kempa, M., Lippert, J.
The AAO Journal, 2022/06
Free full text
724

SOAP Note Review: Evaluating Osteopathic Principles and Practice in Clinical Education
Budny, B., Gigliotti, D., Diggs, B., Fotopoulos, T., Johns, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text
725

An Osteopathic Approach to Chronic Pelvic Pain
Cameron, D. L., Mainville, M., Wallace-Ross, J.
The AAO Journal, 2022/06
Free full text
726

Effects of Osteopathic Manipulative Treatment (OMT) on Anosmia and Ageusia in Post-COVID-19 Patient: A Case Report
Companion, N., Ventimiglia, M., Yao, S. C.
The AAO Journal, 2022/06
Free full text
727

An Uncommon Cause of Common Peroneal Nerve Paresthesia: The Effect of Osteopathic Manipulative Treatment on Ganglion Cyst-Induced Common Peroneal Nerve Paresthesia
Cortes, M., Shah, N., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
728

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
729

Relief of Post-COVD-19 Burning Mouth Syndrome (BMS) with OMM- A case study
Frankini, E. L., Leder, A., Yao, S. C.
The AAO Journal, 2022/06
Free full text
730

Body-Mind-Spirit Connection as an Approach to Treatment of Spasmodic Torticollis
Haley, L., Clark, M., Litman, R., Heller, G.
The AAO Journal, 2022/06
Free full text
731

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
732

Osteopathic Manipulative Treatment may be a Cost-Effective Approach to Reducing Pain Associated with Acute Flare of Interstitial Cystitis
Hermann, S. J., Barnett, M. E., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
733

Effects of Osteopathic Manipulative Therapy on Temporomandibular Joint Disorders
Honeyman, J., Robke, B., Reed, G., Jacob, L., O'Donnell, M., Lynch, W. D., Moore, W.
The AAO Journal, 2022/06
Free full text
734

Out of Place: An Osteopathic Approach to Recurrent Shoulder Dislocations in an Ehlers Danlos Patient
Lambros, S., Tuyn, D., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
735

Effect of Medical School Experiences on Perceived Likelihood of Performing Osteopathic Manipulative Treatment (OMT) in Future Practice
Lin, X., Santos, L., Than, S., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text
736

Managing Muscle Rigidity: An Osteopathic Approach to the Treatment of Stiff Person Syndrome
Mainville, M., Cameron, D. L., Barry, P.
The AAO Journal, 2022/06
Free full text
737

Osteopathic Manipulative Treatment of the Deep Fascia for the Treatment of Chronic Trauma-induced Somatic Dysfunction
Nelson, C., Henderson, J., Kim, C., Le, B., Mintier, K.
The AAO Journal, 2022/06
Free full text
738

The Soft Tissue Clinic Experience (SCTE): A sustainable way for early medical students to develop patient interaction and manipulative treatment skills
Ouyang, Z., Murphy, R., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
739

An Osteopathic Approach to Childhood Scoliosis and Leg Length Inequality in a Pediatric Patient with Chiari I Malformation
Schultz, R., Baig, Y., Henderson, K. K., Heinking, K. P.
The AAO Journal, 2022/06
Free full text
740

Establishing OMT as a Key Treatment Modality in Injury Rehabilitation: Teres Major Tear
Shah, N., Cortes, M., Posey, A.
The AAO Journal, 2022/06
Free full text
741

Osteopathic Manipulative Therapy Effects on Prolonged Post-COVID Olfactory Dysfunction
Stenta, M. E., Bacon, C., Haile, Z. T., Walkowski, S. A.
The AAO Journal, 2022/06
Free full text
742

Novel Lymphatic Counterstrain (LC) in a Case of Low Ankle Sprain
Trinh, D., Henderson, J., Goering, E.
The AAO Journal, 2022/06
Free full text
743

Uncovering Trigger Points Masked by Lumbar Radiculopathy
Tuyn, D., Lambros, S., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
744

“Skateboard to the Head” A Case of Persistent Headaches Following Blunt Eye Trauma
Williams, D., Richie, C.
The AAO Journal, 2022/06
Free full text
745

Restricted Shoulder Range of Motion: A Neglected Component That May Surprise You
Williams, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text
746

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text
747

Das Karpaltunnelsyndrom in der Schwangerschaft aus osteopathischer Sicht
(Carpal tunnel syndrome in pregnancy from an osteopathic point of view)
Schneider-Milo, U.
Akupunktur Praxis, 2022/05
748

Complementary medicine visits by palliative care patients: a cross-sectional survey
Steel, Amie, Schloss, Janet, Diezel, Helene, Palmgren, Per J., Maret, Jean Baptiste, Filbet, Marilène
BMJ Supportive and Palliative Care, 2022/05
749

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text
750

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text
751

The Importance of Pelvic and Leg Length Assessment in the Setting of Postpartum Lower Back Pain
Tafler, L., Wilson, D., Tafler, P.
Cureus, 2022/05
752

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text
753

Effect of osteopathic manipulation of the sacroiliac joint vs electrotherapy on pain and functional disability in patients with low back pain: A pilot study
Rodríguez-Pastor, J. A., Caro-Puértolas, B., Caña-Pino, A., Sánchez-Preciado, A. M., Garrido-Ardila, E. M., Apolo-Arenas, M. D.
Journal of Back and Musculoskeletal Rehabilitation, 2022/05
754

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05
755

Association of sleep quality and chronification of musculoskeletal pain in an older adult: A case report
Westendorp, R., Thaker, V., Srbely, J.
International Journal of Osteopathic Medicine, 2022/05
756

Effects of osteopathic manipulative treatment vs. osteopathic cranial manipulative medicine on Parkinsonian gait
Terrell, Z. T., Moudy, S. C., Hensel, K. L., Patterson, R. M.
Journal of Osteopathic Medicine, 2022/05
Free full text
757

Evaluation de la qualité de la prise en charge ostéopathique de patientes souffrant de douleurs chroniques pelviennes dues à l'endométriose : une série de cas
(Assessing the quality of osteopathic management of patients with chronic pelvic pain due to endometriosis: a case series)
Litzistorf, S., Pires, N.
Unpublished MSc thesis, 2022/04
Free full text
758

An updated brief overview on post-traumatic headache and a systematic review of the non-pharmacological interventions for its management
Argyriou, A. A., Mitsikostas, D. D., Mantovani, E., Litsardopoulos, P., Panagiotopoulos, V., Tamburin, S.
Expert Review of Neurotherapeutics, 2022/04
Free full text
759

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text
760

Incidence Rate of Somatic Dysfunction in Previously Undiagnosed Spotted Fever Rickettsiosis: A Case Report
Unger, M. D., Palmer, J. L., Thorsvik, N. M.
Cureus, 2022/04
Free full text
761

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text
762

The effect of osteopathic manipulative treatment on anaerobic performance and lactate clearance in male athletes: a double-blind, randomized, sham-controlled, crossover study
Akkaş, M. B., Belviranli, M., Okudan, N.
The Journal of Sports Medicine and Physical Fitness, 2022/04
763

Osteopathic management of dysmenorrhea: A qualitative snapshot of New Zealand women’s experiences
Leys, A. E.
Unpublished MSc thesis, 2022/04
Free full text
764

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text
765

Comparative assessment of osteopathy technique with manual therapy associated with biofeedback in patients with the lumbar spine pain.
Mańko, G., Jekiełek, M., Sosulska, A., Pieniążek, M., Jaszczur-Nowicki, J.
Medical Rehabilitation, 2022/04
Free full text
766

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) residency curriculum guidelines to meet Accreditation Council for Graduate Medical Education (ACGME) milestones
Balyakina, E. S., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2022/04
Free full text
767

Retention of tissue texture change after cervical muscle energy and high velocity low amplitude intervention: implications for treatment intervals
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2022/04
Free full text
768

A Review of Glymphatics and the Impact of Osteopathic Manipulative Treatment in Alzheimer's Disease, Concussions, and Beyond
Marino, M. A., Petrova, S., Sweiss, R., Duong, J., Miulli, D. E.
Cureus, 2022/03
Free full text
769

Osteopathie bei Atopischer Dermatitis - eine randomisiert kontrollierte monozentrische explorative Studie
(Osteopathy in Atopic Dermatitis - a randomised controlled monocentric exploratory trial)
Ahnert, M. W.
Unpublished PhD thesis, 2022/03
Free full text
770

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text
771

Эффективность реабилитации пациентов после перенесенной ковид-пневмонии методами остеопатии
(The effectiveness of rehabilitation of patients after covid pneumonia with osteopathic methods)
Belyaev, A. F., Fotina, O. N., Kharkovskaya, T. S., Yurchenko, A. A.
Russian Osteopathic Journal, 2022/03
Free full text
772

Отдаленные результаты совместного применения логопедической и остеопатической коррекции у детей 5–6 лет с дизартрией
(Long-term results of combined use of speech therapy and osteopathic correction in 5–6 year old children with dysarthria)
Bychkova, E. Y., Sandakov, A. V., Kuzmina, Y. O.
Russian Osteopathic Journal, 2022/03
Free full text
773

Исследование эффективности остеопатической коррекции в лечении пациентов детского возраста с идиопатическим сколиозом I степени
(Investigation of the osteopathic correction effectiveness in the treatment of pediatric patients with idiopathic scoliosis of the first degree)
Kamaletdinov, V. L., Kamaletdinova, O. V., Safin, R. F.
Russian Osteopathic Journal, 2022/03
Free full text
774

Инструментальные методы и технические средства для оценки результатов остеопатической коррекции у пациентов после ампутации нижних конечностей
(Instrumental methods and technical means for assessing the results of osteopathic correction in patients after lower limb amputation)
Kolyshnitsyn, N. Y., Mokhov, D. E.
Russian Osteopathic Journal, 2022/03
Free full text
775

Исследование сочетанного применения остеопатической коррекции и ЭЭГ-БОС-тренингов у детей с синдромом дефицита внимания и гиперактивности
(Study of the combined use of osteopathic correction and EEG-biofeedback training in children with attention deficit hyperactivity disorder)
Kudryashova, V. G., Chetverikova, N. A.
Russian Osteopathic Journal, 2022/03
Free full text
776

Эффекты остеопатических методов уравновешивания сфенобазилярного синхондроза и разделения переднерешетчатого шва у детей с узким нёбом
(Effects of osteopathic techniques of balancing SEB and separating the front-ethmoid suture in children with narrow palate)
Quesada, B. M.
Russian Osteopathic Journal, 2022/03
Free full text
777

Возможность применения остеопатических методов коррекции в терапии миофасциального болевого синдрома
(Possibility of using osteopathic methods of correction in the treatment of myofascial pain syndrome)
Safiullina, A. A., Safiullina, G. I.
Russian Osteopathic Journal, 2022/03
Free full text
778

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text
779

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text
780

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
781

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text
782

Patellofemoral pain syndrome: a review of the literature with osteopathic emphasis
Balint, T., Jones, J., Paquette, M., Amalfitano, J.
The AAO Journal, 2022/03
Free full text
783

Osteopathic Approach to Treatment of Radial Head Dysfunction: The Radial Head Range of Motion Technique
Ellis, M. M., Lewis, D. D.
The AAO Journal, 2022/03
Free full text
784

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text
785

Efficacy and Feasibility of an Osteopathic Intervention for Neurocognitive and Behavioral Symptoms Usually Associated With Fetal Alcohol Spectrum Disorder
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., García-Algar, Ó.
Frontiers in Behavioral Neuroscience, 2022/03
Free full text
786

Результаты остеопатической коррекции у детей и подростков с недифференцированной дисплазией соединительной ткани
(Results of osteopathic correction in children and adolescents with undifferentiated connective tissue dysplasia)
Valiev, K. R., Vildanov, I. K., Zyatdinov, R. R., Gainullin, I. R.
Russian Osteopathic Journal, 2022/03
Free full text
787

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
788

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
789

In bestimmter Weise auf jemanden wirken …
(To affect someone in a certain way...)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
790

Nebennierendysfunktion als Schlüssel bei therapieresistentem Zervikalsyndrom: Ein Fallbericht
(Adrenal gland dysfunction as a key in therapy-resistant cervical syndrome: a case report.)
Ebner, M.
Osteopathische Medizin, 2022/03
791

Vom Selbsterleben osteopathischer Praxis im Wirk-Bündnis der Tastwelt: Phänomenologisch-anthropologischer Bericht einer tastenden Praxis
(From the self-perception of osteopathic practice in the active alliance of the world of touch: Phenomenological-anthropological report of a practice of touching)
Kaiser, A. K.
Osteopathische Medizin, 2022/03
792

Osteopathische Diagnostik und Behandlung funktioneller Gallenblasendyskinesien: Eine qualitative Interviewstudie
(Osteopathic diagnosis and treatment of functional gallbladder dyskinesia: A qualitative interview study)
Roth, P., Belz, S.
Osteopathische Medizin, 2022/03
793

Efeitos da abordagem osteopática em neonatos com dificuldade na biomecânica da amamentação: ensaio clínico randomizado
(Effects of the osteopathic approach in neonates with difficulties in the biomechanics of breastfeeding: a randomized clinical trial)
Barros, R. C. T., Vilagra, J. M., Taglietti, M., Tori, F.S., Cagnini, T. L., Camilo, J.M., Grando, F., Abico, R. M., Abico, S. T.
Research, Society and Development, 2022/03
Free full text
794

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03
795

Osteopathische Medizin in vier chronischen muskuloskeletalen Schmerzerkrankungen: Eine Beobachtungsstudie mit Follow-up.
Osteopathic Medicine in Four Chronic Musculoskeletal Pain Diseases: An Observational Trial with Follow-Up
Rotter, G., Binting, S., Tissen-Diabaté, T., Ortiz, M., Brinkhaus, B.
Complementary Medicine Research, 2022/02
Free full text
796

Inflammatory Biochemical Mediators and Their Role in Myofascial Pain and Osteopathic Manipulative Treatment: A Literature Review
Leicht, B. T., Kennedy, C., Richardson, C.
Cureus, 2022/02
Free full text
797

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02
798

Alimentación y osteopatía: el papel de la alimentación en el funcionamiento del sistema fascial. Revisión sistemática
(Diet and Osteopathy: The role of diet in the functioning of fascial system. Systematic Review)
Mora Mora, S. N.
Unpublished MSc thesis, 2022/02
Free full text
799

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text
800

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text
801

Advances in the therapeutic approach of pudendal neuralgia: a systematic review
Murer, S., Polidori, G., Beaumont, F., Bogard, F., Polidori, E., Kinne, M.
Journal of Osteopathic Medicine, 2022/01
Free full text
802

The rationale for including osteopathic manipulative treatment in the management of infections: a hermeneutic review
Lesho, E., McKeown, A., Laguio-Vila, M.
Expert Review of Anti-Infective Therapy, 2022/01
Free full text
803

International Overview of Somatic Dysfunction Assessment and Treatment in Osteopathic Research: A Scoping Review
Tramontano, M., Tamburella, F., Farra, F., Bergna, A., Lunghi, C., Innocenti, M., Cavera, F., Savini, F., Manzo, V., D', Alessandro, G.
Healthcare, 2022/01
Free full text
804

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text
805

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text
806

Effects of Adding Respiratory Training to Osteopathic Manipulative Treatment on Exhaled Nitric Oxide Level and Cardiopulmonary Function in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
The American Journal of Cardiology, 2022/01
807

Inhibiting the Musculoskeletal Pathological Processes in Post-knee Replacement Surgery With Osteopathic Manipulative Treatment: A Systematic Review
Zhou, Y., Chin, J., Evangelista, A., Podger, B., Wan, P. J., Lomiguen, C. M.
Cureus, 2022/01
808

Neurogenic Bowel Dysfunction Changes after Osteopathic Care in Individuals with Spinal Cord Injuries: A Preliminary Randomized Controlled Trial
Tamburella, F., Princi, A. A., Piermaria, J., Lorusso, M., Scivoletto, G., Masciullo, M., Cardilli, G., Argentieri, P., Tramontano, M.
Healthcare, 2022/01
Free full text
809

The immediate effect of thoracolumbar manipulation and diaphragmatic release on inspiratory muscle strength in healthy smokers: A randomized clinical trial
Albarrati, A., Taher, M., Nazer, R., Alshameri, T.
Journal of Back and Musculoskeletal Rehabilitation, 2022/01
810

Relationship between osteopathic manipulative treatment of the temporomandibular joint, molar shim and the orthostatic position: A randomized, controlled and double blinded study
Detoni, R., Heartz, C. S., Fusatto, E. L., Bicalho, E., Nacimento-Moraes, K. S. G., Rizzatti-Barbosa, C. M., Lopes, F. O. T.
Journal of Bodywork and Movement Therapies, 2022/01
Free full text
811

Osteopathic treatment in addition to standard care in patients with Gastroesophageal Reflux Disease (GERD) – A pragmatic randomized controlled trial
Lynen, A., Schömitz, M., Vahle, M., Jäkel, A., Rütz, M., Schwerla, F.
Journal of Bodywork and Movement Therapies, 2022/01
812

Lymphatic osteopathic manipulative treatment reduces duration of deltoid soreness after Pfizer/BioNTech COVID-19 vaccine
Marshall, S., Winter, S., Capobianco, J. D.
Journal of Osteopathic Medicine, 2022/01
Free full text
813

Temporomandibulargelenk: Diskusverlagerung nach anterior
(Temporomandibular joint: disc displacement anteriorly)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
814

Osteopathische Behandlungsaspekte bei COVID-19
(Aspects of osteopathic treatment for COVID-19)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
815

The Effect of Pedal Pump Lymphatic Technique Versus Passive Recovery Following Maximal Exercise: A Randomized Cross-Over Trial
DiFrancisco-Donoghue, J., Chan, T., Jensen, A. S., Docherty, J. E. B., Grohman, R., Yao, S. C.
Sports Medicine - Open, 2022/01
Free full text
816

Anxiety among Adults Undergoing Elective Lumbar Spine Surgery at University of California – San Diego Medical Center – La Jolla
Rusinov, V.
Unpublished Dissertation, 2022/01
Free full text
817

Results of a feasibility randomised controlled trial of osteopathy on neck-shoulder pain in computer users
Santiago, R. J., Esteves, J. E., Baptista, J. S., Magalhães, A., Costa, J. T.
Complementary Therapies in Clinical Practice, 2022/01
Free full text
818

A New Zealand osteopathic perspective on the choice of working in an integrated care environment alongside other regulated health care providers: A qualitative descriptive study
Cox, V.
Unpublished MSc thesis, 2022
Free full text
819

O papel das citocinas no apoio à monitorização e diagnóstico das condições alvo ao tratamento osteopático: Revisão sistemática da literatura
(The role of cytokines in supporting the monitoring and diagnosis of conditions targeted for osteopathic treatment: A systematic review of the literature)
Coelho, D.
Unpublished thesis, 2022
Free full text
820

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12
821

Osteopathic Manipulation of the Sphenopalatine Ganglia Versus Sham Manipulation, in Obstructive Sleep Apnoea Syndrom: A Randomised Controlled Trial
Attali, V., Jacq, O., Martin, K., Arnulf, I., Similowski, T.
Journal of Clinical Medicine, 2021/12
Free full text
822

Эффективность ортодонтической и остеопатической коррекции у пациентов с зубочелюстными аномалиями и мышечно-суставными дисфункциями височно-нижнечелюстного сустава при наличии сопутствующих соматических дисфункций и без них
(The effectiveness of orthodontic and osteopathic correction in patients with dental anomalies and musculoskeletal dysfunction of the temporomandibular joint in the presence of concomitant somatic dysfunctions and without it)
Basieva, E. V., Milutka, Y. A., Tarasov, N. A., Silin, A. V., Mokhov, D. E.
Russian Osteopathic Journal, 2021/12
823

Сочетанное применение остеопатической коррекции и транскраниальной микрополяризации головного мозга в лечении детей с синдромом дефицита внимания и гиперактивностью
(Combined use of osteopathic correction and transcranial micropolarization of the brain in the treatment of children with attention deficit hyperactivity disorder)
Belash, V. O., Bayer, D. V., Kostousov, V. V.
Russian Osteopathic Journal, 2021/12
824

Влияние остеопатической коррекции на функцию внешнего дыхания у пациентов, перенесших коронавирусную пневмонию COVID -19
(The effect of osteopathic correction on the function of external respiration in patients after COVID-19 coronavirus pneumonia)
Belyaev, A. F., Kharkovskaya, T. S., Fotina, O. N., Yurchenko, A. A.
Russian Osteopathic Journal, 2021/12
825

Исследование возможной эффективности остеопатической коррекции в составе комплексного лечения детей первого года жизни с дисплазией тазобедренных суставов
(Investigation of the possible effectiveness of osteopathic correction in the complex treatment of children in the first year of life with hip dysplasia)
Fabristova, N. A., Gainullin, I. R.
Russian Osteopathic Journal, 2021/12
826

Возможности применения остеопатических методов диагностики и коррекции при дискинезии желчного пузыря
(Possibilities of osteopathic methods of diagnosis and correction in gallbladder dyskinesia)
Panaseiko, Y. N.
Russian Osteopathic Journal, 2021/12
827

The immediate effect of harmonic therapy on peripheral blood flow in young males: A cross-over pilot study
Alsayani, K. Y. A., Aslan, U. B., Büker, N., Şavkın, R., Yağcı, A. B.
International Journal of Osteopathic Medicine, 2021/12
828

Immediate alteration of the lumbar intervertebral foramen during the so-called osteopathic locking technique: A preliminary analysis on healthy subjects
Dugailly, P.M., Dethier, C., Salem, W.
International Journal of Osteopathic Medicine, 2021/12
829

Use of muscle energy technique amongst a nationally representative sample of Australian osteopaths
Fryer, G., Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2021/12
830

Epidemiology, common diagnoses, treatments and prognosis of shoulder pain: A narrative review
Hodgetts, C., Walker, B.
International Journal of Osteopathic Medicine, 2021/12
831

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: Protocol for systematic review and meta-analysis
Rehman, Y., Kirsch, J., Bhatia, S., Johnston, R., Bingham, J., Senger, B., Swogger, S., Snider, K. T.
International Journal of Osteopathic Medicine, 2021/12
832

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) Residency Curriculum Guidelines to meet ACGME Milestones
Balyakina, E., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2021/12
833

OMM alters chronic ethanolinduced changes to VTA GABA neurons, NAc DA release and measures of withdrawal in rats
Bills, K., Small, C., Otteson, D., Jones, G., Steffensen, S.
Journal of Osteopathic Medicine, 2021/12
834

Serum osteocalcin in the osteopathic treatment for motor function in Parkinson’s Disease
Gupta, S., Lamba, S., Yao, S. C., Mancini, J.
Journal of Osteopathic Medicine, 2021/12
835

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12
836

Understanding medical student perspectives in virtual osteopathic manipulative medicine education during the COVID pandemic
Liu, T., Torrents, M., Sharma, S., Burke, D., Giovanis, A.
Journal of Osteopathic Medicine, 2021/12
837

Assessing usage and perceptions of osteopathic manipulative treatment (OMT) and self-identity among osteopathic physicians
Mangla, M., Asif, S., Asif, S., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12
838

A Pilot Study to Examine Medical Students’ Perception of their Osteopathic Manipulative Therapy Education
Mazzi, J., Leavitt, N., Kisby, G.
Journal of Osteopathic Medicine, 2021/12
839

Patient Perception of Clinical Trials With and Without Osteopathic Manipulative Treatment During the COVID-19 Pandemic
Nikakis, J., Singh Arora, U., Wang, L., Abramowitz, C., Malkov, D., Cohen, T. J.
Journal of Osteopathic Medicine, 2021/12
840

Decreasing Headache Pain Secondary to a Subarachnoid Hemorrhage with the use of Osteopathic Manipulative Medicine
Barnes, P. L, Haas, H., Beck, B.
The AAO Journal, 2021/12
Free full text
841

Correction: Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/12
Free full text
842

An Osteopathic Approach to Complex Regional Pain Syndrome (CRPS)
Deol, N., Nuño, V., Schuman, M., Contreras, C.
The AAO Journal, 2021/12
Free full text
843

A comparative study of the effectiveness of an osteopathic primary care sports medicine led intervention on performance in men's collegiate lacrosse players
Rao, N. C., Zwibel, H., Berezanskaya, J., Pena, P., Jung, M. K.
Journal of Osteopathic Medicine, 2021/11
Free full text
844

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text
845

Effect of joint manipulation and muscle energy technique in patients with Chronic Obstructive Pulmonary Disease: A review
Bains, D., Goyal, M., Chahal, A., Shaphe, M. A.
Annals of Clinical and Analytical Medicine, 2021/11
Free full text
846

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11
847

Fast improvements in functional status after osteopathic manipulative treatment based on myofascial release in patients with moderate or severe fibromyalgia: a retrospective study
Farra, F., Chiesa, A., Risio, R. G., Vismara, L., Bergna, A.
Journal of Complementary and Integrative Medicine, 2021/11
Free full text
848

Effect of osteopathic manipulation on gait asymmetry
Hill, C. N., Romero, M., Rogers, M., Queen, R. M., Brolinson, P. G.
Journal of Osteopathic Medicine, 2021/11
Free full text
849

Der Einfluss der Osteopathie auf den Schmerz und die Beweglichkeit nach einer Rotatorenmanschettenrekonstruktion
(The influence of osteopathy on pain and mobility after rotator cuff reconstruction)
Schrempf, I.
Unpublished MSc thesis, 2021/11
850

Die Auswirkungen einer allgemein osteopathischen Behandlung bei Patientinnen/Patienten mit rheumatoider Arthritis
(The effects of general osteopathic treatment on patients with rheumatoid arthritis)
Sommeregger, B. M.
Unpublished MSc thesis, 2021/11
851

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11
852

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11
853

Les bienfaits de l’ostéopathie sur la constipation
(The benefits of osteopathy on constipation)
Pitel, C., Rojot, A.
Pratiques en Nutrition, 2021/11
854

Response to Alvarez et al
Coste, J., Medkour, T., Maigne, J. Y., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/11
Free full text
855

The ACAMTO study—impact of add-on osteopathic treatment on adolescent patients with anorexia nervosa: study protocol for a randomized controlled trial
Letranchant, A., Montebello, Y., Dugré-Le bigre, C., Wagner, A., Curt, F., Silva, J., Nicolas, I., Votadoro, P., Kalindjian, N., Korchonnoff, A., Gutierre, A., Novelli, Ana B., Pham-Scottez, A., Corcos, M.
Trials, 2021/11
Free full text
856

Wirksamkeit osteopathischer Behandlungen von Craniomandibulärer Dysfunktion bei Tinnitus Systematsiches Review
(Efficacy of osteopathic treatments for craniomandibular dysfunction in tinnitus. A Systematic Review)
Pollak, E.
Unpublished MSc thesis, 2021/11
857

Der Einfluss von osteopathischen Behandlungen auf die Beschwerdesymptomatik bei Patienten mit CPPS als Ergänzung zur konventionellen Therapie
(The influence of osteopathic treatments on symptomatology in patients with CPPS as an addition to conventional therapy)
Nezaj, B.
Unpublished MSc thesis, 2021/11
858

Osteopathie bei chronischen Beckenschmerzen
(Osteopathic treatment in patients with chronic pelvic pain)
Koza, M.
Unpublished MSc thesis, 2021/11
859

Effekt sakraler Mobilisationen auf die Herzratenvariabilität bei Patienten mit einem milden bis hohen Stressempfinden. Eine randomisierte, kontrollierte Einzelblindstudie
(Effect of sacrum mobilizations on the heart rate variability in patients with a moderate to high perceived stress score. A single blind randomized controlled study)
Chaumont, Y.
Unpublished MSc thesis, 2021/11
860

Effectiveness of myofascial release on pain, sleep, and quality of life in patients with fibromyalgia syndrome: A systematic review
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P.
Complementary Therapies in Clinical Practice, 2021/11
861

Association Between the Modalities of Complementary and Alternative Medicine Use and Cost-Related Nonadherence to Medical Care Among Older Americans: A Cohort Study
Zhang, J. X., Meltzer, D. O.
The Journal of Alternative and Complementary Medicine, 2021/10
862

Most common infant health concerns in osteopathic practices in Germany. A survey
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2021/10
863

Spinal Manipulative Therapy for Acute Neck Pain: A Systematic Review and Meta-Analysis of Randomised Controlled Trials
Chaibi, A., Stavem, K., Russell, M. B.
Journal of Clinical Medicine, 2021/10
Free full text
864

Остеопатия как метод коррекции и профилактики формирования соматических дисфункций опорно-двигательного аппарата у офисных работников
(Osteopathy as a method of correction and prevention of the formation of somatic dysfunctions of the musculoskeletal system in office workers)
Aptekar, I. A., Abramova, E. V.
Russian Osteopathic Journal, 2021/10
Free full text
865

Оценка клинической эффективности остеопатической коррекции у детей с хроническим бронхитом в условиях санатория
(Evaluation of the clinical effectiveness of the osteopathic correction in children with chronic bronchitis in a sanatorium)
Belash, V. O., Khaibullina, G. A.
Russian Osteopathic Journal, 2021/10
Free full text
866

Исследование эффективности остеопатической коррекции в комплексном лечении больных с прооперированной первичной открытоугольной глаукомой
(Study of the effectiveness of osteopathic correction in the complex treatment of patients with operated primary open-angle glaucoma)
Zubkov, O. V., Smirnova, E. A., Kramar, V. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2021/10
Free full text
867

Effects of osteopathic approach in infants with deformational plagiocephaly: an outcome research study
Gasperini, M., Vanacore, N., Massimi, L., Consolo, S., Haass, C., Scapillati, M. E., Petracca, M.
Minerva Pediatrics, 2021/10
868

Stimulating the Use of OMT in Primary Care Offices Via Point-of-Care Reminders
Agcopra, A., Collins, P., Jha, S., Mancuso, A.
Osteopathic Family Physician, 2021/10
869

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10
870

Wirksamkeit der Osteopathie bei Depressionen als Begleitsymptom chronischer Erkrankungen: Systematic Review
(The Effect of Osteopathy on Comorbid Depression in Chronic Disease: Systematic Review)
Zajicek, M.
Unpublished MSc thesis, 2021/10
Free full text
871

Osteopathy in Germany: attitudes, beliefs and handling among general practitioners - results of a nationwide cross-sectional questionnaire survey
Schmid, G. L., Kluge, J., Deutsch, T., Geier, A. K., Bleckwenn, M., Unverzagt, S., Frese, T.
BMC Family Practice, 2021/10
Free full text
872

Osteopathic Treatment and Evaluation in the Clinical Setting of Childhood Hematological Malignancies
Barbieri, M., Zardo, W., Frittoli, C., Rivolta, C., Valdata, V., Bouquin, F., Passignani, G., Maggiani, A., Jankovic, M., Cossio, A., Biondi, A., Balduzzi, A., Lanfranconi, F.
Cancers, 2021/10
Free full text
873

Osteopathic Treatment of Infants in Their First Year of Life: A Prospective Multicenter Observational Study (OSTINF Study)
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Complementary Medicine Research, 2021/10
Free full text
874

Osteopathische Überlegungen zur Begleitung der Therapie des Mammakarzinoms
(Osteopathic considerations to support the therapy of breast carcinoma)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
875

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
876

Behandlung bei posttraumatischer Belastungsstörung
(Treatment for post-traumatic stress disorder)
Treu, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
877

General Osteopathic Treatment (GOT) – ein Überblick
(General Osteopathic Treatment (GOT) - an overview)
Schiller, B.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
878

Efficacy of osteopathic manipulative treatment in patients with Parkinson's disease: a narrative review
Li, R., Jose, A., Poon, J., Zou, C., Istafanos, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/09
Free full text
879

Exploring the Utility of Motion Analysis in Osteopathic Clinical Trials; a School-Based Pilot Study on Jaw and Cervical Range of Motion
Bagory, T., Vaucher, P., Mhadhbi, H., Ménard, M.
International Journal of Osteopathic Medicine, 2021/09
880

Osteopathic Cranial Manipulation for a Patient With Whiplash-Associated Disorder: A Case Report
Parravicini, G., Ghiringhelli, M.
Journal of Chiropractic Medicine, 2021/09
881

Pain and symptom management in a case of cervical dystonia with comorbid generalized joint hypermobility using prolotherapy with osteopathic manipulative medicine
Mancini, J., Whitfield, D.
Movement Disorders, 2021/09
882

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09
883

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09
884

Nebenwirkungen nach einer osteopathischen Behandlung. Eine quantitative Fragebogenstudie
(Adverse Events After Osteopathic Treatment. A Quantitative Questionnaire Study)
Kloibhofer, M.
Unpublished MSc thesis, 2021/09
885

Effects of Osteopathic Manipulation and Other Manual Manipulative Treatments on Cystic Fibrosis
Ball, K. T., Kraft, D. E., Snider, K. T.
The AAO Journal, 2021/09
Free full text
886

Single Osteopathic Manipulative Treatment Session Eliminates Percutaneous Coronary Intervention-Induced Upper Thoracic Pain in Elderly Male
Hoffman, P., Belogorodsky, D., Noto-Bell, L.
The AAO Journal, 2021/09
Free full text
887

Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/09
Free full text
888

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study
Miranda, E., Giza, J., Feketeova, E., Castro-Nunez, C., Vieux, U., Huynh, M.D.
The AAO Journal, 2021/09
Free full text
889

Wertesysteme in der osteopathischen Palpation – Gespräche mit OsteopathInnen über subjektive Wertesysteme in der osteopathischen Befundung und Behandlung
(Value systems in osteopathic palpation – Interviews with osteopaths about subjective value systems in osteopathic diagnosis and treatment)
Müller, F.
Unpublished MSc thesis, 2021/09
Free full text
890

Wie stellt sich die Gesundheitsstörung der idiopathischen Asymmetrie und lagebedingten Plagiozephalie bei Säuglingen im ersten Lebensjahr in Bezug auf die Therapie dar? Eine systematische Literaturrecherche
(How does the health disorder of idiopathic asymmetry and posi-tional plagiocephaly in infants in the first year of life relate to therapy? A systematic literature review)
Daake, B.
Unpublished MSc thesis, 2021/09
891

A Systematic Review of Musculoskeletal Mobilization and Manipulation Techniques Used in Veterinary Medicine
Haussler, K. K., Hesbach, A. L., Romano, L., Goff, L., Bergh, A.
Animals, 2021/09
Free full text
892

Osteopatia na atenção primária à saúde: resultados parciais de uma experiência de educação permanente e alguns efeitos iniciais.
Osteopathy in primary health care: partial results of continuing education experience and some initial outcomes
Schneider, L. M., Tesser, C. D.
Ciencia & Saude Coletiva, 2021/09
Free full text
893

Erratum: Vertigo and balance disorders - The role of osteopathic manipulative treatment: A systematic review (Complementary Medicine Research (2020) DOI: 10.1159/000512673)
Tramontano, M., Consorti, F., Morone, G., Lunghi, C.
Complementary Medicine Research, 2021/08/01
894

Osteopathic Manipulative Treatment for Chronic Low Back Pain
Licciardone, J. C.
JAMA Internal Medicine, 2021/08
895

Osteopathic Manipulative Treatment for Chronic Low Back Pain—Reply
Nguyen, C., Zegarra-Parodi, R, Boutron, I.
JAMA Internal Medicine, 2021/08
896

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08
897

Osteopathic interventions via telehealth in a pediatric population: a retrospective case series
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2021/08
Free full text
898

Patient-centered care or osteopathic manipulative treatment as mediators of clinical outcomes in patients with chronic low back pain
Licciardone, J. C., Aryal, S.
Journal of Osteopathic Medicine, 2021/08
Free full text
899

Vertigo and Balance Disorders-The Role of Osteopathic Manipulative Treatment: A Systematic Review
Tramontano, Marco, Consorti, Giacomo, Morone, Giovanni, Lunghi, Christian
Complementary Medicine Research, 2021/08
900

The Lymphatic System: An Osteopathic Review
Hruby, R. J., Martinez, E. S.
Cureus, 2021/07
Free full text
901

Osteopathie bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom
(Osteopathy for chronic prostatitis/chronic pelvic pain syndrome)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
902

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
903

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07
904

Modulation of vestibulo-ocular reflex gain-symmetry induced by osteopathic manipulations on the fascial system in young healthy subjects: A three-arm randomized controlled trial
Romagnoli, M., Ntino, A. T., Galli, M., Origo, D.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2021/07
905

Effects of myofascial release or self-myofascial release and control position exercises on lower back pain in idiopathic scoliosis: A systematic review
López-Torres, O., Mon-López, D., Gomis-Marzá, C., Lorenzo, J., Guadalupe-Grau, A.
Journal of Bodywork and Movement Therapies, 2021/07
906

Secondary dysmenorrhea and dyspareunia associated with pelvic girdle dysfunction: A case report and review of literature
Origo, D., Piloni, S., Tarantino, A. G.
Journal of Bodywork and Movement Therapies, 2021/07
907

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text
908

Оценка эффективности лечения соматических дисфункций костей таза с применением компьютерной стабилографии с биологической обратной связью
(Estimation of the efficiency of treatment of somatic dysfunctions of the pelvis bones using the technology of computer stabilography with biological feedback)
Andreev, V. V., Sychev, A. I.
Russian Osteopathic Journal, 2021/07
Free full text
909

Возможность применения остеопатической коррекции в комплексной терапии пациентов с болезнью Паркинсона
(Possibility of osteopathic correction in the complex therapy of patients with Parkinson′s disease)
Belash, V. O., Batenina, A. M., Machulina, A. I.
Russian Osteopathic Journal, 2021/07
Free full text
910

Knowledge of osteopathic manipulative medicine and osteopathic physicians in a New York South Asian community
Lee, J., Maung, C., Espares, J., Chen, J., Yip, F., Lin, W., Zhao, L., Li, T. S.
Journal of Osteopathic Medicine, 2021/07
Free full text
911

Возможность включения остеопатической коррекции в комплексное лечение недостаточности анального сфинктера у подростков
(Possibility of osteopathic correction inclusion in the complex treatment of anal incontinence in teenagers)
Kovalchuk, T. S., Enaleev, R. R., Kuzmina, Y. O.
Russian Osteopathic Journal, 2021/07
Free full text
912

Эффективность остеопатического подхода в лечении задней плагиоцефалии позиционного происхождения у грудного ребенка
(Effectiveness of osteopathic care in the treatment of infant positional posterior plagiocephaly)
Marangelli, G., Adouard, J., Josse, B., Ducourneau, J., Chastagner, A.S., Messien, C.
Russian Osteopathic Journal, 2021/07
Free full text
913

Исследование особенностей остеопатического статуса у пациентов с плосковальгусной деформацией стоп в сочетании с установочной кривошеей в анамнезе и без такого сочетания
(Study of the peculiarities of the osteopathic status in patients with planovalgus deformity of the feet in combination with a history of placement torticollis and without such a combination)
Mukhammadieva, Y. R., Alshina, A. N., Gainetdinov, I. I., Safin, R. F.
Russian Osteopathic Journal, 2021/07
Free full text
914

Возможность применения остеопатических методов коррекции в терапии симфизиопатии у беременных
(Possibility of using of osteopathic methods of correction in the therapy of symphysiopathy in pregnant women)
Nenashkina, E. N., Belash, V. O.
Russian Osteopathic Journal, 2021/07
Free full text
915

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07
916

The efficacy of complementary and alternative medicine methods for chronic epilepsy in pediatric patients: A prisma systematic review and meta-analysis
Johnson, B.
Unpublished MSc thesis, 2021/07
Free full text
917

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text
918

Osteopathic empirical research: a bibliometric analysis from 1966 to 2018
Morin, C., Gaboury, I.
BMC Complementary Medicine and Therapies, 2021/07
Free full text
919

Conceptions de la santé et de la pratique des manipulations vertébrales d’étudiants en ostéopathie au cours de leur formation
(Conceptions of health and spinal manipulation practice of osteopathic students during their training)
Javerliat, P.
Unpublished PhD thesis, 2021/06
Free full text
920

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06
921

Туннельная невропатия локтевого нерва: влияние остеопатической коррекции на снижение болевого синдрома
(Cubital tunnel neuropathy: Impact of osteopathic manipulative treatment on pain syndrome relief)
Belyaev, A. F., Belomestnov, P. V.
Russian Journal of Pain, 2021/06
Free full text
922

Spinale Chiropraktische Manipulation (spinale HVLAM): Ein integrativer osteopathischer Ansatz
Spinal chiropractic manipulation (spinal HVLAM): An integrative osteopathic approach
Muntinga, E.
Osteopathische Medizin, 2021/06
923

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text
924

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text
925

Crochet the Pain Away: A Case Study of Osteopathic Manipulation for Cervical Rib Induced Thoracic Outlet Syndrome
Herring, J. A., Soto, G. N., Silver, S.
The AAO Journal, 2021/06
Free full text
926

Integrating Osteopathic Evaluation and Treatment in a Case of Opioid-Induced Hyperalgesia
Rosendahl, N. O.
The AAO Journal, 2021/06
Free full text
927

‘Don’t focus on the finger, look at the moon’ - The importance of contextual factors for clinical practice and research
Thomson, O. P., Rossettini, G.
International Journal of Osteopathic Medicine, 2021/06
928

Craniosacral Therapy Use in Normal Pressure Hydrocephalus
Park, Y., Kabariti, J., Tafler, L.
Cureus, 2021/05
Free full text
929

Osteopathic Manipulative Treatment of Herpes Zoster Ophthalmicus/Postherpetic Neuralgia
Volokitin, M., Izadi, N., Myers, R., Kane Diaw, N., Milani, S.
Cureus, 2021/05
Free full text
930

The importance of epistemological consideration in the reporting of evidence for osteopathic care in Covid-19 papers
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/05
Free full text
931

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05
932

The importance of rigour in the reporting of evidence for osteopathic care in Covid-19 papers
Draper-Rodi, J., Vaucher, P., Thomson, O. P.
Explore (NY), 2021/05
Free full text
933

Effect of Osteopathic Manipulative Treatment vs Sham Treatment on Activity Limitations in Patients With Nonspecific Subacute and Chronic Low Back Pain: A Randomized Clinical Trial
Nguyen, C., Boutron, I., Zegarra-Parodi, R., Baron, G., Alami, S., Sanchez, K., Daste, C., Boisson, M., Fabre, L., Krief, P., Krief, G., Lefèvre-Colau, M.M., Rannou, F.
JAMA Internal Medicine, 2021/05
934

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
935

The usage of multidisciplinary physical therapies at the Rio de Janeiro 2016 Olympic Summer Games: an observational study
Grant, M. E., Steffen, K., Palmer, D.
Brazilian Journal of Physical Therapy, 2021/05
Free full text
936

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05
937

Obstructed defecation syndrome associated with paradoxical puborectalis contraction: osteopathic treatment versus anal biofeedback. Results of a pilot study
Ascanelli, S., Portinari, M., Canella, M., Solari, S., Dall&rsquo, Omo, F., Danese, S., De Troia, A., Carcoforo, P.
Techniques in Coloproctology, 2021/05
938

Effects of Osteopathic Manipulative Treatment on Parkinsonian Gait: A Statistical Parametric Mapping Analysis
Terrell, Z. T.
Unpublished MSc thesis, 2021/05
939

Beeinflussung abdominaler Adhäsionen durch osteopathische oder manuelle Techniken
(Influencing abdominal adhesions through osteopathic or manual techniques: A systematic review)
Kreuzer, M.
Unpublished MSc thesis, 2021/05
Free full text
940

Direct and mediated effects of treatment context on low back pain outcome: a prospective cohort study
Bishop, F., Al-Abbadey, M., Roberts, L., MacPherson, H., Stuart, B., Carnes, D., Fawkes, C., Yardley, L., Bradbury, K.
BMJ Open, 2021/05
Free full text
941

The use of osteopathic manipulative treatment in the newborn nursery and its effect on health in the first six months of life: A retrospective observational case-control study
Mills, M. V.
Complementary Therapies in Clinical Practice, 2021/05
Free full text
942

Evaluation du rôle de l'ostéopathie dans la prévention et la prise en charge de la sarcopénie chez les personnes de plus de 65 ans
(Evaluation of the role of osteopathy in the prevention and management of sarcopenia in people over 65 years of age)
Gonthier, M., Jordan, L.
Unpublished MSc thesis, 2021/04
Free full text
943

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text
944

Evidence-based assessment of potential therapeutic effects of adjunct osteopathic medicine for multidisciplinary care of acute and convalescent COVID-19 patients
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/04
Free full text
945

Effects of Osteopathic T9-T10 Vertebral Manipulation in Tonsillitis: A Randomized Clinical Trial
Luceño-Mardones, A., Luceño-Rodríguez, I., Rodríguez-López, E. S., Oliva-Pascual-Vaca, J., Rosety, I., Oliva-Pascual-Vaca, Á
Healthcare, 2021/04
Free full text
946

Osteopathic manual therapy in heart failure patients: A randomized clinical trial
Thomaz, S. R., Teixeira, F. A., de Lima, Acgb, Cipriano Junior, G., Formiga, M. F., Cahalin, L. P.
Journal of Bodywork and Movement Therapies, 2021/04
947

Assessment of Studies Evaluating Spinal Manipulative Therapy and Infectious Disease and Immune System Outcomes: A Systematic Review
Chow, N., Hogg-Johnson, S., Mior, S., Cancelliere, C., Injeyan, S., Teodorczyk-Injeyan, J., Cassidy, J. D., Taylor-Vaisey, A., Cote, P.
JAMA Network Open, 2021/04
Free full text
948

Telemanagement of Home-Isolated COVID-19 Patients Using Oxygen Therapy With Noninvasive Positive Pressure Ventilation and Physical Therapy Techniques: Randomized Clinical Trial
Adly, A. S., Adly, M. S., Adly, A. S.
Journal of Medical Internet Research, 2021/04
Free full text
949

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
950

Оценка данных динамического МРТ-обследования пациентов с грыжами межпозвонковых дисков на фоне комплексного лечения, включавшего остеопатическую коррекцию
(Evaluation of dynamic MRI data in patients with herniated intervertebral discs after the complex treatment including osteopathic correction)
Adrianova, S. M., Akhmetov, B. H.
Russian Osteopathic Journal, 2021/04
Free full text
951

Osteopathic manipulative medicine in the management of headaches associated with postconcussion syndrome
Esterov, D., Thomas, A., Weiss, K.
Journal of Osteopathic Medicine, 2021/04
Free full text
952

Возможности применения остеопатических методов коррекции в терапии дорсопатии на шейно-грудном уровне
(Possibilities of osteopathic correction methods using in the treatment of dorsopathy at the cervicothoracic level)
Belash, V. O., Nenashkina, E. N.
Russian Osteopathic Journal, 2021/04
Free full text
953

Возможности коррекции нарушения статодинамического стереотипа у пациентов с дорсопатией на шейно-грудном уровне
(Possibilities of correction of the statodynamic stereotype violations in patients with dorsopathy at the cervical-thoracic level)
Belash, V. O., Vorobyova, A. E., Vasyukovich, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
954

Результаты включения остеопатической коррекции в состав комплексной терапии пациентов с хроническим гастритом
(Results of the inclusion of osteopathic correction in the complex therapy of patients with chronic gastritis)
Fazlyakhmetov, R. T., Safiullin, R. R., Ustinov, A. V.
Russian Osteopathic Journal, 2021/04
Free full text
955

Эффект техники освобождения при помощи давления на латентную миофасциальную триггерную точку в верхней части трапециевидной мышцы: рандомизированное контролируемое клиническое исследование
(Effects of the release technique by pressing on the latent myofascial trigger point of the upper trapezius muscle: random controlled clinical trial)
Ferreira Faria, M. A., Bautista Aguirre, F.
Russian Osteopathic Journal, 2021/04
Free full text
956

Эффективность остеопатической коррекции в комплексном лечении взрослых пациентов с гастроэзофагеальной рефлюксной болезнью
(The effectiveness of the osteopathic correction in the complex treatment of adult patients with gastroesophageal reflux disease)
Naletova, T. P., Udintsev, E. P., Oreshko, A. Y., Chusovitina, O. A.
Russian Osteopathic Journal, 2021/04
Free full text
957

Динамический туннельный синдром запястного канала: патофизиология, особенности остеопатической диагностики и лечения
(Dynamic carpal tunnel syndrome: pathophysiology, features of osteopathic diagnosis and treatment)
Stefanidi, A. V., Balabanova, N. V.
Russian Osteopathic Journal, 2021/04
Free full text
958

Результаты остеопатической коррекции при миопии и спазме аккомодации у детей: систематический обзор с применением метаанализа
(Results of osteopathic correction of myopia and accommodation spasm in children: systematic review using meta-analysis)
Vedyashkina, A. S., Milutka, Y. A., Lomakina, Y. N., Potekhina, Y. P.
Russian Osteopathic Journal, 2021/04
Free full text
959

Обоснование возможности включения остеопатической коррекции в комплекс мер по предоперационной подготовке пациентов, планируемых на расширенные абдоминальные операции
(Substantiation of the possibility of osteopathic correction inclusion in the measures complex for the preoperative preparation of patients planned for extended abdominal surgery)
Volkov, P. A., Litvinov, N. I., Bolotov, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
960

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text
961

A Closer Look into the Association between the Sacroiliac Joint and Low Back Pain
Wieczorek, A., Campau, E., Pionk, E., Gabriel-Champine, M. E., Rios-Bedoya, C. F.
Spartan Medical Research Journal, 2021/04
Free full text
962

Osteopathic medicine for fibromyalgia: a sham-controlled randomized clinical trial
Coste, J., Medkour, T., Maigne, J., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/04
Free full text
963

Effektivität der Osteopathie im zentralnervösen/-neurologischen Bereich, Eine systematische Übersichtsarbeit
(Effectiveness of osteopathic manual treatments in the central nervous/ -neurological area, A Systematic review of the literature)
Pflügler, S.
Unpublished MSc thesis, 2021/04
Free full text
964

Effektivität einer osteopathischen Behandlung der Nieren bei Leistenschmerz von Sportlern – eine einfach verblindete randomisierte Studie
(Effectiveness of an osteopathic kidney treatment for groin pain in athletes – a single blinded randomized trial)
Pakosta, M.
Unpublished MSc thesis, 2021/04
Free full text
965

Auswirkungen eines auf dem Fasziendistorsionsmodell basierenden osteopathischen Interventionsprogramms auf die Hüftmobilität und subjektiv empfundene Lebensqualität von Coxarthrosepatienten im Vergleich zur physiotherapeutischen Standardbehandlung Eine randomisiert kontrollierte Studie
(A randomized controlled trial on the effects of an osteopathic treatment method according to the Fascial Distortion Model on the hip mobility and subjectively perceived quality of life of coxarthrosis patients)
Holzer-Jüttner, S.
Unpublished MSc thesis, 2021/04
966

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text
967

Osteopathic manipulative treatment to improve exclusive breast feeding at 1 month
Danielo Jouhier, M., Boscher, C., Roze, J. C., Cailleau, N., Chaligne, F., Legrand, A., Flamant, C., Muller, J. B.
Archives of Disease in Childhood. Fetal and Neonatal Edition, 2021/04
968

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text
969

Osteopathic Manipulative Treatment to Optimize the Glymphatic Environment in Severe Traumatic Brain Injury Measured With Optic Nerve Sheath Diameter, Intracranial Pressure Monitoring, and Neurological Pupil Index
Kashyap, S., Brazdzionis, J., Savla, P., Berry, J. A., Farr, S., Patchana, T., Majeed, G., Ghanchi, H., Bowen, I., Wacker, M. R., Miulli, D. E.
Cureus, 2021/03
Free full text
970

Das benigne Prostatasyndrom im Kontext der Osteopathie
(Benign prostate syndrome in the context of osteopathy)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
971

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Expert*inneninterviews – Teil 2: Qualitative empirische Daten
(The osteopathic treatment of interosseous lesions: A qualitative content analysis of experts' interviews - Part 2: Qualitative empirical data)
Stecker, D.
Osteopathische Medizin, 2021/03
972

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
973

Osteopathische Behandlung bei Vulvodynie
(Osteopathic treatment for vulvodynia)
Morgentau, M. J., Reinartz, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
974

Randomisierte kontrollierte Studien zur osteopathischen Behandlung des Ganglion pterygopalatinum
(Randomized controlled trials for osteopathic treatment of the pterygopalatine ganglion.)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
975

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
976

Osteopathic model of the development and prevention of occupational musculoskeletal disorders
Price, J. W.
Journal of Osteopathic Medicine, 2021/03
Free full text
977

Patient expectations of manual and non-manual therapy within an osteopathic consultation: A cross sectional study
Tripodi, N., Garrett, A., Savic, D., Sadrani, K., Robertson, L., Volarich, S., Sirgiovanni, T.
International Journal of Osteopathic Medicine, 2021/03
978

Effects of osteopathic manipulative treatment and bio-electromagnetic energy regulation therapy on lower back pain
Auger, K., Shedlock, G., Coutinho, K., Myers, N. E., Lorenzo, S.
Journal of Osteopathic Medicine, 2021/03
Free full text
979

Support for osteopathic manipulative treatment inclusion in chronic pain management guidelines: a narrative review
Franzetti, M., Dries, E., Stevens, B., Berkowitz, L., Yao, S. C.
Journal of Osteopathic Medicine, 2021/03
Free full text
980

Teaching and use of cervical high-velocity, low-amplitude manipulation at colleges of osteopathic medicine
Hu, A., Motyka, T., Gish, E., Dogbey, G.
Journal of Osteopathic Medicine, 2021/03
Free full text
981

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03
982

Manual treatment for kidney mobility and symptoms in women with nonspecific low back pain and urinary infections
Lo Basso, F., Pilzer, A., Ferrero, G., Fiz, F., Fabbro, E., Oliva, D., Cazzarolli, C., Turrina, A.
Journal of Osteopathic Medicine, 2021/03
Free full text
983

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03
984

New clinical research urgently needed for adjunctive OMT treatment in elderly patients hospitalized with COVID-19 pneumonia
Vanacore, N.
Journal of Osteopathic Medicine, 2021/03
Free full text
985

Impact of different types of revision materials on the learning of musculoskeletal techniques
Launay, F., Ménard, M., Bourgin, M., Mhadhbi, H., Sutre, F., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2021/03
986

Effekt der Osteopathie auf Patientinnen mit Dysmenorrhoe - Ein Systematischer Review
(Effectiveness of Osteopathy in Patients with Dysmenorrhea - A systematic review)
Thurner, C.
Unpublished MSc thesis, 2021/03
Free full text
987

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text
988

Der tiefsitzende Beckenschmerz: Ein osteopathischer Behandlungsalgorithmus in sieben Schritten
(The chronic pelvic pain: An osteopathic treatment algorithm in seven steps)
Liedtke, H.
Osteopathische Medizin, 2021/03
989

Proprioceptive Coherence: An Expanded View of the Mechanics Behind the Indirect Method and the Introduction of an Innovative Variation
Lockwood, M. D.
The AAO Journal, 2021/03
Free full text
990

Complementary and alternative medicine use by pediatric oncology patients before, during, and after treatment
Lüthi, E., Diezi, M., Danon, N., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
BMC Complementary Medicine and Therapies, 2021/03
991

Osteopathic Cranial Manipulation and Myofascial Release of Anterior Fascia to Improve Respiratory Dynamics in Obstructive Sleep Apnea Syndrome: A Case Series
Torres, J. W.
The AAO Journal, 2021/03
Free full text
992

An Osteopathic Approach to Neck Pain
Zona, J. C., Cranor, M.
American Family Physician, 2021/03
993

A splenic cyst causing a viscerosomatic reflex in the thoracic spine. A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2021/03
994

Osteopathic manipulative treatment and the Spanish flu: a historical literature review
Baroni, F., Mancini, D., Tuscano, S. C., Scarlata, S., Lunghi, C., Cerritelli, F., Haxton, J.
Journal of Osteopathic Medicine, 2021/02
Free full text
995

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text
996

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
997

Characteristics and treatment of geriatric patients in an osteopathic neuromusculoskeletal medicine clinic
King, A. A., Cox, J., Bhatia, S., Snider, K. T.
Journal of Osteopathic Medicine, 2021/02
Free full text
998

A mixed treatment comparison of selected osteopathic techniques used to treat acute nonspecific low back pain: a proof of concept and plan for further research
Price, J. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
999

Effect of occipitoatlantal decompression on cerebral blood flow dynamics as evaluated by Doppler ultrasonography
Roberts, B., Makar, A. E., Canaan, R., Pazdernik, V., Kondrashova, T.
Journal of Osteopathic Medicine, 2021/02
Free full text
1000

Auswirkung einer Behandlung des lateralen Triggerbandes des Oberschenkels nach Prinzipien des Fasziendistorsionsmodells auf die Hüftbeweglichkeit
(Effect of a treatment of the lateral trigger band of the thigh according to the principles of the fascia distortion model by Dr. Stephen Typaldos on hip mobility)
Schulz, K.
Unpublished MSc thesis, 2021/02
Free full text
1001

Supportive care and osteopathic medicine in pediatric oncology: perspectives of current oncology clinicians, caregivers, and patients
Belsky, J. A., Stanek, J., Skeens, M. A., Gerhardt, C. A., Rose, M. J.
Supportive Care in Cancer, 2021/02
Free full text
1002

Effektivität der Osteopathischen Behandlung auf den Blutdruck - Eine Literaturübersichtsarbeit
(The effectiveness of the osteopathic treatment on blood pressure - A systematic review)
Vorreiter, A.
Unpublished MSc thesis, 2021/02
Free full text
1003

Osteopathische Behandlung bei Erwachsenen mit Zerebralparese - Wirkung eines osteopathischen Behandlungsprotokolls im Vergleich zur Vojta-Therapie auf Lungenfunktionsstörungen bei Erwachsenen mit Zerebralparese
(Osteopathic treatment of adults with cerebral palsy – Effects of an osteopathic treatment protocol compared with Vojta-therapy on impaired lung function in adults with cerebral palsy)
Walter, U.
Unpublished MSc thesis, 2021/02
1004

Pediatric Osteopathic Manipulative Medicine: A Scoping Review
DeMarsh, S., Huntzinger, A., Gehred, A., Stanek, J. R., Kemper, K. J., Belsky, J. A.
Pediatrics, 2021/02
1005

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text
1006

The role of touch in osteopathic practice: A narrative review and integrative hypothesis
Baroni, F., Ruffini, N., D'Alessandro, G., Consorti, G., Lunghi, C.
Complementary Therapies in Clinical Practice, 2021/02
1007

Einfluss der Osteopathie auf das Hormon Cortisol
(The Effects of an Osteopathic Treatment on Cortisol Levels)
Lederbauer, C.
Unpublished MSc thesis, 2021/02
Free full text
1008

Einfluss einer osteopathischen Behandlung auf chemotherapeutisch induzierte Nausea und Vomiting (CINV) und auf die gesundheitsbezogene Lebensqualität während emetogen wirkender Chemotherapie
(The Influence of Osteopathic Treatment on Chemotherapy Induced Nausea and Vomiting (CINV) and Health Related Quality of Life (QoL) in Patients with Cancer treated with Emetogenic Chemotherapy)
Aranya-Mayr, J.
Unpublished MSc thesis, 2021/02
1009

Osteopathische Behandlung bei Plagiozephalie
(Osteopathic treatment of plagiocephaly)
Kenner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1010

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1011

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1012

Ist kraniale Osteopathie zuverlässig und wirksam?
(Is cranial osteopathy reliable and effective?)
Reißmann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1013

Gut Microbiome Changes with Osteopathic Treatment of Constipation in Parkinson's Disease: A Pilot Study
Mancini, J. D., Yao, S., Martinez, L. R., Shakil, H., Li, T. S.
Neurology (ECronicon), 2021/01
Free full text
1014

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01
1015

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01
1016

Pilot study assessing the effect of osteopathic manipulative treatment (OMT) on length of stay in neonates after therapeutic hypothermia
Bendixen, K., Beinlich, A., Beck, B., Hashmi, N., Craig, A.
Journal of Osteopathic Medicine, 2021/01
1017

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text
1018

Osteopathic manipulative treatment (OMT) use among osteopathic physicians in the United States
Healy, C. J., Brockway, M. D., Wilde, B. B.
Journal of Osteopathic Medicine, 2021/01
Free full text
1019

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text
1020

Investigating the current literature comprising osteopathic manual therapy (OMT) as an intervention: A scoping review
Ryan, H.
Unpublished MSc thesis, 2021/01
Free full text
1021

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text
1022

Effectiveness of osteopathic interventions in chronic non-specific low back pain: A systematic review and meta-analysis
Dal Farra, F., Risio, R. G., Vismara, L., Bergna, A.
Complementary Therapies in Medicine, 2021/01
Free full text
1023

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text
1024

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text
1025

Inanspruchnahme osteopathischer Medizin bei chronisch und Langzeit-Erkrankten
(Use of osteopathic medicine for chronic and long-term patients)
Beer, A.M., Kiseier, P., Weber, H.
Journal für Pharmakologie und Therapie, 2021
Free full text
1026

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1027

The Effect of Osteopathic Manipulative Treatment (OMT) on Proprioception in Adults: A Pilot Study
Hoevemeyer, K., Teng, K. Y., Mehner, T., McMunn, R., Figueroa, J., Jie, C.
The AAO Journal, 2020/12
Free full text
1028

La prise en charge des grands syndromes cranio-maxillo-faciaux en ostéopathie pédiatrique : Treatment of major cranio-maxillo-facial syndromes in pediatric osteopathy
(Treatment of major cranio-maxillo-facial syndromes in pediatric osteopathy)
Lalauze-Pol, R.
Unpublished PhD thesis, 2020/12
1029

The influence of an osteopathic treatment on pregnant women on expected date of delivery on the course of parturition and the subjective well-being: A Pilot Study
Tauch, A.
European Journal of Osteopathic Research, 2020/12
Free full text
1030

Characteristics and Management of Pregnant Patients From a Neuromusculoskeletal Medicine/Osteopathic Manipulative Medicine Clinic
Frank, L. D., Bhatia, S., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1031

Osteopathic Approach to the Treatment of a Patient With Idiopathic Iliohypogastric Neuralgia
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1032

CRI over MRI: A Cranial Approach to Dizziness
Qureshi, Y., Patel, U., Mercer, A.
The AAO Journal, 2020/12
Free full text
1033

Wissenschaftlich fundiert oder fragwürdiger Mythos?: Osteopathische Behandlungserfolge im Vergleich zur Schulmedizin während der Spanischen Grippe in den USA
(Scientifically substantiated or questionable myth?: Comparison between osteopathic treatment successes and conventional medicine during the Spanish flu in the USA)
Schwerla, F., Franke, H.
Osteopathische Medizin, 2020/12
1034

The Use of Osteopathic Manipulative Medicine in the Management of Recurrent Mastitis
Jackson, C., Loveless, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1035

Crying Unsettled and disTressed Infants Effectiveness Study of osteopathic care (CUTIES trial): Pragmatic randomised superiority trial protocol
Carnes, D., Bright, P., Brownhill, K., Carroll, K., Engel, R., Grace, S., Vogel, S., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/12
1036

Upper airway stabilization by osteopathic manipulation of the sphenopalatine ganglion versus sham manipulation in OSAS patients: a proof-of-concept, randomized, crossover, double-blind, controlled study
Jacq, O., Arnulf, I., Similowski, T., Attali, V.
BMC Complementary and Alternative Medicine, 2020/12
Free full text
1037

Brain Connectivity Changes after Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tramontano, M., Cerritelli, F., Piras, F., Spanò, B., Tamburella, F., Piras, F., Caltagirone, C., Gili, T.
Brain Sciences, 2020/12
Free full text
1038

Результаты комплексного лечения с включением остеопатической коррекции соматических дисфункций при перинатальном поражении ЦНС у детей первого года жизни
(Results of complex treatment with the inclusion of osteopathic correction of somatic dysfunctions in perinatal CNS lesions in children of the first year of life)
Abramova, E. V., Aptekar, I. A., Aptekar, V. I., Yudina, A. A.
Russian Osteopathic Journal, 2020/12
Free full text
1039

Сравнительное исследование эффективности стандартной и комплексной, включающей остеопатическую коррекцию, терапии пациентов с дискогенной SI радикулопатией
(Comparative study of the effectiveness of standard therapy and the complex therapy with inclusion of osteopathic correction, in patients with discogenic SI radiculopathy)
Adrianova, S. M., Akhmetov, B. H.
Russian Osteopathic Journal, 2020/12
Free full text
1040

Рефлексотерапия в лечении пациентов с дорсопатией
(Reflexology in the treatment of patients with dorsopathy)
Belash, V. O., Agasarov, L. G.
Russian Osteopathic Journal, 2020/12
Free full text
1041

Остеопатическая коррекция в комплексной терапии пациентов с гемиспазмом
(Osteopathic correction in the complex therapy of patients with hemispasm)
Belash, V. O., Guzhina, E. Y.
Russian Osteopathic Journal, 2020/12
Free full text
1042

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12
1043

The effect of osteopathic medicine on pain in musicians with nonspecific chronic neck pain: a randomized controlled trial
Rotter, G., Fernholz, I., Binting, S., Keller, T., Roll, S., Kass, B., Reinhold, T., Willich, S. N., Schmidt, A., Brinkhaus, B.
Therapeutic Advances in Musculoskeletal Disease, 2020/12
Free full text
1044

The Effect of Osteopathic Manipulative Treatment on Stiff Person Syndrome
Bazzi, M. O., Vemuri, A., Downing, M. A., Barry, P. E.
The Journal of the American Osteopathic Association, 2020/12
1045

The Use of Osteopathic Manipulation to Facilitate Bone Remodeling in a Postmenopausal Osteoporotic Woman
Grabie, Y., Jamil, N., Habib, N., Simone, J. J.
The Journal of the American Osteopathic Association, 2020/12
1046

The Effects of Osteopathic Manipulative Treatment on HbA1c in Type 2 Diabetes and Pre-diabetes: A Randomized-Control Clinical Trial
Sureshbabu, S., Sheflin, K., Li, T. S., Heller, M., Yusupov, E., Krishnamachari, B., Allera, A., Rivera-Martinez, S.
The Journal of the American Osteopathic Association, 2020/12
1047

Сравнение влияния миотензивной техники Митчелла и так называемой техники укорочения с сопротивлением на пассивную осевую ротацию шейного отдела позвоночника
(Comparison of the effects of a Mitchell’s myotensive technique and the strain-shortening technique on passive axial rotation of the cervical spine)
Dehiles, R., Salem, W., Klein, P.
Russian Osteopathic Journal, 2020/12
Free full text
1048

Utilizing Osteopathic Manipulative Treatment as a Non-Surgical Approach to Severs Disease in a Growing Adolescent
Madhu, B., Goldenhart, A.
Southern Medical Journal, 2020/12
1049

Сравнение эффективности мануальной терапии и фармакотерапии в лечении и реабилитации пациентов с синдромом грушевидной мышцы
(Comparison of manual therapy and pharmacotherapy effectiveness in the treatment and rehabilitation of patients with piriformis syndrome)
Frolov, V. A., Akopyan, M. S., Berezin, V. V.
Russian Osteopathic Journal, 2020/12
Free full text
1050

Влияние остеопатической коррекции на уровень стресса у пациенток с цервикокраниалгией
(The influence of osteopathic correction to the level of stress in patients with cervicobrachialgia)
Korman, D. V., Yushmanov, I. G.
Russian Osteopathic Journal, 2020/12
Free full text
1051

The Effect of Osteopathic Manipulative Treatment on Lower Limb Muscle Rigidity in a Parkinson's Patient
Vemuri, A., Xu, E., Downing, M., Widboom, N.
Southern Medical Journal, 2020/12
1052

Остеопатическая коррекция в составе комплексного лечения первичного билиарного холангита
(Osteopathic correction as part of the complex treatment of primary biliary cholangitis)
Lebedev, D. S., Nizamova, A. H.
Russian Osteopathic Journal, 2020/12
Free full text
1053

Возможности и организационные проблемы диагностики и лечения пациентов с синдромом болевой дисфункции височно-нижнечелюстного сустава
(Possibilities and organizational problems of diagnostics and treatment of patients with the syndrome of temporomandibular joint pain dysfunction)
Milutka, Y. A., Fortin, A. E.
Russian Osteopathic Journal, 2020/12
Free full text
1054

Einzelfallstudie über den Einfluss einer osteopathischen Behandlung eines Mannes mit unerfülltem Kinderwunsch
(Single Case Study on the Influence of an Osteopathic Treatment of One Man with the Unfulfilled Desire To Have a Child)
Mayrhofer, M.
Unpublished MSc thesis, 2020/12
Free full text
1055

An Osteopathic Modular Approach to Asthma: A Narrative Review
Schend, J., Rowane, M., Sanan, N., Hostoffer, S. R.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1056

The clinical management of neck pain of novice and experienced Australian osteopaths: a secondary analysis of a nationally representative sample
Fleischmann, M., McLaughlin, P., Hayes, A., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2020/11
1057

Ultrasonography to Assess the Efficacy of Osteopathic Manipulative Treatment for Lumbar Spine Asymmetry
Winter, J., Kimber, A., Montenegro, S., Gao, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1058

Neurophysiologische Aspekte der osteopathischen Palpation gemessen mit der Herzratenvariabilitätsmessung
(Neurophysiological aspects of osteopathic palpation measured with the heart rate variability measurement)
Strohmaier, B.
Unpublished MSc thesis, 2020/11
Free full text
1059

Osteopathische Anwendung bei Aufmrksamkeits - Defizit - Syndrom
(Osteopathic application in case of lack of concentration)
Werth, B.
Unpublished MSc thesis, 2020/11
1060

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text
1061

Osteopathic manipulative treatment in a general pediatric setting: An account of reflective practice
Mills, M. V.
Complementary Therapies in Clinical Practice, 2020/11
1062

Osteopathic Approach to Treatment of Carpal Dysfunction: The Carpal Mobilization Technique
Mehner, T. R., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1063

Die Sicherheit von Osteopathie bei Schwangeren anhand der Auswirkung auf das mögliche Risiko von Komplikationen vor, während und nach der Geburt
(The safety of osteopathy in pregnant women based on its impact on the risk of complications before, during, and after childbirth)
Kleindessner, A.
Unpublished MSc thesis, 2020/11
Free full text
1064

Chronisch-funktionelle Obstipation bei Kindern – Eine fallkontrollierte Studie Ist Osteopathie effektiver als die medizinische Standardbehandlung?
(Functional Constipation in Childhood – A Case Controlled Study Is osteopathic treatment more effective than medicinal standard treatment?)
Eisenschenk, R.
Unpublished MSc thesis, 2020/11
Free full text
1065

Einfluss einer osteopathischen Behandlung der Halswirbelsäule bei Schulterschmerzen
(Influence of an osteopathic treatment on shoulder pain)
Albrecht, J. M.
Unpublished MSc thesis, 2020/10
Free full text
1066

Osteopathic Manipulative Treatment in Individuals With Vertigo and Somatic Dysfunction: A Randomized, Controlled, Comparative Feasibility Study
Fraix, M., Badran, S., Graham, V., Redman-Bentley, D., Hurwitz, E. L., Quan, V. L., Yim, M., Hudson-McKinney, M., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1067

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text
1068

Cranial osteopathic treatment and stress-related effects on autonomic nervous system measured by salivary markers: A pilot study
Abenavoli, A., Badi, F., Barbieri, M., Bianchi, M., Biglione, G., Dealessi, C., Grandini, M., Lavazza, C., Mapelli, L., Milano, V., Monti, L., Seppia, S., Tresoldi, M., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2020/10
1069

Cerebral tissue oxygenation during cranial osteopathic CV4 procedure in newborns
Malak, R., Kozłowska, Z., Owsiańska, Z., Sikorska, D., Andrusiewicz, M., Szymankiewicz-Bręborowicz, M., Samborski, W., Szczapa, T.
Advances in Clinical and Experimental Medicine, 2020/10
Free full text
1070

Effektivität von Osteopathie bei Patient/en/innen mit gastrointestinalen Erkrankungen; Eine systematische Übersichtsarbeit
(Effectiveness of Osteopathy in Patients with Gastrointestinal Diseases - A Systematic Review)
Schönberger, B.
Unpublished MSc thesis, 2020/10
Free full text
1071

Osteopathie bei PatientInnen mit Knochenmarködemen im Kniegelenksbereich - Eine nicht kontrollierte Interventionsstudie
(Osteopathy related to patients with bone marrow edema – A non-controlled intervention study)
Taferner, W.
Unpublished MSc thesis, 2020/10
Free full text
1072

A Pilot Study of Jugular Compression (Queckenstedt maneuver) for Cranial Movement Perception
Abenavoli, A., Pisa, S., Maggiani, A.
The Journal of the American Osteopathic Association, 2020/10
1073

The Role of Musculoskeletal Disorders in Chronic Disease: A Narrative Review
Asahi, M. G., Briganti, D., Cam, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1074

Osteopathic Manipulative Treatments for Pediatric Conditions
Raines, S. G. M., Ramey, A. L.
Osteopathic Family Physician, 2020/10
Free full text
1075

A Case of Resolved Vincristine-Induced Constipation Following Osteopathic Medicine in a Patient With Infantile Fibrosarcoma
Belsky, J. A., Wolf, K., Setty, B. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1076

Osteopathic Manipulative Treatment for a Recognizable Pattern of Somatic Dysfunction Following Laparoscopic Cholecystectomy
Mills, M., Sevensma, K., Serrano, J.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1077

La fascia desde la medicina osteopática
(Fascia from the perspective of osteopathic medicine)
Stambulie Padilla, E. A.
Unpublished MSc thesis, 2020/10
Free full text
1078

Treating Complex Regional Pain Syndrome Using Counterstrain: A Novel Approach
Schranz, K., Meitz, D., Powers, B., Ables, A.
Cureus, 2020/10
Free full text
1079

Osteopathie bei umschriebenen Entwicklungsstörungen
(Osteopathy for specific developmental disorder)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1080

Auswirkungen von osteopathischen Behandlungen im Vergleich zur Anwendung eines Entspannungsverfahrens auf die Lebensqualität von Endometriose-Patientinnen
(Effects of Osteopathic Treatments in Comparison to a Relaxation-Method on the Quality of Life of Endometriosis Patients)
Kremen-Pilz, I.
Unpublished MSc thesis, 2020/10
Free full text
1081

Osteopathie bei epileptischen Anfällen
(Osteopathy for epileptic disorder)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1082

Die kranio-kaudale Bewegung im Articulatio tibiofibulare proximalis bei einer Dorsalextension und Plantarflexion im Articulatio talocruralis
(The cranial and caudal movement of the Art. Tibiofibularis proximalis during dorsalextension and plantarflexion)
Bernhardt, M.
Unpublished MSc thesis, 2020/09
Free full text
1083

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text
1084

The Immediate, Intermediate, and Long-Term Effects of Osteopathic Manipulative Treatment on Pulmonary Function in Adults with Asthma
Kasten, K. M., Tyler, S. K., Johnson, A. R., Kolakowski, E. R., Pickos, J., Heineman, K., Jie, C.
The AAO Journal, 2020/09
Free full text
1085

Osteopathische Behandlung des Larynx
(Osteopathic treatment of the larynx)
Liem, T.
Osteopathische Medizin, 2020/09
1086

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09
1087

Severe Viscerosomatic Neck Pain from Refractory Gastroesophageal Reflux
Uhrig, J., Rettos, J.
The AAO Journal, 2020/09
Free full text
1088

What Makes an Osteopathic Treatment Effective From a Patient's Perspective: A Descriptive Phenomenological Study
Consorti, G., Marchetti, A., De Marinis, M. G.
Journal of Manipulative and Physiological Therapeutics, 2020/09
1089

Обоснование сочетанного применения остеопатических методов коррекции и рефлексотерапии в комплексной терапии пациентов с дорсопатией на шейно-грудном уровне
(The rationale for the combined use of osteopathic methods of correction and reflexology in the complex treatment of patients with dorsopathy at the cervico-thoracic level)
Belash, V. O., Urazgalieva, L. R., Fayzullina, R. I., Agasarov, L. G.
Russian Osteopathic Journal, 2020/09
Free full text
1090

Assessing the feasibility of a therapy package application on reducing psychological and physiological stress in women: a pilot study
Taylor, V. J.
Unpublished MSc thesis, 2020/09
Free full text
1091

Assessing the feasibility of a therapy package application on reducing psychological and physiological stress in men: a pilot study
Rahier, A.
Unpublished MSc thesis, 2020/09
Free full text
1092

Модель фасциальных дисторсий (FDM-терапия). Принципы диагностики и лечения (обзор литературы)
(Fascial distortion model (FDM-therapy). Principles of diagnosis and treatment (literature review))
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. I.
Russian Osteopathic Journal, 2020/09
Free full text
1093

Структура соматических дисфункций у женщин с узловой формой миомы матки
(The structure of somatic dysfunctions in women with a nodular form of uterine myoma)
Chebotaeva, G. N., Lebedev, D. S.
Russian Osteopathic Journal, 2020/09
Free full text
1094

Влияние общего остеопатического лечения на функцию внешнего дыхания детей, страдающих астмой
(Effects of a General Osteopathic treatment on asthmatic children)
Ernoult, B., Job, H.
Russian Osteopathic Journal, 2020/09
Free full text
1095

Обоснование применения методов остеопатической коррекции у пациентов с синдромом Зудека
(Rationale for the use of osteopathic correction methods in patients with Sudeck syndrome)
Mikhnov, G. I., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/09
Free full text
1096

Возможности применения остеопатических методов коррекции в лечении болевого синдрома при нефроптозе
(Possibilities of applying of osteopathic correction methods in the treatment of pain syndrome in nephroptosis)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/09
Free full text
1097

Применение физио- и бальнеотерапии у пациентов с неспецифической болью в нижней части спины (обзор литературы)
(The application of physical therapy and balneology of the patients with non-specific low back pain (literature review))
Novikov, A. Y., Shaiakhmetov, A. R., Novikov, Y. O.
Russian Osteopathic Journal, 2020/09
Free full text
1098

Instrumentation used to assess pain in osteopathic interventions: A critical literature review
Santiago, R. J., Esteves, J., Baptista, J. S., Marques, A. T., Costa, J. T.
International Journal of Osteopathic Medicine, 2020/09
1099

Does Osteopathic Manipulative Treatment Induce Autonomic Changes in Healthy Participants? A Thermal Imaging Study
Cerritelli, F., Cardone, D., Pirino, A., Merla, A., Scoppa, F.
Frontiers in Neuroscience, 2020/08
Free full text
1100

Osteopathic Considerations for the Pregnant Patient with COVID-19
Gray, K. M., Murphy, L., Buckner, B.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1101

Effectiveness of Osteopathic Manipulative Medicine vs Concussion Education in Treating Student Athletes With Acute Concussion Symptoms
Yao, S. C., Zwibel, H., Angelo, N., Leder, A., Mancini, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1102

Osteopathic Manipulative Treatment for Inhaled Rib Somatic Dysfunction
Koch, J., Tsui, C., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1103

Treatment Modalities for Notalgia Paresthetica Including OMT
Cooley, D., McAree, M., Joshi, N., Peerzada, W.
Osteopathic Family Physician, 2020/08
Free full text
1104

Effects of Osteopathic Manipulative Treatment on Sleep Quality in Student Athletes After Concussion: A Pilot Study
Mazzeo, S., Silverberg, C., Oommen, T., Moya, D., Angelo, N., Zwibel, H., Mancini, J., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1105

Rib Somatic Dysfunction Among General Surgical Patients
Baltazar, G. A., Kolwitz, C. E., Florek, M. G.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1106

Clinical Efficacy of Mesenteric Lift to Relieve Constipation in Traumatic Brain Injury Patients
Berry, J. A. D., Ogunlade, J., Kashyap, S., Berry, D. K., Wacker, M., Miulli, D. E., Saini, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1107

Use of Osteopathic Manipulation for Treatment of Chronic Shoulder Injury Related to Vaccine Administration
Veera, S., Chin, J., Kleyn, L., Spinelli, S., Tafler, L.
Cureus, 2020/08
Free full text
1108

Positional plagiocephaly from structure to function: Clinical experience of the service of pediatric osteopathy in Italy
Filisetti, M., Cattarelli, D., Bonomi, S.
Early Human Development, 2020/07
1109

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07
1110

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07
1111

Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Cicchitti, L., Di Lelio, A., Barlafante, G., Cozzolino, V., Di Valerio, S., Fusilli, P., Lucisano, G., Renzetti, C., Verzella, M., Rossi, M. C.
Medical sciences, 2020/07
Free full text
1112

Osteopathic Manipulation in the Management of Chronic Pain: Current Perspectives
Licciardone, J. C., Schultz, M. J., Amen, B.
Journal of Pain Research, 2020/07
Free full text
1113

Auswirkungen osteopathischer Techniken an der Pleura parietalis auf das Atemvolumen: Eine Pilotstudie mit gesunden Erwachsenen
(Effects of osteopathic techniques applied to the Pleura parietalis on the respiratory volume: a pilot study with healthy adults)
Strnad, V.
Unpublished MSc thesis, 2020/07
Free full text
1114

Osteopathic Response to the COVID-19 Pandemic
Martinez, E., Redding, D.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1115

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1116

Regulationsstörung bei Säuglingen: neue An- und Aussichten
(Regulation disorder in infants: new approaches and prospects)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1117

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1118

Die visuelle Vorstellung in der osteopathischen Palpation
(Visual Imagination in Osteopathic Palpation)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1119

Neuro-Ocular Release: A New Osteopathic Technique For Resolving Somatic Dysfunction
Feely, R. A., Smith, J. A.
The AAO Journal, 2020/06
Free full text
1120

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text
1121

Integrating Osteopathic Manipulative Treatment and Injections in the Diagnosis and Management of a Hip Labral Tear
Snyder, L. L., Knox, S. C., Smutny, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1122

Das Konzept „Hotelzimmer Uterus” möchte als anschauliche Allegorie dem Osteopathen und der (werdenden) Mutter aufzeigen, dass potenzielle Schockenergien, insbesondere in den Uteruswänden, einen negativen Effekt auf ein Ungeborenes haben oder sogar eine erfolgreiche Schwangerschaft verhindern kann. Es werden insbesondere Themen wie Kindsverlust und sexuelle Übergriffe angesprochen, da sie erfahrungsgemäß am ehesten gespeicherte (potenzielle) Schockenergien im gynäkologischen System hinterlassen. Das Phänomen Schockenergie wie auch die therapeutischen Ansätze zu deren Ausleitung werden kurz erläutert, insbesondere auch eventuelle Risiken bei der Behandlung in der Schwangerschaft.
(Shock in the uterus: The “hotel room“ phenomenon)
Muntinga, E.
Osteopathische Medizin, 2020/06
1123

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1124

Skoliose und Osteopathie: Teil 2: Osteopathische Behandlung
(Scoliosis and osteopathy. Part 2: Osteopathic treatment)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/06
1125

Effects of Osteopathic Manipulative Treatment on Musicians: A Systematic Review
Kiepe, M. S., Fernholz, I., Schmidt, T., Brinkhaus, B., Schmidt, A., Weikert, C., Rotter, G.
Medical problems of performing artists, 2020/06
1126

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text
1127

Влияние остеопатической коррекции на спортивные достижения спортсменов-автогонщиков
(Influence of osteopathic correction on sports achievements of racing athletes)
Azarenkova, A. M., Safin, R. F.
Russian Osteopathic Journal, 2020/06
Free full text
1128

Общее остеопатическое лечение в терапии пациентов с хронической головной болью напряжения
(Global osteopathic treatment in the therapy of patients with chronic tension headache)
Belash, V. O., Bruk, I. I.
Russian Osteopathic Journal, 2020/06
Free full text
1129

Остеопатическая коррекция при лечении боли в нижней части спины
(Osteopathic correction in the treatment of pain in the lower back)
Belash, V. O., Novikov, Y. O.
Russian Osteopathic Journal, 2020/06
Free full text
1130

Влияние остеопатической коррекции на функциональное состояние спортсменов при занятиях восточными единоборствами (кендо)
(Influence of osteopathic correction on the functional state of the athletes′ organism during the training process of martial arts practicing (Kendo))
Fasikov, R. M., Safin, R. F.
Russian Osteopathic Journal, 2020/06
Free full text
1131

Возможность применения остеопатической коррекции в комплексной терапии пациентов после стернотомии, выполненной в связи с хирургическим лечением приобретенного порока сердца
(Possibility of osteopathic correction in the complex therapy of patients after sternotomy performed in connection with the surgical treatment of acquired heart defects)
Glushkov, A. A., Salakhov, R. G., Yunusova, A. D., Lebedev, D. A.
Russian Osteopathic Journal, 2020/06
Free full text
1132

Möglicher Erfolg einer individualisierten osteopathischen Behandlung für die Lebensqualität bei einem Patienten mit einem idiopathischen zentralen Diabetes insipidus
(Potential success of an individualised osteopathic therapy for the quality of life of a patient suffering from an idiopathic central diabetes insipidus)
Zenner, C.
Unpublished MSc thesis, 2020/06
Free full text
1133

Обоснование совместного применения остеопатической коррекции и метода кинезиотейпирования при лечении синдрома плечелопаточного периартроза (плечелопаточной периартропатии)
(The rationale for the joint use of osteopathic correction and kinesiotherapy in the humeroscapular periarthrosis syndrome (humeroscapular periarthropathy) treatment)
Lebedev, E. B., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/06
Free full text
1134

Влияние остеопатической коррекции на психоэмоциональное состояние и качество жизни беременных с сопутствующей патологией мочевыводящей системы
(Influence of osteopathic correction on the psychoemotional state and quality of life of pregnant women with concomitant pathology of the urinary system)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/06
Free full text
1135

Обоснование применения остеопатической коррекции при лечении пациенток с хроническим заболеванием вен нижних конечностей
(Rationale for the use of osteopathic correction in the treatment of patients with chronic lower limb vein disease)
Shmeleva, A. S., Mizonova, I. B.
Russian Osteopathic Journal, 2020/06
Free full text
1136

Моноцентровое проспективное исследование влияния остеопатического лечения на здоровье пациентов, страдающих невралгией полового нерва
(Effects of Osteopathic Care on patients suffering with pudendal neuralgia: a prospective monocentric study)
Tessier, A., Morin, M.P.
Russian Osteopathic Journal, 2020/06
Free full text
1137

Применение остеопатической коррекции совместно с радоновыми ваннами на санаторно-курортном этапе реабилитации пациентов с дорсопатией
(The use of osteopathic correction in conjunction with radon baths at the sanatorium-resort stage of rehabilitation of patients with dorsopathy)
Ul′ikhina, N. V., Shiryayeva, E. E.
Russian Osteopathic Journal, 2020/06
Free full text
1138

Manualtherapeutische Behandlung des Zwerchfells bei Asthma bronchiale: Studien geben Hoffnung
(Manual therapy treatment of the diaphragm in bronchial asthma: studies give hope)
Funke, P., Grasmück, J., Merkt, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1139

Beliefs about chronic low back pain amongst osteopaths registered in Spain: A cross-sectional survey
Van Biesen, T., Alvarez, G.
International Journal of Osteopathic Medicine, 2020/06
1140

Behandlung einer stauungsbedingten Trigeminusneuralgie
(Treatment of trigeminal neuralgia as a result of congestion)
Hartmann, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1141

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1142

Weekly Osteopathic Manipulative Treatment to Improve Measures of Sympathetic Tone in Women With Polycystic Ovary Syndrome: A Randomized, Controlled Pilot Study
Davis, S. E., Hendryx, J., Menezes, C., Bouwer, S., Menezes, H., Patel, V., Bostick Smith, C. A., Speelman, D. L.
The Journal of the American Osteopathic Association, 2020/05
Free full text
1143

Evaluation of the stomatognathic system before and after osteopathic manipulative treatment in 120 healthy people by using surface electromyography
Manzotti, A., Viganoni, C., Lauritano, D., Bernasconi, S., Paparo, A., Risso, R., Nanussi, A.
International Journal of Environmental Research and Public Health, 2020/05
Free full text
1144

Revisión sistemática del tratamiento de la fibromialgia con osteopatía
(Systematic review of the treatment of fibromyalgia with osteopathy)
Giraldo Cardona, S.
Unpublished MSc thesis, 2020/05
Free full text
1145

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05
1146

The Five Diaphragms in Osteopathic Manipulative Medicine: Myofascial Relationships, Part 1
Bordoni, B.
Cureus, 2020/05
Free full text
1147

Visceral Mobilization and Functional Constipation in Stroke Survivors: A Randomized, Controlled, Double-Blind, Clinical Trial
Pasin Neto, H., Borges, R. A.
Cureus, 2020/05
Free full text
1148

Osteopathische Intervention bei Mydriasis nach Contusio bulbi
(Osteopathic Intervention for Mydriasis after Contusio bulbi)
Lehnen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1149

Der Subarachnoidalraum – ein Zwischenraum mit unterschätzter Bedeutung
(The subarachnoid space - an interspace with underestimated importance)
Muntinga, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1150

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1151

Wie erleben Cancer Survivors eine osteopathische Behandlung und wie hat diese zum allgemeinen Wohlbefinden (well-being) beigetragen? : eine qualitative Studie
(How do cancer survivors experience osteopathic treatment and how has it contributed to their overall well-being? : a qualitative study)
Meuwly, N.
Unpublished MSc thesis, 2020/04
Free full text
1152

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1153

Osteopathic manipulative treatment combined with exercise improves pain and disability in individuals with non-specific chronic neck pain: A pragmatic randomized controlled trial
Groisman, S, Malysz, T, de Souza da Silva, L., Rocha Ribeiro Sanches, T., Camargo Bragante, K., Locatelli, F., Pontel Vigolo, C., Vaccari, S., Homercher Rosa Francisco, C., Monteiro Steigleder, S., Jotz, G. P.
Journal of Bodywork and Movement Therapies, 2020/04
1154

Severe Postoperative Chronic Constipation Related to Anorectal Malformation Managed with Osteopathic Manipulative Treatment
Vismara, L., Cozzolino, V., Pradotto, L. G., Gentile, R., Tarantino, A. G.
Case Reports in Gastroenterology, 2020/04
Free full text
1155

Osteopathic Manipulative Treatment Relieves Post-concussion Symptoms in a Case of Polytrauma
Baltazar, G. A., Kolwitz, C., Petrone, P., Stright, A., Joseph, D'A.
Cureus, 2020/04
Free full text
1156

Inhibitory Tests as Assessment Tools for Somatic Dysfunctions: Mechanisms and Practical Applications
Bicalho, E., Vieira, L., Makita, D. K., Rivas, L.
Cureus, 2020/04
Free full text
1157

The Effect of High Velocity Low Amplitude Cervical Manipulations on the Musculoskeletal System: Literature Review
Giacalone, A., Febbi, M., Magnifica, F., Ruberti, E.
Cureus, 2020/04
Free full text
1158

Überaktive Blase bei Frauen - der Zusatznutzen von Osteopathie zur Standardtherapie Blasentraining
(Overactive Bladder in Women - Benefit of osteopathy in addition to standard bladder-training)
Cecon, S.
Unpublished MSc thesis, 2020/03
Free full text
1159

Perception des effets d'un traitement ostéopathique sur la qualité et la pratique du chant : une étude qualitative
(Perceived effects of osteopathic treatment on the quality and practice of singing: a qualitative study)
Christe, C.
Unpublished MSc thesis, 2020/03
Free full text
1160

Effect of Osteopathic Manipulative Therapy on Generalized Anxiety Disorder
Dixon, L., Fotinos, K., Sherifi, E., Lokuge, S., Fine, A., Furtado, M., Anand, L., Liberatore, K., Katzman, M. A.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1161

Osteopathic Manipulative Medicine in the Era of the Single Accreditation System: Can the Past Guide the Way to the Future of OMM?
Kanze, D.M.
The AAO Journal, 2020/03
Free full text
1162

Transitions: Our Own, Our Patients’, Our Profession’s
Newman, D.B.
The AAO Journal, 2020/03
Free full text
1163

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text
1164

Assessment and Management of Somatic Dysfunctions in Patients With Patellofemoral Pain Syndrome
Tramontano, M., Pagnotta, S., Lunghi, C., Manzo, C., Manzo, F., Consolo, S., Manzo, V.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1165

Effektivität osteopathischer Maßnahmen bei Dysgnathie-Patienten post operationem: Eine Pilotstudie
(Effectiveness of osteopathic measures in postoperative dysgnathia patients: A pilot study)
Rost, H., Makuch, A.
Osteopathische Medizin, 2020/03
1166

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1167

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1168

Characteristics and Treatment of Pediatric Patients in an Osteopathic Manipulative Medicine Clinic
Kaiser, G., Degenhardt, B. F., Michael Menke, J., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1169

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1170

An osteopathic approach to Graves’ ophthalmopathy: A case report
McDermott, G., Qureshi, Y., Foster-Moumoutjis, G., Espejo, A.
International Journal of Osteopathic Medicine, 2020/03
Free full text
1171

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text
1172

The Intraosseous Dysfunction in the Osteopathic Perspective: Mechanisms Implicating the Bone Tissue
Bicalho, E.
Cureus, 2020/03
Free full text
1173

Osteopathic Manipulative Medical Assistant: A Proposed Allied Profession
Lennon, J. L.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1174

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1175

Osteopathic Medical Care With and Without Osteopathic Manipulative Treatment in Patients With Chronic Low Back Pain: A Pain Registry-Based Study
Licciardone, J. C., Gatchel, R. J.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1176

Eine systematische Übersichtsarbeit über osteopathische manuelle Therapie bei Pneumonie
(Osteopathic Manual Treatment in Pneumonia: A systematic review)
Kafader, J. C.
Unpublished MSc thesis, 2020/02
Free full text
1177

Die akute Sprunggelenksverletzung in der osteopathischen Praxis
(The acute ankle injury in osteopathic practice)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1178

The labor study: Labor length and birth outcomes osteopathic research
Martingano, D., Mitrofanova, A., Kim, A. F., Ulfers, A., Mersch, M., Stevenson, R., Singh, S.
American Journal of Obstetrics & Gynecology, 2020/01
1179

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01
1180

Isometric osteopathic manipulation influences on cervical ranges of motion and correlation with osteopathic palpatory diagnosis: A randomized trial
Niewiadomski, C., Bianco, R. J., Arnoux, P. J., Evin, M.
Complementary Therapies in Medicine, 2020/01
1181

Lateral Strain Patterns at the Sphenobasilar Synchondrosis
Burruano, M. P.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1182

Forschung und Osteopathie – ein Widerspruch? Ein Versuch der Auflösung am Beispiel des DO-Touch.Net
(Research and Osteopathy - a contradiction? An approach to solution using the example of DO-Touch.Net)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1183

Das cerebrospinale venöse System: Anatomie, Physiologie und Pathologie diskutiert im Kontext der Osteopathie
(The cerebrospinal venous system: anatomy, physiology and pathology in the context of osteopathy)
Flenker, J.
Unpublished MSc thesis, 2020/01
Free full text
1184

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020
1185

A Comparative Study of the Heart as a Fulcrum in Relation to the Central Chain and the Ancient Wisdom of the Pervuvian Healers
Friesecke, D.
Unpublished D.O. thesis, 2019/5
Free full text
1186

Who Uses Osteopathic Manipulative Treatment? A Prospective, Observational Study Conducted by DO-Touch.NET
Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2019/12
Free full text
1187

Impact of Predoctoral Teaching Fellows on Osteopathic Medical Students: A Near-Peer Teaching Program Evaluation
Akers, B., Davis, G., Keys, J., Pierce-Talsma, S. L., Lund, G.
The AAO Journal, 2019/12
Free full text
1188

Influence of postoperative adhesions after caesarean section on chronic lower back pain – A pilot study of osteopathic manipulative treatment
Liedler, M., Woisetschläger, G.
European Journal of Osteopathic Research, 2019/12
Free full text
1189

An Osteopathic Approach to Traumatically Induced Mechanical Dyspnea: A Case Report
Kanze, D. M.
The AAO Journal, 2019/12
Free full text
1190

Applying Osteopathic Manipulative Treatment to Postconcussion Syndrome: A Case Report
Yao, S. C.
The AAO Journal, 2019/12
Free full text
1191

Impact of osteopathic manipulative treatment on range of motion of the pelvis during the one-sided tilt test: a pilot study
Menard, M., Ferrari, M., Bouchet, A., Puchaud, P., Vaucher, P., Sutre, F., Bideau, B., Bourgin, M.
HAL CCSD Taylor & Francis, 2019/12
Free full text
1192

Остеопатическая коррекция соматических дисфункций у детей дошкольного возраста с задержкой речевого развития
(Osteopathic correction of somatic dysfunctions in preschool children with delayed speech development)
Abramova, E. V., Aptekar, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1193

Constipation in Parkinson’s Disease Improved by an Osteopathic Manipulative Medicine Sequence in a Repeated Measures Study
Valasareddi, S., Mathai, M., Li, T. S., Yao, S. C., Mancini, J.
The Journal of the American Osteopathic Association, 2019/12
1194

Обоснование применения остеопатической коррекции в комплексной реабилитации больных с консолидированными переломами большого бугорка плечевой кости
(Justification of the use of osteopathic correction in the complex rehabilitation of patients with consolidated fractures of the large tubercle of the humerus)
Bogachev, A. A., Kutuzov, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1195

Роль генерализованной мышечной гиперфасилитации в патогенезе и клинической картине миофасциального болевого синдрома. Возможный вариант её коррекции
(The role of generalized muscule hyperfacilitation in pathogenesis and clinical picture of myofascial pain syndrome. Possible option of its correction)
Boldin, A. V., Agasarov, L. G., Tardov, M. V., Bokova, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1196

Возможности остеопатической коррекции соматических дисфункций у детей с хроническим аденоидитом
(Possibilities of osteopathic correction of somatic dysfunctions in children with chronic adenoiditis)
Chaiko, E. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2019/12
Free full text
1197

Корреляционные связи между некоторыми ритмами организма у пациентов врача-остеопата
(Correlation between certain rhythms of the body in osteopathic patients)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/12
Free full text
1198

Efeitos da manipulação osteopática em trabalhadores feirantes com dor lombar crônica inespecífica: ensaio clínico randomizado
(Effects of osteopathic manipulation in fairground workers with chronic nonspecific low back pain: randomized clinical trial)
Estrázulas, J. A.
Unpublished MSc thesis, 2019/12
Free full text
1199

Побочные эффекты и качество жизни пациентов при химиотерапии: оценка влияния остеопатической коррекции (многоцентровое рандомизированное клиническое исследование)
(Secondary effects and quality of life with chemotherapy: assessing the impact of an osteopathic treatment (multicentric randomized clinical trial)
Favier, N., Guinet, A. G., Nageleisen, M., Ceccaldi, B., Pujade-Lauraine, E., LeFoll, C., Soudain-Pineau, M., Turlin, C., Stubbe, L.
Russian Osteopathic Journal, 2019/12
Free full text
1200

Возможности применения остеопатической коррекции в лечении сочетанной формы бесплодия
(Possibilities of using osteopathic correction in treatment of combined forms of infertility)
Nenashkina, E. N.
Russian Osteopathic Journal, 2019/12
Free full text
1201

Developing “Migraneous” Rat Models to Evaluate the Efficacy of OMT on Various Migraine Biomarkers
Byrd, K. E., Gregory, C., Krishna, S., Xie, J. Y., Fleming, R. K.
The Journal of the American Osteopathic Association, 2019/12
1202

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12
1203

Эпидемиологические и клинические аспекты хронического пиелонефрита у беременных и остеопатическое сопровождение беременных, страдающих хроническим пиелонефритом
(Epidemiological and clinical aspects of chronic pyelonephritis in pregnant women and osteopathic follow-up of pregnant women with chronic pyelonephritis)
Nenashkina, E. N., Tregubova, E. S., Belash, V. O.
Russian Osteopathic Journal, 2019/12
Free full text
1204

Osteopathic Manipulative Medicine Vs Counseling in the Treatment of Sports-Related Concussion: Comparative Balance Assessment
Morris, J. Z., Shah, J., Zwibel, H., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12
1205

Головная боль напряжения у пациентов с сопутствующей скелетно-мышечной патологией
(Tension-type headache in patients with concomitant musculoskeletal disorders)
Novikov, Y. O., Salakhov, I. E.
Russian Osteopathic Journal, 2019/12
Free full text
1206

The Effect of OMM on Opioid Users with Chronic Low Back Pain
Patel, K. C., Cooley, D. L., Bailey, J. W., Janora, D. M., Fusco, C.
The Journal of the American Osteopathic Association, 2019/12
1207

The Efficacy of Osteopathic Manipulative Treatment on Decreasing the Severity of Migraine Headaches
Rhoads, A., Metzgar, M. M., Donovan, P.
The Journal of the American Osteopathic Association, 2019/12
1208

Клиническая эффективность остеопатической коррекции в комплексном лечении больных с неоперированной открытоугольной глаукомой
(Clinical efficacy of osteopathic correction in the complex treatment of patients with unoperated open-angle glaucoma)
Simakova, E. N., Stenkova, O. V.
Russian Osteopathic Journal, 2019/12
Free full text
1209

Остеопатическое сопровождение спортсменов в годовом тренировочном процессе
(Osteopathic support of sportsmen during the annual training process)
Yakupov, R. A., Safiullina, G. I., Safiullina, A. A., Burganov, E. R.
Russian Osteopathic Journal, 2019/12
Free full text
1210

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text
1211

The Role of Mental Imagery in Osteopathic Palpation: a qualitative study
Kraml, M. M., Besse, J.P.
European Journal of Osteopathic Research, 2019/11
Free full text
1212

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11
1213

The Effect of Osteopathic Manual Treatment on Concussion Injury Rehabilitation
Henderson, L. D.
Unpublished MSc thesis, 2019/11
Free full text
1214

The Benefits and Limitations of Evidence-based Practice in Osteopathy
Bordoni, B.
Cureus, 2019/11
Free full text
1215

Psychological context effects of participant expectation on pain pressure thresholds as an adjunct to cervicothoracic HVLA thrust manipulation: A randomised controlled trial
Shackleton, E., Toutt, C., Edwards, D. J.
International Journal of Osteopathic Medicine, 2019/11
1216

Einfluss von Osteopathie auf die gesundheitsbezogene Lebensqualität von Frauen nach Sectio caesarea
(Influence of osteopathy on the health-related quality of life of women after caesarean section)
Rehak, M.
Unpublished MSc thesis, 2019/10
1217

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1218

Die Anwendung osteopathischer Techniken zur Behandlung bei chronisch obstruktiver Lungenerkrankung (COPD)
(The use of osteopathic techniques in the management of the chronic obstructive pulmonary disease (COPD))
Lebersorger, P.
Unpublished MSc thesis, 2019/10
Free full text
1219

Herzratenvariabilitätsanalyse in der Osteopathie und Manualmedizin
(Heart rate variability in manual medicine)
Klumpp, M.
Unpublished MSc thesis, 2019/10
Free full text
1220

Osteopathie zur Behandlung von Schlafstörungen bei Kindern: Eine klinische Studie mit Drei- bis Sechsjährigen
(Osteopathy for the Treatment of Sleep Disturbances of Children: A Clinical Study Among 3-6 Year Olds)
Ellersdorfer, A.
Unpublished MSc thesis, 2019/10
Free full text
1221

Effectiveness of an osteopathic treatment on the autonomic nervous system: a systematic review of the literature
Rechberger, V., Biberschick, M., Porthun, J.
European Journal of Medical Research, 2019/10
Free full text
1222

Einfluss einer osteopathischen Behandlung der vier Diaphragmen des Rumpfes nach Zink auf die Bewegungen des Center of pressure von Personen mit Rückenbeschwerden
(The impact of an osteopathic treatment of the four diaphragms after Zink on the movement of the center of pressure of individuals with back pain)
Arztmann, A.
Unpublished MSc thesis, 2019/10
Free full text
1223

Understanding the role of osteopathic manipulative medicine in the management of gastrointestinal disorders and symptoms: a survey study
Shah, R. N., Diehl, D. L., Graham, J., Kim, A. H., Loughlin, M. T.
The American Journal of Gastroenterology, 2019/10
Free full text
1224

Effects of Osteopathic Visceral Treatment in Patients with Gastroesophageal Reflux: A Randomized Controlled Trial
Eguaras, N., Rodriguez-Lopez, E. S., Lopez-Dicastillo, O., Franco-Sierra, M. A., Ricard, F., Oliva-Pascual-Vaca, A.
Journal of Clinical Medicine, 2019/10
1225

Osteopathie bei Spondylitis ankylosans (Morbus Bechterew)
(Osteopathy in ankylosing spondylitis (Bechterew's disease))
Gugganig, K.
Unpublished MSc thesis, 2019/10
Free full text
1226

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10
1227

Einfluss der osteopathischen Behandlung im Rahmen der stationären Anschlussheilbehandlung bei Patienten mit Zustand nach Hüft-TEP-Implantation. Randomisierte kontrollierte Studie.
(Influence of osteopathic treatment during post-hospital curative treatment in patients after total hip arthroplasty. A randomized controlled trial)
Behm, B., Mattern, E. R.
Unpublished D.O. thesis, 2019/10
1228

Wechselbeziehung von Mittelohrpathologien und Mobilität des Os temporale bei Säuglingen mit Lippen-Kiefer-Gaumenspalten - ein Pilotprojekt
(Middle Ear Pathologies and the Mobility of the Temporal Bone in Children with Cleft Lip and Palate - A Pilot Study)
Wedenig, K.
Unpublished MSc thesis, 2019/10
1229

Können osteopathische Behandlungen Einfluss auf die Intensität und Dauer der Schmerzen bei Frauen mit primärer Dysmenorrhoe nehmen? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with primary dysmenorrhea. A randomized controlled trial)
Plathner, M., Wolf, L.
Unpublished D.O. thesis, 2019/10
1230

Osteopathic Manipulative Treatment for Allostatic Load Lowering
Nuno, V., Siu, A., Deol, N., Juster, R. P.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1231

Einfluss osteopathischer Behandlung der Fascia thoracolumbalis bei chronisch unspezifischen Rückenschmerzen
(The influence of osteopathic treatment on the thoracolumbar fascia in case of chronic non-specific low back pain)
Putz, F.
Unpublished MSc thesis, 2019/10
Free full text
1232

Does Compression of the Fourth Ventricle Cause Preterm Labor? Analysis of Data From the PROMOTE Study
Hensel, K. L., Roane, B. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1233

Rezidivierende Harnwegsinfekte und Reizblase
(Recurrent urinary tract infections and irritable bladder)
Kilian-von Hofe, K.
Osteopathische Medizin, 2019/09
1234

Effektivität einer osteopathischen Therapie auf das autonome Nervensystem: Eine systematische Übersichtsarbeit
(Effectiveness of an osteopathic treatment on the autonomic nervous system A systematic review of the literature)
Rechberger, V.
Unpublished MSc thesis, 2019/09
Free full text
1235

Das Restless-Legs-Syndrom und die Nierenregion - Können osteopathische Behandlungen die Symptome verbessern?
(The Restless Legs Syndrome and Kidney Region - Can Osteopathic Treatment Influence the Symptoms?)
Lotz, S.
Unpublished MSc thesis, 2019/09
Free full text
1236

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text
1237

Osteopathic Approach for Lateral Knee Pain Caused by Iliotibial Band Friction Syndrome: A Case Report
Kostanjevec, J., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
1238

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy in somatoform disorders - Systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
Free full text
1239

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1240

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1241

Effektivität der osteopathischen Behandlung eines Maldescensus testis bei Kindern im Alter von neun Monaten bis sechs Jahren
(Effectiveness of the osteopathic treatment of maldescensus testis in children from 9 months to 6 years of age)
Roch, U.
Unpublished MSc thesis, 2019/09
Free full text
1242

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
1243

Integrating Osteopathic Evaluation and Treatment in a Case Report of Acute Chest Pain
Yao, S. C.
The AAO Journal, 2019/09
Free full text
1244

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09
1245

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09
1246

Temporomandibuläre Dysfunktion (TMD) mit Diskusprolaps
(Temporomandibular dysfunction (TMD) with discus prolapse: Case study on the efficacy of osteopathic treatment)
Vathrakokoilis, K., Liem, T., Aetopoulos, I., Antoniadis, K., Triantafyllidou, E.
Osteopathische Medizin, 2019/09
1247

Osteopathic Manipulation Treatment Improves Cerebro-splanchnic Oximetry in Late Preterm Infants
Marinelli, B., Pluchinotta, F., Cozzolino, V., Barlafante, G., Strozzi, M. C., Marinelli, E., Franchini, S., Gazzolo, D.
Molecules, 2019/09
Free full text
1248

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text
1249

A Literature Review of Osteopathic Manipulative Techniques for Otalgia
Lindsey, T., Lawson, R., Hiffernan, F.
Osteopathic Family Physician, 2019/09
1250

Beschleunigungstrauma der Halswirbelsäule
(Whiplash injury in the cervical spine)
Belz, S., Baum, N.
Osteopathische Medizin, 2019/09
1251

Is visceral manipulation beneficial for patients with low back pain? A systematic review of the literature
Switters, Jacob Marten, Podar, Stefan, Perraton, Luke, Machotka, Zuzana
International Journal of Osteopathic Medicine, 2019/09
1252

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy for somatoform disorders - a systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1253

Efficacy of osteopathic treatment in patients with stable moderate-to-severe chronic obstructive pulmonary disease: a randomized controlled pilot study
Buscemi, A., Pennisi, V., Rapisarda, A., Pennisi, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2019/08
1254

Muscle energy technique for chronic obstructive pulmonary disease: a systematic review
Baxter, D. A., Shergis, J. L., Fazalbhoy, A., Coyle, M. E.
Chiropractic & Manual Therapies, 2019/08
1255

Empathy in Medicine Osteopathic and Allopathic Physician Interpersonal Manner, Empathy, and Communication Style and Clinical Status of Their Patients: A Pain Registry-Based Study
Licciardone, J. C., Schmitt, M. E., Aryal, S.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1256

Assessment of shoulder pain and somatic dysfunction in young competitive swimmers: Preventive Osteopathic Manipulative Treatment
Granger, F., Etevenard, M., Kily, J. P., Garet, M.
Journal of Sports Medicine and Therapy, 2019/08
Free full text
1257

Osteopathic Manipulative Therapy in Patients With Chronic Tension-Type Headache: A Pilot Study
Deodato, M., Guolo, F., Monticco, A., Fornari, M., Manganotti, P., Granato, A.
The Journal of the American Osteopathic Association, 2019/08
1258

Stretch Receptor and Somatic Dysfunction: A Narrative Review
Andrews, M. A. W.
The Journal of the American Osteopathic Association, 2019/08
1259

Revisión sistemática de la terapia osteopática en el tratamiento del Síndrome del túnel del carpo
(Efficacy of osteopathic therapy in the management of carpal tunnel syndrome)
Mesa Palacio, A. M.
Unpublished MSc thesis, 2019/08
Free full text
1260

Effects of Post-Isometric Relaxation on Ankle Plantarflexion and Timed Flutter Kick in Pediatric Competitive Swimmers
Noto-Bell, L., Vogel, B. N., Senn, D. E.
The Journal of the American Osteopathic Association, 2019/08
1261

Understanding Myalgic Encephalomyelitis/Chronic Fatigue Syndrome and the Emerging Osteopathic Approach: A Narrative Review
Larrimore, C., Ramnot, A., Jaghab, A., Sarduy, S., Guerrero, G., Troccoli, P., Hilton, K., Bested, A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1262

OMT for the Prevention and Management of Chronic Constipation and Distal Intestinal Obstructive Syndrome in Cystic Fibrosis: A Pilot Study
Modlin, S. E., Borofka, K., Franzini, D., Klene-Bowns, A. C., Nuño, V. A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1263

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1264

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
1265

Differences in Function and Comorbidities Between Older Adult Users and Nonusers of Chiropractic and Osteopathic Manipulation: A Cross-sectional Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2019/07
1266

Влияние остеопатической коррекции на восстановление функций голеностопного сустава при частичном повреждении его связок
(The influence of osteopathic correction on the restoration of the functions of the ankle joint with partial damage of its ligaments)
Alekseev, V. N., Naumenko, E. Y.
Russian Osteopathic Journal, 2019/07
1267

Результаты остеопатической коррекции у пациентов с посттравматической кокцигодинией
(Results of osteopathic correction of patients with post-traumatic coccygodynia)
Antonova, Y. V., Iskandarov, A. M., Mizonova, I. B.
Russian Osteopathic Journal, 2019/07
1268

La lumbalgia: La visión desde la osteopatía y medicina tradicional del Palenque San Basilio
(Low back pain: The vision of osteopathy and traditional medicine of Palenque San Basilio)
Ayala Ardila, D. P.
Unpublished MSc thesis, 2019/07
Free full text
1269

Изменение функциональной активности фибробластов в процессе моделирования компрессии, гиперкапнии и гипоксии
(Сhange in the functional activity of fibroblasts in the process of modelling of compression, hypercapnia and hypoxia)
Aptekar, A. I., Kostolomova, E. G., Sukhovey, Y. G.
Russian Osteopathic Journal, 2019/07
1270

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text
1271

Влияние остеопатической коррекции на частоту различных ритмов организма
(The influence of osteopathic correction on the rate of various rhythms of the body)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
1272

Эффективность дополнительных методов лечения постинсультной периартропатии плечевого сустава
(The effectiveness of additional treatment methods for post-stroke periarthropathy of the shoulder joint)
Kozlova, N. S., Amelin, A. V.
Russian Osteopathic Journal, 2019/07
1273

Возможности остеопатической коррекции в комплексной терапии дисфункции височно-нижнечелюстного сустава
(Possibilities of osteopathic correction in complex therapy of temporomandibular joint dysfunction)
Milutka, Y. A., Yushmanov, I. G., Badmaeva, A. N.
Russian Osteopathic Journal, 2019/07
1274

Рандоминизированное контролируемое исследование эффективности остеопатической манипуляционной коррекции при мышечной кривошее вследствие родовой травмы
(Randomized controlled study of the effectiveness of osteopathic manipulative correction for muscular torticollis due to birth injury)
Novikov, Y. O., Mokhov, D. E., Amigues, J.P., Musina, G. M., Shaiakhmetov, A. R.
Russian Osteopathic Journal, 2019/07
1275

Изменение электрической активности кожи во время остеопатического воздействия с применением биодинамического подхода
(Change of skin electrical activity during osteopathic correction with the use of biodynamical approach)
Novikov, Y. O., Shaiakhmetov, A. R., Musina, G. M.
Russian Osteopathic Journal, 2019/07
1276

Остеопатическая коррекция в комплексном лечении синдрома карпального канала при закрытых осложненных переломах предплечья
(Osteopathic correction in complex treatment of carpal tunnel syndrome with complicated closed forearm fractures)
Sebaykin, Y. V., Mokhov, D. E., Tarusova, K. S., Nechoroshev, S. N.
Russian Osteopathic Journal, 2019/07
1277

Влияние остеопатической коррекции на вязкоупругие характеристики мышц голени
(The influence of osteopathic correction on the viscoelastic characteristics of the lower leg muscles)
Timanin, E. M., Sydneva, N. S., Zakharova, A. A.
Russian Osteopathic Journal, 2019/07
1278

Effect of Osteopathic Obstetrical Management on the Duration of Labor in the Inpatient Setting: A Prospective Study and Literature Review
Martingano, D., Ho, S., Rogoff, S., Chang, G., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1279

The Combined Shoulder Technique: A Novel Approach in the Treatment of Scapular Dysfunction—A Case Report
Kanze, D. M.
The AAO Journal, 2019/06
Free full text
1280

Osteopathische Behandlung bei Pertussis im 19. und 20. Jahrhundert
Osteopathic treatment of pertussis in the 19th and 20th centuries: A structured historical literature review
Liem, T.
Osteopathische Medizin, 2019/06
1281

Restoring Full Squat Range of Motion by Applying OMT to Superior Innominate Shear: A Case Report
Lewis, D. D., Pickos, J.
The AAO Journal, 2019/06
Free full text
1282

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06
1283

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06
1284

Integrated pilot medical study on 40 patients affected by open angle glaucoma undergoing topical therapy with additional osteopathic manipulation
Paoli, D., Brusini, P., Michelin, L., Vassallo, F., Ciullo, L., Torelli, L.
Acta Ophthalmologica, 2019/06
1285

A Study to Investigate the Effect of ‘Frontal Lift’ Osteopathic Manipulative Technique (OMT) in Patients with Chronic Sinusitis
Lintonbon, David
American Journal of Biomedical Science & Research, 2019/06
1286

Do empathic osteopaths achieve better clinical results? An observational feasibility study
Acquati, A., Uberti, S., Aquino, A., Cerasetti, E., Castagna, C., Rovere-Querini, P., Pisa, V.
International Journal of Osteopathic Medicine, 2019/06
1287

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1288

¿La Manipulación Osteopática Mejora la Función Mecánica y Física y la Simetría Espinal en Golfistas?
(Does Osteopathic Manipulation Lead to Improvements in Physical and Muscle Mechanical Function and Spinal Symmetries in Golfers?)
Rojas-Valverde, D., Sánchez García, A., Sáez Ulloa, D., Gutiérrez-Vargas, R.
Kronos, 2019/06
Free full text
1289

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06
1290

Patient experience, satisfaction, perception and expectation of osteopathic manipulative treatment: A systematic review
Lam, M. T., Banihashem, M., Lam, H. R., Wan, A. B., Chow, E.
International Journal of Osteopathic Medicine, 2019/06
1291

The role of osteopathic complementary treatment in high frequency paediatric headache: a randomised controlled study
Rossi, R., Versace, A., Lauria, B., Grasso, G., Bagagiolo, D., Cappitella, E., Altieri, R., Delli Santi, M., Scarinzi, C., Urbino, A. F.
Neurological Sciences, 2019/06
1292

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1293

A systematic review of non-invasive manual therapies in the management of irritable bowel syndrome
Badenhorst, N.
Unpublished MSc thesis, 2019/06
1294

OSLO – Effets d’un traitement ostéopathique manuel sur la lombalgie non spécifique aiguë dans un service d’accueil des urgences : un protocole d’essai randomisé contrôlé monocentrique
(OSLO – Effects of osteopathic manipulative therapy for acute nonspecific low back pain in emergency room: design of a randomised monocentric controlled trial)
Ginier-Gillet, M.
Unpublished MSc thesis, 2019/06
1295

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06
1296

Osteopathic Approach to the Treatment of a Patient With an Atypical Presentation of Coccydynia
Alexandre, K., Channell, M. K.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1297

Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Levy, V. J., Holt, C. T., Haskins, A. E.
The Journal of the American Osteopathic Association, 2019/05
Free full text
1298

Einfluss von Osteopathie auf die Symptomatik, Häufigkeit und die Medikamenteneinnahme von PatientInnen mit episodisch-häufigem Spannungskopfschmerz
(Impact of Osteopathic Treatment on Frequent Tension-type Headache)
Huemer, D.
Unpublished MSc thesis, 2019/05
Free full text
1299

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text
1300

Cynefin Framework for Evidence-Informed Clinical Reasoning and Decision-Making
Lunghi, C., Baroni, F.
The Journal of the American Osteopathic Association, 2019/05
Free full text
1301

Desenvolvimento de técnicas manipulativas osteopáticas para tratamento da síndrome do impacto do ombro baseado na biomecânica
(Development of osteopathic manipulative technique for impingement syndrome of shoulder treatment based on the biomechanics)
Louro, S. M.
Unpublished MSc thesis, 2019/05
Free full text
1302

Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative pilot study of osteopathy and electrostimulation /biofeedback for pelvic floor
Bogner, D.
European Journal of Osteopathic Research, 2019/04
Free full text
1303

Manual therapy for musculoskeletal pain in cystic fibrosis: Review of the literature
Graziano, L., Giordani, B., Nico, D., Colella, E., Savi, D., Cimino, G., Di Vito, A., Valente, D., Palange, P.
Italian Journal of Pediatrics, 2019/04
1304

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text
1305

Osteopathic Manipulative Treatment in a Paediatric Patient with Oesophageal Atresia and Tracheo-Oesophageal Fistula
Barni, A., Zecchillo, D., Uberti, S., Ratti, S.
Gastroenterology, 2019/04
1306

Analyse comparative entre la thérapie manuelle orthopédique et l'ostéopathie une mise au point sur la situation en Belgique
(Comparative analysis between orthopaedic manual therapy and osteopathy: Focus on the Belgian situation)
Hidalgo, B., Demoulin, C.
Revue Medicale de Liege, 2019/04
Free full text
1307

Manipulasjonsteknikker ved nakkeasymmetri hos spedbarn
(Manipulation techniques for infant torticollis)
Brurberg, K. G., Dahm, K. T., Kirkehei, I.
Tidsskrift for den Norske Laegeforening, 2019/04
Free full text
1308

Allopathic supervision of osteopathic education: What support is needed?
James, S. J., Zakletskaia, L:
Osteopathic Family Physician, 2019/04
1309

Effects of osteopathic manipulative treatment on patients with multiple sclerosis: A pilot study
Porcari, B., Russo, M., Naro, A., La Via, C., Pullia, M., Accorinti, M., De Luca, R., Calabro, R. S.
Complementary Therapies in Medicine, 2019/04
1310

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04
1311

Osteopathic Manipulative Treatment as a Novel Way to Manage Postvasectomy Pain Syndrome
Gray, R. E., Kasper, K.
The Journal of the American Osteopathic Association, 2019/04
Free full text
1312

Patient satisfaction and perception of treatment in a student-led osteopathy teaching clinic: Evaluating questionnaire dimensionality and internal structure, and outcomes
Vaughan, B., Burns, C., Burridge, L., Wigger, J., Blair, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2019/03
1313

Osteopathic Structural Findings in Women During Menstruation
Cabrera, K. L., Darwish, A. M., Lurz, K. L., L., McClain. R., McClain, E., Cox, J., Segars, L.
The AAO Journal, 2019/03
Free full text
1314

Un audit clinique ostéopathique visant à décrire les procédures d’examen, de diagnostic, de traitement et de consentement chez des patientes présentant des douleurs pelviennes chroniques : projet de recherche
(An osteopathic clinical audit to describe examination, diagnosis, treatment and consent procedures in patients with chronic pelvic pain: a research project)
Cettou, N.
Unpublished MSc thesis, 2019/03
Free full text
1315

Ernährungswissen von Osteopathinnen und Osteopathen
(Knowledge of Nutrition Issues among Osteopaths)
Putschögl, J.
Unpublished MSc thesis, 2019/03
Free full text
1316

Die Rolle der mentalen Vorstellung in der Palpation von Osteopathen
(The role of mental imagery in osteopathic palpation)
Kraml, M.
Unpublished MSc thesis, 2019/03
Free full text
1317

Rescued Root Canal: A Case Report on OMT for Jaw Pain Following Repeat Root Canal Procedure
Fong, K. F., Rummel, T. B.
The AAO Journal, 2019/03
Free full text
1318

Effektivität von Osteopathie bei Patientinnen mit lumbalen Rückenschmerzen und/oder Beckengürtelschmerzen in der Schwangerschaft und Post Partum - systematic review
(The effectiveness of osteopathy for low back pain and pelvic girdle pain during and after pregnancy - a systematic review)
König, M.
Unpublished MSc thesis, 2019/03
Free full text
1319

Der Effekt von osteopathischen Behandlungen auf das Tagesprofil des Speichelcortisols
(The effect of osteopathic treatments on the diurnal profile of salivary cortisol)
Hämmerli, U.
Unpublished MSc thesis, 2019/03
Free full text
1320

Exploration des méthodes d’identification et des stratégies de gestion du stress et de l’anxiété des patients par l’ostéopathe : étude qualitative
(Exploring methods of identification and strategies for management of patient stress and anxiety by the osteopath: a qualitative study)
Piaget, B.
Unpublished MSc thesis, 2019/03
Free full text
1321

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text
1322

Dans quelle mesure la prise en charge ostéopathique des gonalgies chez les adolescents et les adultes est en concordance avec les bonnes pratiques ? : un sondage
(To what extent is osteopathic management of gonalgia in adolescents and adults in line with good practice? A survey)
Rossier, F.
Unpublished MSc thesis, 2019/03
Free full text
1323

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text
1324

Osteopathie bei Bone Bruise
(Osteopathy for bone bruise)
Bick, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
1325

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
1326

Die Kinderosteopathie aus Sicht der Kinderärzte. Eine qualitative Interview-Studie
(Pediatric osteopathy: What registered pediatricians think about it - A qualitative interview study)
Seidner, K., Belz, S.
Osteopathische Medizin, 2019/03
1327

Manual therapy for the pediatric population: a systematic review
Parnell Prevost, C., Gleberzon, B., Carleo, B., Anderson, K., Cark, M., Pohlman, K. A.
BMC Complementary and Alternative Medicine, 2019/03
Free full text
1328

Klinische und osteopathische Bedeutung der beidseitigen Blutdruckmessung. Nützlich bei “Thoracic outlet Syndrome“?
(Clinical and osteopathic significance of bilateral blood pressure measurement. Useful with “Thoracic outlet syndrome“?)
Stattin, E.
Unpublished MSc thesis, 2019/03
Free full text
1329

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text
1330

Dancers’ experience of osteopathy and their attitudes towards dance injuries
Maddren, K.
Unpublished MSc thesis, 2019/03
Free full text
1331

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text
1332

Does somatic dysfunction lead to lower extremity injuries in the high school soccer player?
Wisinski, J., Lipp, T., Dougherty, J. J.
Clinical Journal of Sport Medicine, 2019/03
1333

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03
1334

Short-term effectiveness of the flexion-distraction technique in comparison with high-velocity vertebral manipulation in patients suffering from low-back pain
Carrasco-Martínez, F., Ibáñez-Vera, A. J., Martínez-Amat, A., Hita-Contreras, F., Lomas-Vega, R.
Complementary Therapies in Medicine, 2019/03
1335

Effects of Practicing Osteopathic Manipulative Treatment (OMT) on Hand Function
Barnum, I. F. O., Chang, M. E., Patterson, R. M., Surve, S.
UNTHSC Scholarly Repository, 2019/03
1336

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text
1337

Osteopathic Manipulative Treatment: A Primary Care Approach
Bodine, W. A.
American Family Physician, 2019/02
1338

Assessment of the Efficacy of An Osteopathic Treatment in Infants with Biomechanical Impairments to Suckling
Herzhaft-LeRoy, J., Xhignesse, M., Gaboury, I.
Journal of Visualized Experiments, 2019/02
1339

Osteopathic Manipulative Treatment for Pertussis in the 19th and 20th Centuries: A Structured Historical Literature Review
Liem, T.
The Journal of the American Osteopathic Association, 2019/02
Free full text
1340

Evaluating Patient's Understanding of Pain Neurophysiology: Rasch Analysis of the Neurophysiology of Pain Questionnaire
Vaughan, B., Mulcahy, J., Fitzgerald, K., Austin, P.
The Clinical Journal of Pain, 2019/02
1341

Osteopathische Behandlung bei akut traumatischen Zuständen: die Kraft der Flüssigkeiten
(Osteopathic treatment for acute traumatic conditions: the power of fluids)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
1342

Nonpharmacologic Management of Symptoms in Females With Polycystic Ovary Syndrome: A Narrative Review
Speelman, D. L.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1343

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1344

The Italian Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross sectional survey
Cerritelli, F., van Dun, P. L. S., Esteves, J. E., Consorti, G., Sciomachen, P., Lacorte, E., Vanacore, N.
PLoS One, 2019/01
Free full text
1345

Ultrasound Evaluation of Diaphragmatic Mobility and Contractility After Osteopathic Manipulative Techniques in Healthy Volunteers: A Prospective, Randomized, Double-Blinded Clinical Trial
Mancini, D., Cesari, M., Lunghi, C., Benigni, A. M., Antonelli Incalzi, R., Scarlata, S.
Journal of Manipulative and Physiological Therapeutics, 2019/01
1346

Women’s experiences of osteopathic care whilst living with endometriosis
Waugh, M. D.
Unpublished MSc thesis, 2019/01
Free full text
1347

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01
1348

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1349

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12
1350

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text
1351

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text
1352

Effect of the soft-tissue techniques in the quality of life in patients with Crohn's disease: A randomized controlled trial
Espi-Lopez, G. V., Ingles, M., Soliva-Cazaban, I., Serra-Ano, P.
Medicine (Baltimore), 2018/12
Free full text
1353

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1354

Can lateral epicondylitis be relief by osteopathic treatments targeting tensions from the thoracic region? Results of a case study
Brisson-Larouche, A., Kassab, G., Wehbe, W.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1355

Effect of global osteopathic treatment on functional mobility in the parkinsonian patient: A quasi-experimental study
Devantéry, K., Bouchard, J.C.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1356

The effect of early osteopathic manual treatment (OMT) care, after vaginal delivery, on pelvic health recovery
Fafard, A.M.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1357

Assessing the immediate behavioural responses of hospitalized preterm babies during osteopathic manipulative treatment (OMT): A case series
O'Connor, S., Lafrenaye, S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1358

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text
1359

Immediate effect of T2, T5, T11 thoracic spine manipulation of asymptomatic patient on autonomic nervous system response: Single-blind, parallel-arm controlled-group experiment
Minarini, G., Ford, M., Esteves, J.
International Journal of Osteopathic Medicine, 2018/12
1360

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text
1361

Osteopaticheskaia korrektsiia v kompleksnoi terapii i reabilitatsii patsientov s sindromom pozvonochnoi arterii.
[The use of the osteopathic correction for the combined treatment and rehabilitation of the patients presenting with the vertebral artery syndrome]
Belash, V. O., Mokhov, D. E., Tregubova, E. S.
Voprosy Kurortologii, Fizioterapii, i Lechebnoi Fizicheskoi Kultury, 2018/12
1362

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text
1363

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text
1364

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
The Journal of the American Osteopathic Association, 2018/11
1365

The Effect of Osteopathic Manipulative Medicine on Oxidative Stress Following Mild Traumatic Brain Injury: A Pilot Study
Angelo, N., Mazzeo, S., Oommen, T., Zwibel, H., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1366

Osteopathy and patients who have experienced sexual violence: management, treatment and self-care
Michael-Anna, E.
Unpublished MSc thesis, 2018/11
Free full text
1367

Clinically Based OMM Competency Standards for Physicians in Residencies Designated With Osteopathic Recognition in the Single Accreditation System for GME
Cooper Rau Jr., D., Merritt, M.
The Journal of the American Osteopathic Association, 2018/11
1368

The Effect of Osteopathic Manipulative Treatment on Reactive Oxygen Species in Parkinson Disease
Docherty, J., Chu, K., Orshan, D., Kulason, K., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1369

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1370

Managing Tremor in Parkinson Disease Using Osteopathic Manipulative Medicine
Li, R., Docherty, J., Koo, S. L., Shinners, J., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1371

Using Wearable Technology to Measure the Effectiveness of Osteopathic Manipulative Treatment on Parkinson Disease Motor Symptoms
Poon, J., Docherty, J., Mancini, J., DiFrancisco-Donoghue, J., Cheriyan, G., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
1372

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11
1373

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1374

Kann die Schwangerschaftsrate nach technisch assistierter Reproduktion durch osteopathische Behandlungen erhöht werden?
(Can the pregnancy rate after assisted reproductive technology be increased through osteopathic treatments?)
Samouh, S.
Unpublished MSc thesis, 2018/10
Free full text
1375

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10
1376

Die osteopathische Behandlung aus PatientInnensicht – Interviews mit PatientInnen über ihre subjektive Befindlichkeit während osteopathischen Behandlungen
(The osteopathic treatment from the patient's point of view - Interviews with patients about their subjective well-being during osteopathic treatments)
Hocher, J.
Unpublished MSc thesis, 2018/10
Free full text
1377

Die Rolle der Eltern in der osteopathischen Säuglingsbehandlung innerhalb der ersten drei Lebensmonate aus Sicht von Eltern und OsteopathInnen
(The Role of the Parents in Osteopathic Care of Infants within the First Three Months of Life from the Parents’ and Practitioners’ Perspectives)
Bechinie, C.
Unpublished MSc thesis, 2018/10
Free full text
1378

(Effectiveness of osteopathic treatment in patients with chronic knee pain. A randomized controlled trial)
Weitendorff, A.
Unpublished D.O. thesis, 2018/10
1379

Meralgia paresthetica: A 5 model osteopathic approach
Torrents, M., Malik, R.
Osteopathic Family Physician, 2018/10
Free full text
1380

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10
1381

Möglicher Erfolg einer individualisierten osteopathischen Behandlung für die Lebensqualität und das Angstbefinden bei einer Patientin mit einer chronischen Lungensarkoidose.
(Possible success of an individualized osteopathic treatment regarding the quality of life and the state of anxiety of a patient with a chronic lung sarcoidosis)
Origer, S.
Unpublished MSc thesis, 2018/10
Free full text
1382

Messung des Effekts einer Midline-Behandlung. Eine randomisierte kontrollierte Studie mit gesunden Erwachsenen.
(Measuring the effect of a midline treatment: randomized controlled trial in healthy adults)
Galoppi, M.
Unpublished MSc thesis, 2018/10
Free full text
1383

A Short Review of the Treatment of Headaches Using Osteopathic Manipulative Treatment
Whalen, J., Yao, S., Leder, A.
Current Pain and Headache Reports, 2018/10
1384

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text
1385

An Osteopathic Approach to Rib Somatic Dysfunction in Respiratory Disorders
Pierce-Talsma, S., Talsma, J., Ferrill, H.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1386

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1387

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
1388

Behandlung einer Patientin mit Schulter-Arm-Syndrom nach proximaler Radiusfraktur infolge eines Sturzes
(Treatment of a patient with shoulder-arm syndrome after proximal radius fracture as a result of a fall: Commented case study on the article “Resonance and dialogue: On the methodology of a neuroregulative treatment model“)
Metcalfe-Wiegand, D.
Osteopathische Medizin, 2018/09
1389

The Immediate Effect of Therapeutic Touch and Deep Touch Pressure on Range of Motion, Interoceptive Accuracy and Heart Rate Variability: A Randomized Controlled Trial With Moderation Analysis
Edwards, D. J., Young, H., Johnston, R.
Frontiers in Integrative Neuroscience, 2018/09
Free full text
1390

In welchem Ausmaß kann die Osteopathie bei Kindern mit Zerebralparese die Bewegung mit funktionellen Konsequenzen und die Lebensqualität positiv beeinflussen
(To what extend can osteopathy have a positive influence on movement with functional consequences and quality of life by children with cerebral palsy)
Schneider, D.
Unpublished MSc thesis, 2018/09
1391

Osteopathic Manipulative Treatment Including Specific Diaphragm Techniques Improves Pain and Disability in Chronic Nonspecific Low Back Pain: A Randomized Trial
Marti-Salvador, M., Hidalgo-Moreno, L., Domenech-Fernandez, J., Lison, J. F., Arguisuelas, M. D.
Archives of Physical Medicine and Rehabilitation, 2018/09
1392

Primary care physicians' attitude and reported prescribing behavior for chronic low back pain: An exploratory cross-sectional study
Rodondi, P. Y., Dubois, J., Bill, A. S., Koutaissoff, D., Ros, J., Aveni, E., Pasquier, J., Herzig, L., Decosterd, I., Burnand, B.
PLoS One, 2018/09
Free full text
1393

Ernährungswissen: Integrativer Bestandteil der Osteopathie in Deutschland?
(Nutritional Knowledge: An integrative part of osteopathy in Germany?)
Nier, R.
Unpublished MSc thesis, 2018/09
Free full text
1394

Osteopathic Manipulative Therapy and Multiple Sclerosis: A Proof-of-Concept Study
Cordano, C., Armezzani, A., Veroni, J., Pardini, M., Sassos, D., Infante, M. T., Tacchino, A., Lapucci, C., Cellerino, M., Calabro, V., Ciullo, L., Nourbakhsh, B.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1395

Effectiveness of an Osteopathic Abdominal Manual Intervention in Pain Thresholds, Lumbopelvic Mobility, and Posture in Women with Chronic Functional Constipation
Martinez-Ochoa, M. J., Fernandez-Dominguez, J. C., Morales-Asencio, J. M., Gonzalez-Iglesias, J., Ricard, F., Oliva-Pascual-Vaca, A.
The Journal of Alternative and Complementary Medicine, 2018/08
1396

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1397

Medical Infrared Thermography in back pain osteopathic management
Polidori, G., Kinne, M., Mereu, T., Beaumont, F., Kinne, M.
Complementary Therapies in Medicine, 2018/08
1398

Progressive Infantile Scoliosis Managed With Osteopathic Manipulative Treatment Response
Feely, R. A., Kapraun, H. E.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1399

Treatment of bilateral dyshidrotic eczema with drugs versus nutritional and osteopathic treatment
Aceranti, A., Vernocchi, S.
Italian Journal of Medicine, 2018/07
Free full text
1400

Osteopathic Lymphatic Pump Techniques
Franzini, D., Cuny, L. A., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1401

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1402

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07
1403

Role of osteopathic manipulative treatment in cystic fibrosis: A pilot study
Fainardi, V., Benecchi, S., Longo, F., Tripodi, M. C., Villani, M. L., Teopompi, E., Chetta, A. A., Pisi, G.
Journal of Cystic Fibrosis, 2018/07
1404

Use of complementary health approaches at military treatment facilities, active component, U.S. Armed Forces, 2010-2015
Williams, V. F., Clark, L. L., McNellis, M. G.
Medical Surveillance Monthly Report, 2018/07
1405

Enablers and barriers to the development of interprofessional collaboration between physicians and osteopaths: A mixed methods study
Morin, C., Desrosiers, J., Gaboury, I.
Journal of Interprofessional Care, 2018/07
1406

Lymphatic Pump Treatment Mobilizes Bioactive Lymph That Suppresses Macrophage Activity In Vitro
Castillo, R., Schander, A., Hodge, L. M.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1407

Osteopathic Manipulative Therapy Potentiates Motor Cortical Plasticity
Ponzo, V., Cinnera, A. M., Mommo, F., Caltagirone, C., Koch, G., Tramontano, M.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1408

Osteopathic Evaluation and Post-Surgical Rehabilitation Approach in a Patient With Myelopathy and Tetraparesis Related to Cervical Ependymoma: A Case Report
Lewis, D. D.
The AAO Journal, 2018/06
Free full text
1409

The immediate effects of two manual therapy techniques on ankle musculoarticular stiffness and dorsiflexion range of motion in people with chronic ankle rigidity: A randomized clinical trial
Hidalgo, B., Hall, T., Berwart, M., Biernaux, E., Detrembleur, C.
Journal of Back and Musculoskeletal Rehabilitation, 2018/06
1410

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text
1411

Osteopathic Cranial Manipulative Medicine in the Setting of Concussion
Warren, C., Keys, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1412

Osteopathic manipulative treatment for post mastectomy pain: A case report
Downey, H. F.
International Journal of Osteopathic Medicine, 2018/06
1413

The use of osteopathic manipulative medicine in the treatment of headaches for a patient with subdural hematomas in the setting of traumatic brain injury
Bonthala, S., Falco, C.
The Journal of Head Trauma Rehabilitation, 2018/06
1414

An exploration of osteopaths' views and experiences regarding the identification of, and provision of advice for, urinary incontinence in women: A qualitative study using framework analysis
Robinson, M. E., Ford, S. L., Goodman, L. B.
International Journal of Osteopathic Medicine, 2018/06
1415

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects
Abdelfattah, A., Abdelraoof, N., Nasef, S.
Internal Medicine Journal, 2018/05
Free full text
1416

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05
1417

Efficacy of Osteopathic Manipulative Treatment in the Patient of Chronic Rhinosinusitis: A Case Report
Baisakhiya, N.
An International Journal Clinical Rhinology, 2018/05
1418

Myofascial Release Therapy Beneficial for Patients With Chronic Low Back Pain
Jazayeri, S., Seffinger, M.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1419

Fibromyalgia Symptoms Reduced by Osteopathic Manipulative Medicine and Gabapentin
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1420

Osteopathic Manipulation Shown to Improve Upper Airway Stabilization
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1421

Cervical Osteopathic Manipulation Shown to Affect Median Nerve Function
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1422

Manipulation and mobilization for treating chronic low back pain: a systematic review and meta-analysis
Coulter, I. D., Crawford, C., Hurwitz, E. L., Vernon, H., Khorsan, R., Suttorp Booth, M., Herman, P. M.
The Spine Journal, 2018/05
Free full text
1423

Restoration of Full Shoulder Range of Motion After Application of the Fascial Distortion Model
Boucher, J. D., Figueroa, J.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1424

Neck-stomach syndrome in the cervical spondylosis: An update on preliminary 2017 data
Ramieri, A., Miscusi, M., Costanzo, G.
European Spine Journal, 2018/04
1425

Fibromyalgia with Gabapentin and Osteopathic Manipulative Medicine: A Pilot Study
Marske, C., Bernard, N., Palacios, A., Wheeler, C., Preiss, B., Brown, M., Bhattacharya, S., Klapstein, G.
The Journal of Alternative and Complementary Medicine, 2018/04
1426

Chronic inflammatory exposure changes the phenotype of human skeletal muscle cells
McManus, C., Richardson, C.
FASEB Journal, 2018/04
1427

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1428

How type and number of training sessions influence the reliability of palpation
Lavazza, C., Milano, V., Abenavoli, A., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2018/04
1429

Osteopathic manipulative treatment in chronic coccydynia: A case series
Origo, D., Tarantino, A. G., Nonis, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2018/04
1430

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04
1431

The immediate effect of osteopathic cervical spine mobilization on median nerve mechanosensitivity: A triple-blind, randomized, placebo-controlled trial
Whelan, G., Johnston, R., Millward, C., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2018/04
1432

IGeL-Monitor. Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text
1433

Effectiveness of 2 Osteopathic Treatment Approaches on Pain, Pressure-Pain Threshold, and Disease Severity in Patients with Fibromyalgia: A Randomized Controlled Trial
Albers, J., Jäkel, A., Wellmann, K., von Hehn, U., Schmidt, T.
Complementary medicine research, 2018/04
1434

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
1435

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
1436

Einfluss der osteopathischen Therapie auf funktionelle Sehstörungen beim Schulkind
(Influence of osteopathic therapy on functional visual disorders in schoolchildren)
Nestel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
Free full text
1437

Wann braucht ein Kind Physiotherapie und wann Osteopathie?
(When does a child need physiotherapy and when do they need osteopathy?)
Schwahn, N., Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
1438

Osteopathic Manipulative Treatment in the Management of Pediatric Headache and Orthodontic Intervention: A Case Report
Heineman, K.
The AAO Journal, 2018/03
Free full text
1439

Characterizing Adverse Events Reported After Osteopathic Manipulative Treatment
Degenhardt, B. F., Johnson, J. C., Brooks, W. J., Norman, L.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1440

Shaping conservative spinal services with the Spine Tango Registry
Morris, S., Booth, J.
European spine journal, 2018/03
1441

The Safety of Osteopathic Manipulative Treatment (OMT)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1442

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1443

OMT for Patients With Sacral Somatic Dysfunction
Yu, K., Pfotenhauer, K., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1444

“Der schiefe Kopf“ Befundungs- und Behandlungsprozess bei Säuglingen mit Plagiozephalie mittels Experteninterviews
(“The Oblique Head“ Follow-Up and Treatment Process for Infants with Orthesis by Interview of Experts)
Michaelis, C.
Unpublished MSc thesis, 2018/03
Free full text
1445

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text
1446

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text
1447

Assessment of cervical stiffness in axial rotation among chronic neck pain patients: A trial in the framework of a non-manipulative osteopathic management
Dugailly, P. M., Coucke, A., Salem, W., Feipel, V.
Clinical Biomechanics, 2018/03
1448

Work-related musculoskeletal injuries among Australian osteopaths: A preliminary investigation
McLeod, G. A., Murphy, M., Henare, T. M., Dlabik, B.
International Journal of Osteopathic Medicine, 2018/03
1449

Effektivität der osteopathischen Behandlung bei Patienten mit chronischem Knieschmerz, eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with chronic knee pain, a randomized controlled study)
Weitendorff, A.
Unpublished MSc thesis, 2018/03
1450

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03
1451

Kann durch eine Serie von osteopathischen Behandlungen die Lebensqualität von Bewohnern eines Altenheims, die an Osteoporose erkrankt sind, mehr verbessert werden als mit einer alternativen Behandlung in Form von Bewegungstherapie?
(Can the quality of life of an elderly who is affected by osteoporosis be improved through a series of osteopathic treatments, rather than with an alternative treatment in the form of movement therapy?)
Preis, G.
Unpublished MSc thesis, 2018/03
Free full text
1452

Pilotstudie über den Einfluss der osteopathischen Behandlung des Mesenteriums auf das Atemvolumen
(Pilot study on the influence of the treatment of the mesentery on the respiratory volume)
Muigg, E.
Unpublished MSc thesis, 2018/03
Free full text
1453

The effects of osteopathic treatment on psychosocial factors in people with persistent pain: A systematic review
Saracutu, M., Rance, J., Davies, H., Edwards, D. J.
International Journal of Osteopathic Medicine, 2018/03
1454

Einfluss osteopathischer Behandlung bei Subacromialem Impingement-Syndrom (SAIS)
(Influence of Osteopathic Treatment on Subacromial Impingement Syndrome (SAIS))
Grill, H.
Unpublished MSc thesis, 2018/03
Free full text
1455

Osteopathie bei Rücken- und Beckengürtelschmerzen während und nach der Schwangerschaft
(Osteopathy in low back pain and pelvic girdle pain during and after pregnancy: Systematic review and meta-analysis)
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Osteopathische Medizin, 2018/03
1456

Mechanical Link – Protokoll für eine individuelle Diagnostik und Therapie
(Mechanical link - Protocol for an individual diagnostics and therapy)
Hafen-Bardella, C.
Osteopathische Medizin, 2018/03
1457

OMT to Address the Physiologic Effects of Stress
Emmet, D., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/02
Free full text
1458

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text
1459

Osteopathic Manipulative Treatment in Surgical Care: Short Review of Research Publications in Osteopathic Journals During the Period 1990 to 2017
Sposato, N. S., Bjersa, K.
Journal of Evidence-Based Integrative Medicine, 2018/02
Free full text
1460

Einfluss postoperativer Adhäsionen nach Sektio auf chronischen Low Back Pain - eine Pilotstudie
(Influence of postoperative adhesion after caesarean section on chronic lower back pain - a pilot study)
Liedler, M.
Unpublished MSc thesis, 2018/02
Free full text
1461

Osteopathische intrauterine Behandlung einer kongenitalen Lungenzyste
(Osteopathic intrauterine treatment of a congenital lung cyst)
Urbanek, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
1462

Chronic Pain Management: Perspective of an Osteopathic Medical Student in New Mexico
Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1463

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1464

Effects of spinal manipulation and myofascial techniques on heart rate variability: A systematic review
Amoroso Borges, B. L., Bortolazzo, G. L., Neto, H. P.
Journal of Bodywork and Movement Therapies, 2018/01
1465

Postural and autonomic modifications following osteopathic manipulative treatment (OMT): Comparison between two techniques. A pilot study
Scoppa, F., Pirino, A., Belloni, G., Gallamini, M., Messina, G., Iovane, A.
Acta Medica Mediterranea, 2018/01
Free full text
1466

Lymphatic Vessels Found in the Brain-Osteopathic Considerations, Part 2: Now in Humans and Monkeys
King, H. H.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1467

Manual therapy for unsettled, distressed and excessively crying infants: a systematic review and meta-analyses
Carnes, D., Plunkett, A., Ellwood, J., Miles, C.
BMJ Open, 2018/01
Free full text
1468

Combined osteopathy and exercise management of Achilles tendinopathy in an athlete
Ross, G., Macfarlane, C., Vaughan, B.
The Journal of Sports Medicine and Physical Fitness, 2018/01
1469

Safety of Osteopathic Cranial Manipulative Medicine as an Adjunct to Conventional Postconcussion Symptom Management: A Pilot Study
Patel, K. G., Sabini, R. C.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1470

OMT for Cancer Patients After Bowel Resection
Pena, N., Prieto, H., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1471

Tools zum Erlernen der Palpation
(Tools for learning palpation)
Krause, R.
Osteopathische Medizin, 2017/12
1472

Palpatory and Ultrasound Assessment of Cervical Dysfunctions and the Effect of Cervical High-Velocity, Low-Amplitude (HVLA) Technique
Flaum, T. B., Mirza, A., Rusnack, F. M-A., Apoznanski, T. E., Munarova, A., Mazzie, J., Terzella, M. J., Yao, S. C.
The AAO Journal, 2017/12
Free full text
1473

Advancing the Understanding and Treatment of the Thoracic Inlet and Incorporation of a New Still Technique—Part 1
Lewis, D. D.
The AAO Journal, 2017/12
Free full text
1474

OMT for Patients With Multiple Sclerosis
Wolf, K., Krinard, T., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1475

Braucht es einen Paradigmenwechsel in der osteopathischen Diagnostik und Therapie im kraniozervikalen Bereich?
(Is a paradigm shift required in osteopathic diagnosis and treatment in the craniocervical junction?)
Moser, U.
Osteopathische Medizin, 2017/12
1476

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12
1477

Use of pressure dynamometer in the assessment of the pressure pain threshold in trigger points in the craniocervical muscles in women with unilateral migraine and tension-type headache: An observational study
Pires, R., da Rocha, N. S., Esteves, J. E., Rodrigues, M. E.
International Journal of Osteopathic Medicine, 2017/12
1478

Let's get physical!
Hickner, J.
The Journal of Family Practice, 2017/12
1479

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text
1480

Osteopathic manipulative treatment for post mastectomy lymphedema: A case report
Goyal, M, Goyal, K, Narkeesh, K., Samuel, A. J., Arumugam, N.
International Journal of Osteopathic Medicine, 2017/12
1481

Osteopathic Manipulative Treatment for the Management of Adjacent Segment Pathology
Lewis, D. D., Summers, G. K.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1482

Influence of perceived difficulty of cases on student osteopaths' diagnostic reasoning: a cross sectional study
Noyer, A. L., Esteves, J. E., Thomson, O. P.
Chiropractic & Manual Therapies, 2017/12
Free full text
1483

What are the risks of manual treatment of the spine? A scoping review for clinicians
Swait, G., Finch, R.
Chiropractic & Manual Therapies, 2017/12
Free full text
1484

Osteopathy and troublesome regurgitation in babies. The influence of a set of osteopathic techniques on the symptoms of troublesome regurgitation in babies. A randomized controlled clinical trial
Schepers, V.
Unpublished D.O. thesis, 2017/12
1485

Complementary and alternative therapies in dentistry and characteristics of dentists who recommend them
Baatsch, B., Zimmer, S., Rodrigues Recchia, D., Bussing, A.
Complementary Therapies in Medicine, 2017/12
1486

Median Arcuate Ligament Syndrome (MALS): Fallserie über die osteopathische Behandlung von sieben Patienten: Evidenzlevel IV gemäß CARE-Guideline
(Median arcuate ligament syndrome (MALS): Case series on the osteopathic treatment of seven patients. Evidence level IV according to CARE guidelines)
Beck, M.
Osteopathische Medizin, 2017/12
1487

Challenging Case of Parotitis: A Comprehensive Approach
Patel, P., Scott, S., Cunningham, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1488

Current Clinical Status of Osteopathy: Study Based on Retrospective Evidences of Six Years, A Systemic Review
Ahmad, R.
Annual Research & Review in Biology, 2017/11
Free full text
1489

Functional Limitations in Adults Who Utilize Chiropractic or Osteopathic Manipulation in the United States: Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2017/11
1490

Comparing the Effect of Osteopathic Manipulative Medicine Versus Concussion Education for the Acute Treatment of Mild Concussion Symptoms
Angelo, N., Zwibel, H., Leder, A., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
1491

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
1492

Touro California Student-Run Free Clinic: An Investigation of Actual vs Target Patient Demographic and the Impact of Osteopathic Manipulative Medicine in the Vallejo, California, Community
Jamall, S., Ang, B., Kimpo, J. V., Liu, B., Donn, E., Szeto, H., Devanney, J., Pearce, M.
The Journal of the American Osteopathic Association, 2017/11
1493

Osteopathic Manipulative Treatment Reduces Oxidative Stress Levels and Improves Relative Stiffness and Quality of Life in Parkinson Disease
Moriarty, S. A., Lu, V., Oommen, C., Bellavia, L. M., Lee, J. M., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
1494

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text
1495

Evaluation of New Zealand osteopathy patients experiences of their treatment
Judkins, R., Vaughan, B., Mulcahy, J.
Complementary Therapies in Clinical Practice, 2017/11
1496

Condylar Decompression Technique for Infants
Pierce-Talsma, S., Pena, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
1497

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text
1498

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10
1499

Manipulative scar treatment and ostheopatic manipulative treatment for pain, shoulder motion and quality of life in post-mastectomy pain syndrome (PMPS). A randomized clinical trial
Figini, D., Seghini, P., Bidin, L.
Annals of Oncology, 2017/10
1500

Kann die osteopathische Behandlung die Krankheitsaktivität bei Patienten mit rheumatoider Arthritis (RA) beeinflussen? Randomisierte kontrollierte Studie.
(The influence of osteopathic treatment in addition to the standard therapy on disease activity in patients with rheumatoid arthritis (RA). A randomized controlled trial)
Franzen, K., Ramscheidt, B.
Unpublished D.O. thesis, 2017/10
1501

Wirksamkeit einer ganzheitlichen osteopathischen Behandlung bei Menschen mit Depression und damit einhergehenden Schlafstörungen. Prä-Post-Studie.
(Effectiveness of individual osteopathic treatment in patients with depression and associated sleep disturbance. A pre-post study)
Gruber, J.
Unpublished D.O. thesis, 2017/10
1502

Einfluss einer osteopathischen Behandlung am Tag des errechneten Geburtstermins auf das Einsetzen einer physiologischen Geburt innerhalb eines 48-Stunden Zeitraums. Randomisierte kontrollierte Studie.
(The influence of an osteopathic treatment at due date on the onset of labor within a 48-hour period. A randomized controlled trial)
Huss, S., Klose, M., Patanchon, P.
Unpublished D.O. thesis, 2017/10
1503

Postpartale Beschwerden von Müttern nach einem Kaiserschnitt
(Postpartal complaints of mothers after Caesarean section)
Weiss, A.
Unpublished MSc thesis, 2017/10
1504

Osteopathic management of chronic constipation in women patients. Results of a pilot study
Belvaux, A., Bouchoucha, M., Benamouzig, R.
Clinics and Research in Hepatology and Gastroenterology, 2017/10
1505

Untersuchung der Effektivität von osteopathischen Behandlungen zusätzlich zur Standardtherapie bei Jugendlichen mit unspezifischen Kreuzschmerzen. Randomisierte kontrollierte Studie.
(Evaluation of effectiveness of osteopathic treatment in addition to standard therapy in adolescents with unspecific low lack pain (LBP). A randomized controlled trial)
Ringeisen, P.
Unpublished D.O. thesis, 2017/10
1506

Osteopathie bei gastroosophagealem Reflux mit Hiatushernie: Ein Fallbericht gemass der CARE-Leitlinie
(Osteopathic Treatment of Gastroesophageal Reflux Disease and Hiatal Hernia: A Case Report Following the CARE Guideline)
Rotter, G., Brinkhaus, B.
Complementary Medicine Research, 2017/10
Free full text
1507

Osteopathische Behandlung von Patienten mit Impingement-Syndrom der Schulter. Prä-Post-Studie.
(Effectiveness of individual osteopathic treatment in patients with shoulder outlet impingement. A pre-post study)
Tallo, F.
Unpublished D.O. thesis, 2017/10
1508

Developing an evidence base for osteopathic healthcare: an exploration of osteopathic healthcare to inform the design of an appropriate methodology to investigate its effectiveness
Orrock, P. J.
Unpublished PhD thesis, 2017/10
Free full text
1509

Die Pathophysiologie von postoperativen peritonealen Adhäsionen - Osteopathie als Behandlungsmöglichkeit?
(The pathophysiology of postoperative peritoneal adhesions - Osteopathy as a treatment option?)
Lackner, I.
Unpublished MSc thesis, 2017/10
Free full text
1510

Osteopathie und die Auswirkung auf den Trainingslevel der MFT Challenge Disc. Eine kontrollierte randomisierte klinische Pilotstudie an gesunden Personen.
(Osteopathy and its effect on the Training Level of the MFT Challenge Disc. A randomised controlled pilot study of healthy adults)
Moser-Dobaj, A.
Unpublished MSc thesis, 2017/10
Free full text
1511

An observational study of ultrasound to confirm cervical spine segmental positional rotation
Flaum, T. B., Rusnack, F. M., Mirza, A., Apoznanski, T. E., Munarova, A., Mazzie, J. P., Terzella, M.l J., Yao, S. C.
International Journal of Osteopathic Medicine, 2017/09/01/
1512

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text
1513

Prozessorientierung in der Osteopathie: ein Ansatz jenseits des Strukturmodells
(Process orientation in osteopathy: An approach beyond the structural model)
Lederman, E.
Osteopathische Medizin, 2017/09
1514

Die biodynamische Behandlung bei einem Patienten mit Makuladegeneration
(Biodynamic treatment of a patient suffering from macular degeneration)
Koop, J. P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
1515

Update zur Drainage des Gehirns und osteopathische Behandlungsansätze
Update on brain drainage and osteopathic treatment approaches
Liem, T.
Osteopathische Medizin, 2017/09
1516

Osteopathic Manipulative Treatment for Chronic Neck Pain, Headaches, and Referred Pain in a Patient With Myofascial Pain Syndrome: A Case Report
Lewis, D. D.
The AAO Journal, 2017/09
Free full text
1517

The Use of Osteopathic Manual Therapy and Rehabilitation for Subacromial Impingement Syndrome: A Case Report
Bennett, S., Macfarlane, C., Vaughan, B.
Explore (NY), 2017/09
1518

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
1519

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
1520

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
1521

Acupuncture Meridian-Based Myofascial Release to Treat Knee Pain in Sinding-Larsen–Johansson Syndrome: A Case Report
Valvano, K. D., Sina, R. E.
The AAO Journal, 2017/09
Free full text
1522

Interet clinique du traitement osteopathique chez les patientes ayant une endometriose colorectale : classification fondee sur les symptomes et la qualite de vie.
(Impact of osteopathic manipulative therapy in patient with deep colorectal endometriosis: A classification based on symptoms and quality of life)
Darai, C., Bendifallah, S., Foulot, H., Ballester, M., Chabbert-Buffet, N., Darai, E.
Gynecologie, Obstetrique, Fertilite & Senologie, 2017/09
1523

Osteopathic approach to treating a patient with congenital infantile torticollis reveals unusual presentation of absence of concomitant cranial base strain pattern: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/09
1524

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
1525

Integrating osteopathic approaches based on biopsychosocial therapeutic mechanisms. Part 1: The mechanisms
Fryer, G.
International Journal of Osteopathic Medicine, 2017/09
1526

Osteopathische Behandlung bei Coxarthrose
(Osteopathic Treatment of Patients with Coxarthrosis: A Randomised Controlled Trial)
Vögele, T.
Unpublished MSc thesis, 2017/09
Free full text
1527

Aus welchen Gründen und mit welchen Beschwerden kommen Mütter innerhalb 18 Monate post partum zum/zur Osteopathen/in und welche somatischen Dysfunktionen weisen sie auf?
(What are the reasons and complaints of mothers who consult an osteopath within 18 months postpartum, and which somatic dysfunctions do they have?)
Woitzik, K.
Unpublished MSc thesis, 2017/09
Free full text
1528

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
1529

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text
1530

Diagnostic reliability of osteopathic tests: A systematic review
Basile, F., Scionti, R., Petracca, M.
International Journal of Osteopathic Medicine, 2017/08
1531

Corrigendum to “Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research“ [Musculoskelet. Sci. Pract. 27 165-175]
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/08
1532

Efficacité d'un traitement ostéopathique pour les problématiques biomécaniques de succion des nouveau-nés
(Efficacy of an osteopathic treatment for infants with biomechanical sucking dysfunctions)
Herzhaft-Le Roy, J.
Unpublished MSc thesis, 2017/08
Free full text
1533

Conservative management of a traumatic meniscal injury utilising osteopathy and exercise rehabilitation: A case report
Feehan, J., Macfarlane, C., Vaughan, B.
Complementary Therapies in Medicine, 2017/08
1534

Successful outcome of musculoskeletal injury leads to a reduction in chronic fatigue: A case report
Todd, C.
Journal of Bodywork and Movement Therapies, 2017/07
1535

Efficacy of Osteopathic Manipulative Treatment Approach in the Patient with Pulmonary Fibrosis in Critical Care Outpatient Department
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Arumugam, N., Chatterjee, S., Sharma, S.
Indian Journal of Critical Care Medicine, 2017/07
Free full text
1536

The effectiveness of osteopathic manipulative treatment in an abnormal uterine bleeding related pain and health related quality of life (HR-QoL) - A case report
Goyal, K., Goyal, M., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S., Arumugam, N.
Journal of Bodywork and Movement Therapies, 2017/07
1537

Hypnosis and Osteopathic Manipulative Treatment for Visual Disorders During Pregnancy: A Case Report
Russo, G., Remonato, A., Remonato, R., Zanier, E.
Advances in Mind-Body Medicine, 2017/07
1538

Osteopathic approach to treating a patient with new onset low back pain following injury reveals unusual presentation of bilateral and symmetric symptoms: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/07
1539

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text
1540

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
1541

Osteopathic Approach to Anxiety
Blumer, T.., Blumer, J.
Osteopathic Family Physician, 2017/07
Free full text
1542

Wirkungen der Osteopathie im psychischen Bereich – eine systematische Literaturübersicht
(Effects of osteopathy in the psychological field - a systematic review)
Perstling, A., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
1543

Effects of Osteopathic Manipulative Therapy on Pain and Mood Disorders in Patients With High-Frequency Migraine
D'Ippolito, M., Tramontano, M., Buzzi, M. G.
The Journal of the American Osteopathic Association, 2017/06
Free full text
1544

Osteopathic manipulative treatment in soccer players with chronic groin pain: a pilot study
Nolli, L., Baraggiolo, S., PaganiI, M, Origo, D., Bergna, A., Vismara, L.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2017/06
1545

Osteopathie als aktuelle Satzungsleistung gesetzlicher Krankenkassen
(Osteopathy as current optional benefit of statutory health insurance companies)
Newiger, C.
Osteopathische Medizin, 2017/06
1546

Balanced Fascial Tension (BFT) am Beispiel der faszialen Hüllen des Herzens
(Balanced Fascial Tension (BFT) using the fascial sheaths of the heart as an example)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
1547

(Osteopathic approaches for endometriosis)
Ott, S.
Osteopathische Medizin, 2017/06
1548

Efficacy of an eccentric osteopathic manipulation treatment in somatic tinnitus
Goyal, M., Sharma, S., Baisakhiya, N., Goyal, K.
Indian Journal of Otology, 2017/06
1549

Wirkungen der Osteopathie im psychischen Bereich – eine systematische Literaturübersicht
(Effects of osteopathy in the psychological field - a systematic literature review)
Perstling, A., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
1550

Diaphragm postural function in injured subtalar joint
Urbaniak, M., Kisilewicz, A., Klich, S.
Physiotherapy Quarterly, 2017/06
1551

Schwindel bei Tubenkatarrh nach Otitis media
(Vertigo in tubal catarrh after otitis media)
Schneider, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
1552

Mikrobiom: Worauf Sie bei Ihren Patienten achten sollten
(Microbiome: What you should pay particular attention to in your patients)
Zschocke, A. K.
Osteopathische Medizin, 2017/06
1553

Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment
Licciardone, J. C.
Musculoskeletal Science and Practice, 2017/06
1554

Reply to the letter to the editor: 'Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment'
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/06
1555

Osteopathic medical students entering family medicine and attitudes regarding osteopathic manipulative treatment: Preliminary findings of differences by sex
Baker, H. H., Linsenmeyer, M., Ridpath, L. C., Bauer, L. J., Foster, R. W.
The Journal of the American Osteopathic Association, 2017/06
Free full text
1556

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06
1557

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text
1558

Osteopathische Behandlungen nach Karpaltunneloperation – eine randomisierte kontrollierte Studie
(Osteopathic treatments after carpal tunnel surgery - A randomized controlled trial)
Deutschmann, G., Porthun, J., Grabner, O., Leskowschek, H., Graff, W., Sammer, A., Safran, T.
Osteopathische Medizin, 2017/06
1559

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06
1560

The effect of visceral osteopathic manual therapy applications on pain, quality of life and function in patients with chronic nonspecific low back pain
Tamer, S., Öz, M., Ülger, O.
Journal of Back and Musculoskeletal Rehabilitation, 2017/05
1561

Osteopathic manipulation of the ankle improves spinal flexibility in elite alpine skiers: a pilot study
Parisio, C., Vismara, L., Micotti, V., Cimolin, V., Aprile, D., Cavigioli, M., Panzeri, A., Manzotti, A., Galli, M., Capodaglio, P.
Gazzetta Medica Italiana Archivio Per Le Scienze Mediche, 2017/05
1562

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
1563

Addition of Osteopathic Visceral Manipulation to OMT for Low Back Pain Decreases Pain and Increases Quality of Life
King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
1564

Effects of Osteopathic Treatment on Postural Equilibrium Evaluated through a Stabilometric Platform: A Randomized and Controlled Study
Buscemi, A., Cannatella, M., Lutrario, P., Rapisarda, A., Di Gregorio, G., Coco, M.
Journal of Functional Morphology and Kinesiology, 2017/05
Free full text
1565

Integrating osteopathic approaches based on biopsychosocial therapeutic mechanisms. Part 2: Clinical approach
Fryer, G.
International Journal of Osteopathic Medicine, 2017/05
1566

Osteopathic Manipulative Treatment During the Third Trimester of Pregnancy
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2017/05
Free full text
1567

A efetividade do tratamento osteopático na constipação intestinal: uma revisão sistemática
(Effectiveness of the ostheopatic treatment in intestinal constipation: A systematic review)
Rocha Do Vale, J., De Carvalho, H. F. B., Andrade, V. L. Â, Almeida, L. C.
GED - Gastrenterologia Endoscopia Digestiva, 2017/04
1568

Autismus-Spektrum-Störung (ASS) und Osteopathie
(Autism spectrum disorder (ASD) and osteopathy)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
1569

„Point of Balance“ in der osteopathischen Behandlung eines Kindes mit Handicap
(“Point of Balance“ in the osteopathic treatment of a child with handicap)
Müller, H.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
1570

Preliminary evidence of Regional Interdependent Inhibition, using a 'Diaphragm Release' to specifically induce an immediate hypoalgesic effect in the cervical spine
McCoss, C. A., Johnston, R., Edwards, D. J., Millward, C.
Journal of Bodywork and Movement Therapies, 2017/04
1571

Biological effects of direct and indirect manipulation of the fascial system. Narrative review
Parravicini, G., Bergna, A.
Journal of Bodywork and Movement Therapies, 2017/04
1572

Ein Leben mit Arthrogryposis multiplex congenita (ACM)
(Living with arthrogryposis multiplex congenita (AMC))
Seger, G.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
1573

Osteopathie bei infantiler Zerebralparese (IZP) – eine Einzelfallstudie
(Osteopathy in infantile cerebral palsy (IZP) - a single case study)
Budroni, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
1574

Das Fasziendistorsionsmodell: Ein medizinisches Konzept – Praxiswissen kompakt
(The fascial distortion model: A medical concept - Praxiswissen Kompakt)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
1575

Das chronische Beckenschmerzsyndrom : Hilfe durch Osteopathie.
(Chronic pelvic pain syndrome : Treatment options using osteopathy)
Marx, S.
Der Urologe, 2017/04
1576

Use of the Spencer Technique on Collegiate Baseball Players: Effect on Physical Performance and Self-Report Measures
Curcio, J. E., Grana, M. J., England, S., Banyas, P. M., Palmer, B. D., Placke, A. E., Rieck, W. A., Jr., Eade
The Journal of the American Osteopathic Association, 2017/03
Free full text
1577

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text
1578

Osteopathic Manipulative Treatment for Nausea and Vomiting Following Fine Needle Aspiration of the Neck
Hess, N. J.
The AAO Journal, 2017/03
Free full text
1579

Imaging Evidence Demonstrating Effectiveness of Osteopathic Visceral Manipulation Techniques in Treating Pseudo-Obstruction
Ignatowicz, A., Berkowitz, M. R.
The AAO Journal, 2017/03
Free full text
1580

Osteopathic Manipulative Treatment in the Management of Isaacs Syndrome
Shanahan, L. K. T., Raines, S. G., Coggins, R. L., Moore, T., Carnes, M., Griffin, L.
The Journal of the American Osteopathic Association, 2017/03
Free full text
1581

Efficacy of Myofascial Unwinding and Myofascial Release Technique in a Patient with Somatic Symptoms - A Case Report
Goyal, M., Goyal, K., Bathla, M., Kanimozhi, D., Narkeesh, D.
Indian journal of Psychological Medicine, 2017/03
Free full text
1582

Impact of osteopathic therapy on proprioceptive balance and quality of life in patients with dizziness
Papa, L., Amodio, A., Biffi, F., Mandara, A.
Journal of Bodywork and Movement Therapies, 2017/03
1583

A mixed methods evaluation of a third wave cognitive behavioural therapy and osteopathic treatment programme for chronic pain in primary care (OsteoMAP)
Carnes, D., Mars, T., Plunkett, A., Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/03
1584

A critical review of manual therapy use for headache disorders: prevalence, profiles, motivations, communication and self-reported effectiveness
Moore, C. S., Sibbritt, D. W., Adams, J.
BMC Neurology, 2017/03
Free full text
1585

Osteopathic manipulative treatment showed reduction of length of stay and costs in preterm infants: A systematic review and meta-analysis
Lanaro, D., Ruffini, N., Manzotti, A., Lista, G.
Medicine (Baltimore), 2017/03
Free full text
1586

Rehabilitation treatment for chronic lower back pain: New evidence for old methods? A randomized, controlled experimental trial
Rigoni, S., Scapin, M.
Minerva Ortopedica e Traumatologica, 2017/03
1587

Osteopathy for primary headache patients: a systematic review
Cerritelli, F., Lacorte, E., Ruffini, N., Vanacore, N.
Journal of Pain Research, 2017/03
Free full text
1588

Osteopathic manipulation as a complementary approach to Parkinson's disease: A controlled pilot study
Difrancisco-Donoghue, J., Apoznanski, T., De Vries, K., Jung, M. K., Mancini, J., Yao, S.
NeuroRehabilitation, 2017/03
1589

Effects of a short-term osteopathic intervention on vertical jump and reach height in female recreational overhead athletes : a cross-over design
Green, T. C.
Unpublished MSc thesis, 2017/03
Free full text
1590

Osteopathie bei Schlafstörungen von Erwachsenen
(Osteopathic treatment on adults with sleep disturbances)
Litzlbauer, T.
Unpublished MSc thesis, 2017/03
Free full text
1591

Osteopathic Medical Student Practice of Osteopathic Manipulative Treatment During School Break
Pierce-Talsma, S., Hiserote, R. M., Lund, G.
The Journal of the American Osteopathic Association, 2017/03
Free full text
1592

Osteopathic treatment in a patient with left-ventricular assist device with left brachialgia: a case report
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Medical Case Reports Journal, 2017/02
Free full text
1593

Motorische Entwicklung eines Säuglings: Idealbild und Abweichungen
(Motor development of an infant: Ideal and deviations)
Strunk, A.
Osteopathische Medizin, 2017/02
1594

Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/02
1595

The strain - Counter strain technique in the management of anterior interosseous nerve syndrome: A case report
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S.
Journal of Taibah University Medical Sciences, 2017/02
Free full text