Advanced search



 
 82.7% of the records
 
 17.3 % of the records
 
 55.7 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Medically Underserved Area*Osteopathic Medicine*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabducens nerveabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsolute alpha powerabstractabstractsacademicacademic barrieracademic difficultiesacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic surgeryacademies and institutesacademy of osteopathyaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive release techniqueactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadmissionadmission criteriaadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced trainingadvancing TBI careadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective empathyaffective touchafferenceAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcoholismalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltingAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappraisalsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismArcticarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory test foilartifical intelligenceartificial jointartificial respirationartificial ventilationartilcleartsartticleasanaaspirationassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical swallowingaudiovisual aidsauditory canalauditory channelauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawards and prizesawarenessawareness of spaceaxesaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberinebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioenergetic modelbioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumabladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood supplyblood systemblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrand disputeBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksC-reactive proteinC-tactileC-tactile afferentsC. BowlesC. DoveC. J. Smutny IIIC. S. GonsteadC. SteeleC. WeaverC1cability crisiscadavercadaver dissectioncadaveric dissectioncadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciumcalfCaliforniacaloric restrictioncalot’s triangleCAMCanadaCanadiancanal syndromecancercancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecarbon dioxidecarbon emissionscarcinoid tumorcarcinomacardiac arrestcardiac frequencycardiac implantable electronic devicecardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase reportcase reportscase seriescase studycase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicothoracic diaphragmcervicothoracic junctioncesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wall defectchewingChiari I malformationChicagoChicago College of Osteopathic Medicinechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communitychinese medicinechinese traditional medicinechiropracticchiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclavicleclavicle fractureCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoituscold temperaturecoliccolitis ulcerosacollaborationcollagencollagen fiberscollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasesColoradocolorectal endometriosisCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phasecongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontol interventionscontraceptive carecontract governing medical treatmentcontractilitycontractioncontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapycooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilitycostal cartilagescostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial volumecranial-sacral-motioncraniocranio sacral osteopathycranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutionculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniquecybernetic systemcyberneticscynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. HerbertD. J. ClauwD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latadeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdeglutition disordersdegreesdehydrationdelayed developmentdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissolutiondistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational resourceeducational standardseducational statuseducational technologyeducational toolsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30elastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselbowelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic fieldselectromagnetic interactionelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyempirical approachempirical evidenceempirical researchempiricismemployee disciplineemployment disabilityemu oilenactivismencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineEpley maneuverEpstein-Barr virusEQ-5Dequilibriumeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerythrocyte counterythrocytesesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidenced based osteopathyeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitionexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocular musclesextrinsic sleep disorderseyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial structurefacial tumorsfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitationfactfactor analysisfactual databasesfacultyfaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyfast fourier transformfastingfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst trimester pregnancyfirst year of lifefirst-choice residencyfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexion distraction techniqueflexion rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot lesionsfoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionfracture healingfracturesFraminghamFranceFrankfurt DeclarationFred Mitchellfree energy principlefree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency-tuningfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principlefulcrumfull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilityGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenetic mutationgeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenomicsgentlenessgeodesicgeographic factorsGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingivitisgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral jointglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteus maximusglycated hemoglobin Aglycosylationglygoaminoglycansglymphaticglymphatic systemglymphaticsgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaitihallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand painhand strengthhandballhandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharmonic techniqueharmonic therapyHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead painhead positionhead repositioninghead retraction reflexheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare costhealthcare costshealthcare deliveryhealthcare initiativehealthcare needshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity, low-amplitudeHigher educationhiphip arthroplastyhip dislocationhip dysplasiahip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistorical articlehistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organshome carehome exercisehomeless personshomeless populationhomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axishrvHTA-Report 124humanhuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehumanitiesHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourhurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronic acidhydrationhydraulic mechanismhydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogonadismhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueicosahedronICPideal muscle functionidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimage-guided spine interventionimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantationsimpotenceimpotence medicineimpulsein vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationInfrared thermal camerainfrared thermographyinfraspinatusinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninpatientinpatient outcomeinpatient rehabilitationinpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8Interleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternationalityinternetinternet useinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterviewsintestinalintestinal constipationintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra ocular pressureintra- and inter-rater reliabilityintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemic compressionischemic pressureischialgiaIsele-methodisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohnston’s functional methodsjointjoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejoyful discoursejudgmentjugular compressionjumpingjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketorolac tromethaminekeyword searchkidneykidney mobilitykidney motilitykidney stonekidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory testlaboratory valueslabral tearlacerationslack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislarynxLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture seriesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevel of evidencelevels of anxiety and depressionLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdle muscular dystrophylimb injurieslimb placodelimb symmetrylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylorazepamlordosislordotic angleloss of a childloss of childlovelow anorectal malformationlow backlow back injurylow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelunglung capacitylung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusm. piriformism. rectus capitis posterior minorM. WilsonM. Wyvekensmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratesmatched-pair analysismateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatrix-rhythm-therapymattermaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionmediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical graduatesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmelancholic wholenessmelanomaMelicien TettambelmembranesmemorymenMeniere’s diseasemeningesmeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental disordermental disordersmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticameridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetastasismetastatic abdominal cancermetastudiesmethodismmethodological qualitymethodologymethodsmethyl-sulfonyl-methanemethylprednisolonemetronidazoleMFI-20mfrMFT challenge discmiceMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studymobile appsmobile clinicmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMöbius syndromemolar shimmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRImsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle contractilitymuscle contractionmuscle developmentmuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tendernessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal injurymusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathyMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymytonometryN. Mithanaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessneedle biopsyneedlesneeds assessmentnegentropyNelson-Dennyneonatalneonatal abstinence syndromeneonatal hyperbilirubinemianeonatal intensive care unitneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsnephroptosisnerve activitynerve compressionnerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingneumuscular therapyneuracneural canalneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroinflammationneurokinesiologyneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular junctionneuromuscular rehabilitationneuromuscular systemneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuropsychiatric disorderneuropsychological testsneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotransmissionneurotransmitterneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstetic populationobstetric deliveryobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal planeocclusal splintocclusal splint therapyocclusionocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid use disorderopioid-related disordersopioidsopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoral ?uidoral aversionoral cavityoral diagnosisoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan of perceptionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic manipulationorthopedic proceduresorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteochondrosisosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. KimberlyP. MisslinP. Schwindpad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepaintingspalatal disjunctionpalatine bonepaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackspanic disorderspapillomavirus infectionspapillomavirus vaccinesparaesophageal herniaparafunctionparallel accreditationparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentpartient-reported outcomesparturitionpassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpelvicpelvic adhesionspelvic anatomypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centered carepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalguspharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphytotherapyPIC syndromepicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disordersplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespopulation dynamicspopulation healthpopulation surveillanceportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromeposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencypovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-menopausal womenpre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive processingpredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematurepremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologypreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepreserved ejection fraction exacerbationspressurepressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprisonprivate collegesprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsproceduresprocess approachprocessesprocessus styloideusprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studyPROMsprone positionproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapyPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsrctre-findingsre-orientation processreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseasesrespiratory disordersrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumeresponses to treatmentrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoscopyretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroutine examinationroutine findingsroutine physical therapyrowingrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. Typaldossacral basesacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal regionsacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsscalesscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniascholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic neuritissciatic neuropathysciatic painsciaticasciencescientific journalscientific proofscientific publicationscientific researchscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreeningscreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshared decision makingsharing informationsharp painshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-effectsidebendingSIDSsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusskatersskeletalskeletal muscleskiersskiingskillskills transferskinskin blood flow indexskin burning sensationskin cancerskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmokerssmokingsmoking cessationsmoking preventionsmooth musclesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessolar keratosissoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspeakingspecial needs childrenspecializationspecialty boardspecialty boardsspecialty trainingspecific adjustmentspecific laryngeal manipulationspecificityspectroscopyspeechspeech acousticsspeech developmentspeech development disordersspeech disorderspeech disordersspeed of blood flowspelling disordersspencer techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainsSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stephen Tyremanstereoidssterilitysternal painsternal recoil techniquesternotomiesternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoragestrabismstrabismusStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniqueStretchingstretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsStudents, Pharmacystudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubclavian arterysubclavian steal syndromesubcutaneous hemorrhageSubject Headingssubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointSubtle energy measurementsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicidesumatriptanSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperoxide anion radicalssupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessuprarenal gland,supraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurveysSurveys and Questionnairessurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationSynergeticsynostosis sphenooccipitalis,synovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetastwelttattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBI careteachersteachingteaching assistantteaching clinicteaching effectivenessteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteamUP Short-FormteamUP-SFteamworktechnical requirementsTechniquetechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth settingtelemanagementtelemedicinetelemetrytelephonetelescopic bridgeworktemperamenttemperaturetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendonitistendonstenetstennistennis elbowtenotomytensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?TGF-?Thai foot reflex zone massagethai massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical basistheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelsTherapeutic presencetherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal, skin temperaturethermodiagnosisthermographythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree months colicthree-dimensional imagingthree-dimensional printingthroacic transverse processesthroatthrombolytic therapythrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticksticstideTietze syndromeTiffeneau indextilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?tnf-?TNF-atnterpretation analysis comparative studiestobacco use disordertoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstrainingtraining deliverytraining hourstraining programmstraining programstraining requirementstraining supporttranscranial Doppler ultrasonographytranscranial magnetic stimulationtransdisciplinarytransferencetransformation phasestransgendertransgender personstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretrauma-informes caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatically induced lesiontraumatized patientstravelTravell trigger pointstreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerstrimesters of pregnancytrinitytrisomy 21triunetriune mantriune osteopathytriunity Routine-diagnosistroponin itroubles musculo-squelettiquestruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk stabilizationtrunk torsiontrusttruthtruth disclosuretryptaminestuba auditiva techniqueTug navicular techniquetumortumor necrosis factortumor necrosis factor-alphatunnel syndrometurbttutoringtwin pregnancytwinstympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderservedunderserved areaunderserved areasunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionUnified Parkinson Disease Rating Scaleunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beingUniversitiesuniversityuniversity outpatient departmentsunna nevusunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamicsurogenital stage or phallic stageurogenital systemurogenital tracturologic systemurologyurticariaUSAusmleUSMLE scoresUSMLE Step 1usmle step 2uterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvaliditityvalidityvalidity of testsvalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverificationVermontvertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcarewestern worldWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwoman?s organismwomenwomen’s healthworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopworld health organisationWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenZ. ComeauxzenZIMMTzinczinc deficiencyZink modelZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

1107 results (please see below)  Sort:    
1

Reliability of spinal palpation for diagnosis of back and neck pain: a systematic review of the literature
Seffinger, M. A., Najm, W. I., Mishra, S. I., Adams, A., Dickerson, V. M., Murphy, L. S., Reinsch, S.
Spine (Phila Pa 1976), Oct 1
2

Strategies to prevent and manage running-related knee injuries: A systematic review of randomised controlled trials
Alexander, J., Johnston, R., Ezzat, A., Culvenor, A., Barton, C.
Journal of Science and Medicine in Sport, Nov 2022 2022-11-02
3

Responsiveness to osteopathic manipulative treatments in people with non-specific low back pain: A secondary analysis of the LC-OSTEO trial
Rören, A., Yagappa, D. M., Zegarra-Parodi, R., Fabre, L., Krief, G., Daste, C., Lefèvre-Colau, M. M., Rannou, F., Nguyen, C.
Annals of Physical and Rehabilitation Medicine, 2024/06
4

Osteopathic management of non-specific neck pain: Preliminary findings from a cross sectional study of Australian osteopaths
Fleischmann, M., McLaughlin, P., Vaughan, B., Hayes, A.
International Journal of Osteopathic Medicine, 2024/03
Free full text
5

The short- and long-term effect of osteopathic manipulative treatment on pain, and psychosocial factors in adults with chronic low back pain
Nicodemus, C. L., Epstein, J., Huebner, M., DeCicco, B., Shaik, M.
Journal of Osteopathic Medicine, 2024/03
Free full text
6

Different exposure times of flexion distraction technique in the L5-S1 distance and local pain of patients with chronic low back pain: A feasibility study
Pagnez, M. A. M., Mello, M. S., Bittencourt, J. V., Ricard, F., Nogueira, L. A. C.
International Journal of Osteopathic Medicine, 2024/03
7

The effectiveness of manipulation in combination with exercise for patients with coccydynia: Six months follow-up of a randomized controlled trial
Tufekci, O., Yilmaz, K., Gercek, H., Unuvar, B. S.
International Journal of Osteopathic Medicine, 2024/03
8

Osteopathic Approach to a Patient with Recurring Low Back Pain following OMT results in Diagnosis of Underlying Gynecological Etiology: A Case Report
Berkowitz, M. R.
The AAO Journal, 2024/03
9

An osteopathic approach for a patient with sequela after treatment for a cheek squamous cell carcinoma
Wehner, B. L., Calla, R.
The AAO Journal, 2024/03
10

Effects of a novel osteopathic visceral technique for the pancreas on pain and range of motion in a patient with neck pain: Case report
Faria, M. A. F.
Journal of Bodywork and Movement Therapies, 2024/03
11

Psychische Gesundheit und somatische Symptombelastung von Patient*innen: Eine Fragebogenstudie
(Mental health and somatic symptom burden of patients: A questionnaire study)
Bobrowski, A., Porthun, J.
Osteopathische Medizin, 2024/03
Free full text
12

Strain Relief – Teil 2: Technische Ausführung: Behandlung chronischer Schmerzen in der unteren Extremität
(Strain Relief - Part 2: Technical performance: Treatment of chronic pain in the lower extremity)
Liedtke, H.
Osteopathische Medizin, 2024/03
Free full text
13

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03
14

Is Craniosacral Therapy Effective? A Systematic Review and Meta-Analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Cabanillas-Barea, S., Esteban-Pérez, J., Jiménez-del-Barrio, S.
Healthcare, 2024/03
15

The changes of blood-based inflammatory biomarkers after non-pharmacologic interventions for chronic low back pain: a systematic review
Puerto Valencia, L. M., He, Y., Wippert, P. M.
BMC Musculoskeletal Disorders, 2024/03
16

Osteopathic Manipulative Treatment for Chronic Neck Stiffness After a Motor Vehicle Collision: A Case Report
Jost, J. M., Stoll, V. K., Waters, H. B.
Cureus, 2024/02
Free full text
17

New Zealand osteopaths’ use of patient-reported outcome measures with patients who have chronic low back pain: A cross-sectional survey
Vallyon, E., Aminian, S., Heath, S.
International Journal of Osteopathic Medicine, 2024/02
18

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text
19

Does Osteopathic Heart-Focused Palpation Modify Heart Rate Variability in Stressed Participants with Musculoskeletal Pain? A Randomised Controlled Pilot Study
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Healthcare, 2024/01
Free full text
20

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic low back pain: a single-blinded randomized controlled trial
Popovich, J. M., Cholewicki, J., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan, A.
Journal of Osteopathic Medicine, 2024/01
Free full text
21

Massage-like stroking produces analgesia in mice
Waarala, Z. M. S., Comins, L., Laumet, S., Folger, J. K., Laumet, G.
Neurobiology of Pain, 2024/01
Free full text
22

The Fascial Distortion Model in Military Aircrew with Chronic Neck Pain: A Case Study
Fullenkamp, A. J.
Military Medicine, 2024/01
23

Assessment of Long-term Effects of Adding Osteopathic Manipulative Treatment to Neck Exercises for Individuals With Non-specific Chronic Neck Pain: A Randomized Trial
Groisman, S., da Silva, L., Sanches, T., Rocha, C., Malysz, T., Jotz, G.
Journal of Chiropractic Medicine, 2023/12
24

Strain Relief – Teil 1: Grundlagen: Ein neues Verfahren zur Behandlung chronischer Schmerzen im Bewegungsapparat am Beispiel von therapieresistenten, funktionellen Beschwerden in der unteren Extremität
(Strain Relief - Part 1: Basics: A new procedure for the treatment of chronic pain in the musculoskeletal system using the example of therapy-resistant, functional complaints in the lower extremities)
Liedtke, H.
Osteopathische Medizin, 2023/12
25

Effects of combined taping of quadriceps and hamstring muscles on pain and disability in patients with knee osteoarthritis: Randomized assessor-blinded controlled study
Mohamed, Y. E., Abd-Alkareem, D. S., Balbaa, A.E. A.A., Samy, M. M., Ashour, R. S.
International Journal of Osteopathic Medicine, 2023/12
26

‘More harm than good’ – A qualitative study exploring the attitudes and beliefs of a group of Italian osteopaths about spinal imaging in the management of patients with chronic low back pain
Ogliari, L., Formica, A., Bettelli, L.
International Journal of Osteopathic Medicine, 2023/12
27

The effect of lumbopelvic manipulation on electromyography parameters of gluteus medius and vastus medialis in patients with patellofemoral pain syndrome: A double-blind, placebo-controlled trial
Zafarian, T., Taghipour, M., Khafri, S., Bahrami, M., Javanshir, K.
International Journal of Osteopathic Medicine, 2023/12
28

Evaluation of effectiveness of osteopathic visceral manipulation in patients with chronic mechanical low back pain: A multi-center, single-blind, randomized-controlled study
Altınbilek, T., Murat, S., Yıldırım, E., Filiz, B., Ünlü, S., Terzi, R.
Turkish Journal of Physical Medicine and Rehabilitation, 2023/12
29

Effect of osteopathic manipulative treatment and Bio-Electro-Magnetic Energy Regulation (BEMER) therapy on generalized musculoskeletal neck pain in adults
Palmer, G. M., Dominick, N., Kane, M., Bawek, S., Burch, B., Sanders, T., Phrathep, D., Myers, N., Lorenzo, S.
Journal of Osteopathic Medicine, 2023/12
Free full text
30

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
31

Effects of osteopathic manipulative therapy on recurrent pelvic pain and dyspareunia in women after surgery for endometriosis: a retrospective study
Alboni, C., Melegari, S., Camacho Mattos, L., Farulla, A.
Minerva Obstetrics and Gynecology, 2023/11
32

Efficacy of pulsed electromagnetic field therapy on pain and physical function in patients with non-specific low back pain: a systematic review
Kull, P., Keilani, M., Remer, F., Crevenna, R.
Wiener Medizinische Wochenschrift, 2023/11
Free full text
33

Transrectal osteopathic manipulation treatment for chronic coccydynia: feasibility, acceptability and patient-oriented outcomes in a quality improvement project
Nourani, B., Norton, D., Kuchera, W., Rabago, D.
Journal of Osteopathic Medicine, 2023/11
Free full text
34

Der Einfluss einer suboccipitalen Release Technik auf den Schmerz sowie auf die sensomotorische Leistung bei PatientInnen mit chronischen, unspezifischen Nackenschmerzen
(The influence of a suboccipital release technique on pain and sensorimotor performance in patients with chronic, non-specific neck pain)
Kiener, S.
Unpublished MSc thesis, 2023/11
35

Pericardial Adhesion and Chronic Non-Specific Neck Pain following Thoracentesis: An Osteopathic Approach
Bordoni, B., Escher, A.
Clinics and Practice, 2023/10
Free full text
36

A biopsychosocial approach as a part of an osteopathic intervention in the management of chronic prostatitis/chronic pelvic pain: A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2023/10
37

The Use of Osteopathic Manipulative Treatment for Treatment of Sore Throat, Headache, and Facial Pain: A Case Report
Berkowitz, M. R.
The AAO Journal, 2023/09
38

Resolution of Stridor, Gastritis and Cephalgia in an Adolescent with Reflex Sympathetic Dystrophy Following Osteopathic Manipulative Treatment—A Case Report
Habenicht, A. L.
The AAO Journal, 2023/09
39

Возможности немедикаментозных методов лечения при синдроме хронической тазовой боли у мужчин (систематический обзор)
(Possibilities of non-drug methods of treatment for chronic pelvic pain syndrome in men (systematic review))
Krikunov, A. I., Potekhina, Y. P.
Russian Osteopathic Journal, 2023/09
40

Influence of Osteopathic Manipulative Treatment on the Quality of Life and the Intensity of Lumbopelvic Pain in Pregnant Women in the Third Trimester: A Prospective Observational Study
Correia, M. L. A., Peixoto Filho, F. M., Gomes Júnior, S. C.
Healthcare, 2023/09
Free full text
41

Evaluation of the effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in chronic nonspecific low back pain. A protocol for a randomised controlled trial
Armbrust, D., Fonseca, C. L., Lopes Dumont, A. J., Viegas da Trindade, A. M., Neto, H. P., Oliveira, C. S.
International Journal of Osteopathic Medicine, 2023/09
42

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/09
Free full text
43

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09
44

The biomechanical links between pelvic floor dysfunction and testicular pain: A clinical review
Jackson, C., Fawcett, L.
Osteopathic Family Physician, 2023/09
45

Osteopathic Manipulative Treatment for a Chronic Rotator Cuff Tear: A Case Report
Scypinski, L. J., Bonitz, T. J., Lomiguen, C. M., Chin, J.
Cureus, 2023/09
Free full text
46

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: randomized controlled trial
Boas Fernandes, W. V., Correa, F. I., Fidelis de Paula Gomes, C. A., Blanco, C. R., Lucareli, P. R. G., Politti, F., Correa, J. C. F.
Gait and Posture, 2023/09
47

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text
48

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07
49

Osteopathic Manipulative Treatment Reduces Pain and Improves Range of Motion in Patients with Chronic Neck Pain
Daly, E., Prodoehl, J., Bolch, C., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2023/06
50

Tackling Structure and Function with an Osteopathic Approach: A Patient with a Herniated Lumbar Disc and a Small Hemipelvis
Danto, S. E., Danto, J. B.
The AAO Journal, 2023/06
51

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
52

Cranial for Chronic pain: The efficacy of osteopathic manipulative treatment (OMT) in the management of chronic post-traumatic headache (CPTHA)
Helderlein, P., Geyer-Roberts, E., Widboom, N.
The AAO Journal, 2023/06
53

Intersegmental sacral dysfunction as primary etiology of low back pain in a college athlete: A case study
Householder, L., Veach, A., Diefenderfer, J.
The AAO Journal, 2023/06
54

Osteopathic Treatment of Chronic Chest Pain After Trauma
Martini, J., Veach, A.
The AAO Journal, 2023/06
55

Osteopathic Manipulative Treatment for Chemotherapy-Induced Abdominal Pain and Anorexia in Glioblastoma Multiforme
McIntire, R., Terry, R., Gebhardt, G.
The AAO Journal, 2023/06
56

A Case of Chronic Postoperative Abdominal Wall Pain Successfully Treated with the Fascial Distortion Model
Pelletier, J., Boucher, J.
The AAO Journal, 2023/06
57

Osteopathie in Österreich: Wirksamkeit und Sicherheit bei Schmerzen des Bewegungsapparats und Überblick über Ausbildung und Qualitätsanforderungen
(Osteopathy in Austria: Effectiveness and safety in treating pain of the musculoskeletal system and overview of training and quality requirements)
Gassner, L., Hofer, V.
Osteopathische Medizin, 2023/06
Free full text
58

An Osteopathic Approach To Refractory Sternal Pain
Risov, D., Geer, R.
The AAO Journal, 2023/06
59

Releasing the Restriction: A Study of Myofascial Release to Improve Pain and Range of Motion in Post-Cesarean Section Patients in the Peruvian Amazon
Scott, G., Gordon, T.
The AAO Journal, 2023/06
60

Osteopathic Manipulative Treatment of Chronic Pelvic Pain due to High-Tone Pelvic Floor Dysfunction
Barnett, M. E., Henderson, K. K., Elliott-Burke, T. L., Heinking, K. P.
Osteopathic Family Physician, 2023/06
61

Quantitative ultrasound to assess efficacy of treatment for neck somatic dysfunctions: a feasibility study
Tran, A., Ngo, T., Roberts, T., Ko, E., Holmgren, J. G., Edwards, C., Coleman, M., Gao, J.
Journal of Osteopathic Medicine, 2023/06
Free full text
62

Effects of a myofascial technique on the structure and biomechanical properties of the thoracolumbar fascia in chronic low back pain adults assessed by sonoelastography and myotonometry: a study protocol
Devantéry, K., Morin, M., Gaudreault, N.
Journal of Complementary and Integrative Medicine, 2023/06
63

Exploring the effects of standardized soft tissue mobilization on the viscoelastic properties, pressure threshold and touch threshold of the caesarean section scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2023/06
64

What complementary and alternative medicine therapy recommendations exist across clinical practice guidelines for low back pain? A systematic review
Mohiuddin, U., Ng, J.
Journal of Complementary and Integrative Medicine, 2023/06
65

The process and outcomes of chronic low back pain treatment provided by osteopathic and allopathic physicians: a retrospective cohort study
Licciardone, J. C., Kellerlee, J., Joseph, M., Mohammad, M. B., Kim, K. G., Jain, J., Aryal, S.
Journal of Osteopathic Medicine, 2023/05
Free full text
66

Evaluation of Osteopathic Manipulative Treatment in Patients with Chikungunya Fever in the Chronic Phase: A Randomized Controlled Trial
Tenorio, L., Mello, K., Maia, M., Valença, A., Duarte, Â., Marques, C.
Journal of Clinical Rheumatology, 2023/05
67

Manejo de la espondilolistesis lumbar desde la osteopatía. Una revisión bibliométrica
(Management of lumbar spondylolisthesis from osteopathy. A bibliometric review)
Apolinar Cruz, G. A.
Unpublished MSc thesis, 2023/05
Free full text
68

Osteopathic Manual Treatment Compared to Kaltenborn-Evjenth Orthopedic Manual Therapy for Chronic Low Back Pain: A Randomized Study
Lizis, P., Kobza, W., Jaszczur-Nowicki, J., Wisniewski, D.
Alternative Therapies in Health and Medicine, 2023/05
69

Comparative Effects of Positional Release Technique Versus Deep Transverse Friction Massage on Pain and Disability in patients with Acute Mechanical Low Back Pain
Ammara, U., Shahzadi, F., Nazir, S., Fatima, K., Batool, F., Gondal, K. S., Aqeel, M., Shah, S., Maqbool, S.
Pakistan Journal of Medical and Health Sciences, 2023/04
70

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text
71

Schmerz – ein mögliches Erklärungsmodell im Patientengespräch
(Pain - a possible explanatory model in the patient interview)
Serafin, A.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
72

Communication strategies in psychologically informed osteopathic practice: A case report
Abbey, H.
International Journal of Osteopathic Medicine, 2023/03
73

Blinding and sham control methods in trials of physical, psychological, and self-management interventions for pain (article I): a systematic review and description of methods
Hohenschurz-Schmidt, D., Draper-Rodi, J., Vase, L., Scott, W., McGregor, A., Soliman, N., MacMillan, A., Olivier, A., Cherian, C. A., Corcoran, D., Abbey, H., Freigang, S., Chan, J., Phalip, J., Nørgaard Sørensen, L., Delafin, M., Baptista, M., Medforth, N. R., Ruffini, N.
Pain, 2023/03
Free full text
74

Blinding and sham control methods in trials of physical, psychological, and self-management interventions for pain (article II): a meta-analysis relating methods to trial results
Hohenschurz-Schmidt, D., Draper-Rodi, J., Vase, L., Scott, W., McGregor, A., Soliman, N., MacMillan, A., Olivier, A., Cherian, C. A., Corcoran, D., Abbey, H., Freigang, S., Chan, J., Phalip, J., Sørensen, L. N., Delafin, M., Baptista, M., Medforth, N. R., Ruffini, N.
Pain, 2023/03
Free full text
75

Revisiting chronic low back pain: evidence that it is not non-specific
Nicodemus, C. L., Sikorskii, A., Epstein, J.
Journal of Osteopathic Medicine, 2023/03
Free full text
76

Work from home-related musculoskeletal pain during the COVID-19 pandemic: A rapid review
Gomez, I. N., Suarez, C. G., Sosa, K. E., Tapang, M. L.
International Journal of Osteopathic Medicine, 2023/03
Free full text
77

Faszien als sensorisches und emotionales Organ: Faszien als Sinnesorgan
(Fasciae as sensory and emotional organ: Fasciae as sensory organ)
Schleip, R., Bartsch, K.
Osteopathische Medizin, 2023/03
Free full text
78

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text
79

OSCAR (Osteopathic Single CAse Research) – Assessing the effect of standard and biopsychosocial osteopathic management for patients with non-specific low back pain: Protocol for a Single Case Experimental Design (SCED)
Draper-Rodi, J., Abbey, H., Brownhill, K., Vogel, S.
International Journal of Osteopathic Medicine, 2023/03
80

Prostate Cancer with a Presenting Symptom of Lower Thoracic Back Pain
Malhotra, V., Singh, C., Weening, A., Patel, S., Mayi, B., Migliozzi, J., Malhotra, V.
Osteopathic Family Physician, 2023/03
81

Возможность применения остеопатической коррекции при синдроме хронической тазовой боли
(The possibilities of using osteopathic correction for chronic pelvic pain syndrome)
Sharapov, I. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/03
Free full text
82

Therapeutic and stabilization exercises after manual therapy in patients with non-specific chronic neck pain: A randomised clinical trial
Demir, O., Atıcı, E., Torlak, M. S.
International Journal of Osteopathic Medicine, 2023/03
83

A scientometrics analysis and visualization of low back pain
Zuo, Y., Zhang, J., Leng, X., Fan, Y., Fu, B., Wang, P.
International Journal of Osteopathic Medicine, 2023/03
84

Effects of a Myofascial Technique on the Stiffness and Thickness of the Thoracolumbar Fascia and Lumbar Erector Spinae Muscles in Adults with Chronic Low Back Pain: A Randomized before-and-after Experimental Study
Devantéry, K., Morin, M. P., Grimard, J., Gaudreault, N.
Bioengineering, 2023/03
Free full text
85

Osteopathische Behandlung bei Rückenschmerzen. Akuter, nicht- spezifischer
(Osteopathic Manipulative Treatment for acute, non-specific Low Back Pain)
Jankovic-Preslmayer, M.
Unpublished MSc thesis, 2023/03
86

Osteopathic manipulative treatment of patients with chronic low back pain in the United States: a retrospective cohort study
Licciardone, J. C., Moore, S., Fix, K., Blair, L. G., Ta, K.
Journal of Osteopathic Medicine, 2023/02
Free full text
87

Abordaje de Manejo de dolor en Niños desde la perspectiva de la Medicina Alternativa
(Approach to Pain Management in Children from an Alternative Medicine Perspective)
Sierra Sánchez, A. P.
Unpublished MSc thesis, 2023/02
Free full text
88

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
89

Neck pain service utilization and costs: association with timing of non-pharmaceutical services for individuals initially contacting a primary care provider. A retrospective cohort study
Elton, D., Zhang, M.
medRxiv, 2023/01
Free full text
90

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text
91

Successful buprenorphine transition while overlapping with a full opioid agonist to treat chronic pain: a case report
Patel, K. V., Sahni, S., Taylor, L. F.
Journal of Osteopathic Medicine, 2023/01
Free full text
92

(Osteopathy as a treatment proposal for patients with temporomandibular disorders: a systematic review)
Pereira de Paula, R., Oliveira da Silva Almeida, D., Garcia de Paula, G., Moreira Alves, L., Oliveira Silva, M., Rodrigues da Cunha, M., Iatecola, A., Ramos Fernandes, V.A., Rodrigues Silva, V., de França, E., Barroso Hirota, V.
Revista Multidisciplinar da Saúde, 2023
Free full text
93

Effects of osteopathic manipulative treatment associated with pain education and clinical hypnosis in individuals with chronic low back pain: study protocol for a randomized sham-controlled clinical trial
Luchesi, G. L. S., da Silva, A. K. F., Amaral, O. H. B., de Paula, V. C. G., Jassi, F. J.
Trials, 2022/12
Free full text
94

Исследование возможности включения остеопатической коррекции в состав комплексной терапии синдрома тазовой боли у женщин в позднем послеродовом периоде
(Study of the possibility of osteopathic correction inclusion in the complex therapy of pelvic pain syndrome in women at the late postpartum period)
Chumakova, I. B., Nasibullina, R. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/12
95

Обоснование использования остеопатической коррекции в комплексном лечении пациентов с плечелопаточным болевым синдромом
(Substantiation of the possibility of using osteopathic correction in the complex treatment of patients with shoulder-shoulder pain syndrome)
Emelyanova, C. K., Zolkova, O. V., Kozlova, N. S.
Russian Osteopathic Journal, 2022/12
96

Epiploic Appendagitis Mimicking Acute Appendicitis: An Osteopathic Case Report
Chin, J., Oseguera, B., Hon, K., Lomiguen, C. M., McBride, T.
Cureus, 2022/12
Free full text
97

Pain and functional recovery from chronic low back pain over 12 months: implications for osteopathic medicine
Licciardone, J. C., Pandya, V.
Journal of Osteopathic Medicine, 2022/12
Free full text
98

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic neck pain: A single-blinded randomized controlled trial
Cholewicki, J., Popovich, J. M., Jr., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/12
99

Effectiveness of muscle energy technique in patients with nonspecific low back pain: a systematic review with meta-analysis
Santos, G. K., Gonçalves de Oliveira, R., Campos de Oliveira, L., Ferreira C de Oliveira, C., Andraus, R. A., Ngomo, S., Fusco, A., Cortis, C., Da Silva, R. A.
European Journal of Physical and Rehabilitation Medicine, 2022/12
Free full text
100

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12
101

Beliefs and Attitudes About Opioid Prescribing in Patients With Low Back Pain: A Survey of Osteopathic Physicians
Pham, B., Tzau, A., Lee, A. S., DeStefano, L. A., Popovich, J. M.
Journal of Osteopathic Medicine, 2022/12
102

A Collaborative Modeling Approach to Understand the Perspective of Patients with Low Back Pain Referred for Osteopathic Manipulative Medicine Management
Tzau, A., Popovich, J. M.
Journal of Osteopathic Medicine, 2022/12
103

Optimizing chronic pain management through patient engagement with quality of life measures: a randomized controlled trial
Licciardone, J. C., McDonald, H., Yablon, M., Ngo, W., Cunanan Garza, K. A., Aryal, S.
Journal of Osteopathic Medicine, 2022/11
Free full text
104

Le toucher en ostéopathie, une ouverture au dialogue et à la relation.
(Touch in osteopathy, an opening to dialogue and relationship)
Beaulieu, A.
Soins Pédiatrie/Puériculture, 2022/11
105

The effectiveness of visceral osteopathy in pain, disability, and physical function in patients with low-back pain. A systematic review and meta-analysis
Ceballos-Laita, L., Mingo-Gómez, M. T., Medrano-de-la-Fuente, R., Hernando-Garijo, I., Jiménez-Del-Barrio, S.
Explore (NY), 2022/11
106

Osteopathic Manipulative Medicine for Chronic Pain in the Setting of Cerebral Palsy
Dixon, D. S., Elwert, N. C., McDermott, G. A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/11
107

Osteopathy: effectiveness and safety for musculoskeletal pain and overview of training and quality requirements. AIHTA Project Report No.: 144 2022
Gassner, L., Hofer, V.
HTA Austria – Austrian Institute for Health Technology Assessment GmbH, 2022/11
Free full text
108

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11
109

The Benefits of Integrative Medicine in the Management of Chronic Pain: A Review
Trivedi, H., Avrit, T. A., Chan, L., Burchette, M., Rathore, R.
Cureus, 2022/10
Free full text
110

Effect of Isolated Hip Musculature Strengthening Program in Avascular Necrosis: A Case Report
Mungal, S. M., Dhage, P., Deshmukh, N. S.
Cureus, 2022/10
Free full text
111

Conservative management of symptomatic degenerative and isthmic spondylolisthesis in adults: A scoping review
Mauch, M.
Unpublished MSc thesis, 2022/10
Free full text
112

Effectiveness of cranial osteopathy therapy on nociception in equine back as evaluated by pressure algometry
Vokietytė-Vilėniškė, G., Nagreckienė, S., Duliebaitė, I., Žilaitis, V.
Acta Veterinaria Brno, 2022/10
Free full text
113

Effectiveness of routine physical therapy with and without muscle energy technique in patients with upper crossed syndrome
Shahzad, H., Fatima, A., Ahmad, A., Khan, Z. A., Gilani, S. A.
Rawal Medical Journal, 2022/09
Free full text
114

Interaktion zwischen Gehirn und Herz: Modifikation der Interaktion zwischen Gehirn und Herz bei chronischen Schmerzen durch osteopathische Behandlung
(Interaction between brain and heart: modification of brain-heart interaction in chronic pain by osteopathic treatment)
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Osteopathische Medizin, 2022/09
115

Osteopathische Behandlung von Patienten mit episodischer Migräne. Prospektive, multizentrische, kontrollierte randomisierte Studie
(Osteopathic treatment of patients with episodic migraine. Prospective, multicenter, controlled randomized study)
Stolzmann, K., Ziller, M., Britz, I., de Braganca, L., Thielen, F.
Unpublished D.O. thesis, 2022/09
116

A randomized controlled trial on pain, grip strength, and functionality in lateral elbow pain: Mulligan vs muscle energy techniques
Bagcaci, S., Unuvar, B. S., Gercek, H., Ugurlu, I., Sert, O. A., Yilmaz, K.
Journal of Back and Musculoskeletal Rehabilitation, 2022/09
117

Osteopathische Behandlung von Frauen mit Beckengürtelschmerz post partum (PPGP). Randomisierte kontrollierte Studie
(To evaluate the effectiveness of custom tailored osteopathic treatment in women suffering from pelvic girdle pain after childbirth.)
Richterink, J., Bruns, A.
Unpublished D.O. thesis, 2022/09
118

Effectiveness of osteopathic interventions in patients with non-specific neck pain: A systematic review and meta-analysis
Dal Farra, F., Buffone, F., Risio, R. G., Tarantino, A. G., Vismara, L., Bergna, A.
Complementary Therapies in Clinical Practice, 2022/08
119

The Main Changes in Pregnancy - Therapeutic Approach to Musculoskeletal Pain
Fiat, F., Merghes, P. E., Scurtu, A. D., Almajan Guta, B., Dehelean, Cristina A., Varan, N., Bernad, E.
Medicina, 2022/08
Free full text
120

Thoracic Manual Therapy Improves Pain and Disability in Individuals With Shoulder Impingement Syndrome Compared With Placebo: A Randomized Controlled Trial With 1-Year Follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/08
121

Efficacy of Single Stretching Session of Iliopsoas Using Proprioceptive Neuromuscular Facilitation Versus Muscle Energy Technique on Low Back Pain in Patients With Lumbar Hyper-Lordosis
Lakkadsha, T. M., Qureshi, M. I., Kovela, R. K., Saifee, S. S., Lalwani, S. S.
Cureus, 2022/08
Free full text
122

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07
123

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text
124

Successful Osteopathic Manipulative Treatment of Foot Drop
Tafler, L., Katz, V., Kolesnikov, V., Singh, R.
Cureus, 2022/07
Free full text
125

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07
126

Non-pharmacological and non-surgical treatment of pain in children and adolescents with cerebral palsy: A scoping review
Flyckt, N., Wong, C., Michelsen, J. S.
Journal of Pediatric Rehabilitation Medicine, 2022/07
127

Reply to Kudus, A.L. Comment on “Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845“
Brandl, A., Egner, C., Schleip, R.
Life (Basel), 2022/06
Free full text
128

Comment on Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845
Kudus, A. L.
Life (Basel), 2022/06
Free full text
129

An Enactive-Ecological Model to Guide Patient-Centered Osteopathic Care
Cerritelli, F., Esteves, J. E.
Healthcare, 2022/06
Free full text
130

Возможность применения остеопатических методов коррекции в терапии лицевой боли
(The possibility of osteopathic correction methods in the treatment of facial pain)
Popov, A. S.
Russian Osteopathic Journal, 2022/06
131

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06
132

Effect of post-isometric relaxation versus myofascial release therapy on pain, functional disability, rom and qol in the management of non-specific neck pain: a randomized controlled trial
Khan, Z. K., Ahmed, S. I., Baig, A. A. M., Farooqui, W. A.
BMC Musculoskeletal Disorders, 2022/06
Free full text
133

The Modified Back Beliefs Questionnaire as a tool to screen for incorrect beliefs regarding back pain: Cross-cultural adaptation and measurement properties
Fernandes, Daysiane A. M., Freire, Ana Paula C. F., Santos, Jéssica Mendes, Lemes, Italo R., Diniz, Leandro M., Franco, Marcia R., Ocarino, Juliana M., Pinto, Rafael Z.
International Journal of Osteopathic Medicine, 2022/06
134

The Portuguese osteopaths attitudes towards a biomechanical or biopsychosocial model in the approach of chronic low back pain – A cross-sectional questionnaire-based survey
Dinis, M., Silva, C., Cruz, R., Esteves, J., Nunes, A.
International Journal of Osteopathic Medicine, 2022/06
135

Abnormal Foot Progression Angle Kinematics in Cervical Dystonia Improved After Osteopathic Manipulative Medicine: A Prospective Case Series
Mancini, J., Oliff, Z., Abu-Sbaih, R., Simone, J., LaRosa, A., Mody, S., Li, T. S., Leder, A.
Cureus, 2022/06
Free full text
136

The Effect of Muscle Energy Technique and Posture Correction Exercises on Pain and Function in Patients with Non-specific Chronic Neck Pain Having Forward Head Posture-a Randomized Controlled Trail
Joshi, R., Poojary, N.
International Journal of Therapeutic Massage and Bodywork, 2022/06
Free full text
137

Effects of Muscle Energy Technique with and without Bowen Therapy in Text Neck Syndrome
Seemal, P., Noor, R., Riaz, S., Afzal, H., Anwaar, S., Niaz, M.
Pakistan Journal of Medical and Health Sciences, 2022/06
Free full text
138

Where do people acquire their beliefs about low back pain?
Suhail, A., Poulter, D. C.
International Journal of Osteopathic Medicine, 2022/06
139

Исследование эффективности остеопатической коррекции пекталгического синдрома у студентов
(Study of the osteopathic correction effectiveness of pectalgic syndrome in students)
Valiullova, L. V., Gilmutdinova, G. R., Safiullina, A. A.
Russian Osteopathic Journal, 2022/06
140

Osteopathic Manipulation of Pelvic Floor Muscle Dysfunction Improves Chronic Lower Back Pain
Torres, J.
The AAO Journal, 2022/06
Free full text
141

Healing from trauma - Effect of platelet-rich plasma on post-traumatic neck injury resulting in muscle spasm
Zhong, X., Davalath, V., O'Donnell, A.
The AAO Journal, 2022/06
Free full text
142

Picking Apples and Somatic Dysfunctions: A Case Study of Osteopathic Manipulative Treatment in the Farmworker Community
Ackerman, K., Gavin, K., Johnson, D.
The AAO Journal, 2022/06
143

An Osteopathic Approach to Chronic Pelvic Pain
Cameron, D. L., Mainville, M., Wallace-Ross, J.
The AAO Journal, 2022/06
Free full text
144

Osteopathic Manipulative Treatment may be a Cost-Effective Approach to Reducing Pain Associated with Acute Flare of Interstitial Cystitis
Hermann, S. J., Barnett, M. E., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
145

Uncovering Trigger Points Masked by Lumbar Radiculopathy
Tuyn, D., Lambros, S., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
146

Effects of Muscle Energy Technique versus Bruegger's Relief Exercise on the Forward Head Posture among electronic gadget users - A Pilot study
Dalawar, A., Afzal, H., Dalawar, I., Murtaza, A., Ghafoor, A., Fiaz, S.
Pakistan Journal of Medical and Health Sciences, 2022/05
Free full text
147

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text
148

The Importance of Pelvic and Leg Length Assessment in the Setting of Postpartum Lower Back Pain
Tafler, L., Wilson, D., Tafler, P.
Cureus, 2022/05
149

Effect of osteopathic manipulation of the sacroiliac joint vs electrotherapy on pain and functional disability in patients with low back pain: A pilot study
Rodríguez-Pastor, J. A., Caro-Puértolas, B., Caña-Pino, A., Sánchez-Preciado, A. M., Garrido-Ardila, E. M., Apolo-Arenas, M. D.
Journal of Back and Musculoskeletal Rehabilitation, 2022/05
150

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05
151

Association of sleep quality and chronification of musculoskeletal pain in an older adult: A case report
Westendorp, R., Thaker, V., Srbely, J.
International Journal of Osteopathic Medicine, 2022/05
152

Response to “Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine“
Marshall, S.
Journal of Osteopathic Medicine, 2022/05
Free full text
153

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text
154

Exploring the Effects of Standardized Soft Tissue Mobilization on the Viscoelastic Properties, Pressure Pain Thresholds, and Tactile Pressure Thresholds of the Cesarean Section Scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Integrative and Complementary Medicine, 2022/04
Free full text
155

Osteopathy as a complementary/alternative medicine for breast cancer: a Canadian case study and comprehensive review
Fortin, J., Beaupré, A., Thamar Louis, L. A., Roy, C.A., Bourque, M. A., Cappeliez, S., Fadhlaoui, A.
Breast Cancer Management, 2022/04
Free full text
156

Psychosocial Interventions for the Treatment of Functional Abdominal Pain Disorders in Children: A Systematic Review and Meta-analysis
Gordon, M., Sinopoulou, V., Tabbers, M., Rexwinkel, R., de Bruijn, C., Dovey, T., Gasparetto, M., Vanker, H., Benninga, M.
JAMA Pediatrics, 2022/04
157

Comparative assessment of osteopathy technique with manual therapy associated with biofeedback in patients with the lumbar spine pain.
Mańko, G., Jekiełek, M., Sosulska, A., Pieniążek, M., Jaszczur-Nowicki, J.
Medical Rehabilitation, 2022/04
Free full text
158

Возможность применения остеопатических методов коррекции в терапии миофасциального болевого синдрома
(Possibility of using osteopathic methods of correction in the treatment of myofascial pain syndrome)
Safiullina, A. A., Safiullina, G. I.
Russian Osteopathic Journal, 2022/03
Free full text
159

Patellofemoral pain syndrome: a review of the literature with osteopathic emphasis
Balint, T., Jones, J., Paquette, M., Amalfitano, J.
The AAO Journal, 2022/03
Free full text
160

Thoracic manual therapy improves pain and disability in individuals with shoulder impingement syndrome compared to placebo: a randomised controlled trial with one year follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/03
161

Effectiveness and safety of extracorporeal shock wave treatment for low back pain：a systematic review and meta-analysis of RCTs
Ma, J., Yan, Y., Wang, B., Sun, W., Yue, D., Wang, W.
International Journal of Osteopathic Medicine, 2022/03
162

Short- and medium-term effects of manual therapy on the upper cervical spine combined with exercise vs isolated exercise in patients with cervicogenic headache. A randomized controlled trial
Rodríguez-Sanz, J., Malo-Urriés, M., Corral-de-Toro, J., Lucha-López, M. O., López-de-Celis, C., Pérez-Bellmunt, A., Hernández-Secorún, M., Ruiz-de-Escudero-Zapico, A., Krauss, J., Hidalgo-García, C.
International Journal of Osteopathic Medicine, 2022/03
163

Результаты остеопатической коррекции у детей и подростков с недифференцированной дисплазией соединительной ткани
(Results of osteopathic correction in children and adolescents with undifferentiated connective tissue dysplasia)
Valiev, K. R., Vildanov, I. K., Zyatdinov, R. R., Gainullin, I. R.
Russian Osteopathic Journal, 2022/03
Free full text
164

Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine
Sookaromdee, P., Wiwanitkit, V.
Journal of Osteopathic Medicine, 2022/03
Free full text
165

Primary care providers' experiences treating low back pain
Al Sad, S., Start, A. R.
Journal of Osteopathic Medicine, 2022/02
Free full text
166

The impact of self-efficacy on nonoperative treatment of atraumatic shoulder pain
Grandizio, L. C., Choe, L. J., Follett, L., Laychur, A., Young, A.
Journal of Osteopathic Medicine, 2022/02
Free full text
167

Osteopathische Medizin in vier chronischen muskuloskeletalen Schmerzerkrankungen: Eine Beobachtungsstudie mit Follow-up.
Osteopathic Medicine in Four Chronic Musculoskeletal Pain Diseases: An Observational Trial with Follow-Up
Rotter, G., Binting, S., Tissen-Diabaté, T., Ortiz, M., Brinkhaus, B.
Complementary Medicine Research, 2022/02
Free full text
168

Inflammatory Biochemical Mediators and Their Role in Myofascial Pain and Osteopathic Manipulative Treatment: A Literature Review
Leicht, B. T., Kennedy, C., Richardson, C.
Cureus, 2022/02
Free full text
169

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text
170

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text
171

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text
172

Advances in the therapeutic approach of pudendal neuralgia: a systematic review
Murer, S., Polidori, G., Beaumont, F., Bogard, F., Polidori, E., Kinne, M.
Journal of Osteopathic Medicine, 2022/01
Free full text
173

Pragmatic trials of pain therapies: a systematic review of methods
Hohenschurz-Schmidt, D., Kleykamp, B. A., Draper-Rodi, J., Vollert, J., Chan, J., Ferguson, M., McNicol, E., Phalip, J., Evans, S. R., Turk, D. C., Dworkin, R. H., Rice, A. S. C.
Pain, 2022/01
Free full text
174

Differenzialdiagnostik von Hüft- und Leistenschmerzen
(Differential diagnosis of hip and groin pain)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
175

Lymphatic osteopathic manipulative treatment reduces duration of deltoid soreness after Pfizer/BioNTech COVID-19 vaccine
Marshall, S., Winter, S., Capobianco, J. D.
Journal of Osteopathic Medicine, 2022/01
Free full text
176

Comparing the effects of muscle energy technique and mulligan mobilization with movements on pain, range of motion, and disability in adhesive capsulitis
Razzaq, A., Nadeem, R. D., Akhtar, M., Ghazanfar, M., Aslam, N., Nawaz, S.
Journal of the Pakistan Medical Association, 2022/01
Free full text
177

Comparison of the Effect of Muscle Energy Techniques and Stretching Exercises on Pain and Psychosocial Dysfunction Levels in Individuals With Low Back Pain
Cha, B., Kim, S.
Physical Therapy Korea, 2022/01
Free full text
178

Results of a feasibility randomised controlled trial of osteopathy on neck-shoulder pain in computer users
Santiago, R. J., Esteves, J. E., Baptista, J. S., Magalhães, A., Costa, J. T.
Complementary Therapies in Clinical Practice, 2022/01
Free full text
179

Возможности применения остеопатических методов диагностики и коррекции при дискинезии желчного пузыря
(Possibilities of osteopathic methods of diagnosis and correction in gallbladder dyskinesia)
Panaseiko, Y. N.
Russian Osteopathic Journal, 2021/12
180

‘A Mindful ACT’- testing the feasibility and acceptability of a brief psychosocial intervention designed to accompany osteopathy treatment for people who live with persistent pain
Jäger, M., Terry, J., Rance, J.
International Journal of Osteopathic Medicine, 2021/12
181

Pain knowledge and fear-avoidance beliefs of French osteopathy students and educators towards chronic low back pain: An osteopathic educational institution-based cross-sectional survey
Mhadhbi, H., Thierry-Hildenbrand, B., Draper-Rodi, J., Esteves, J. E., Ménard, M.
International Journal of Osteopathic Medicine, 2021/12
182

Effects of Visceral Manipulation Treatment on Women with Infertility and Adults with Low Back Pain
Parker, A.
Unpublished Dissertation, 2021/12
183

An Osteopathic Approach to Complex Regional Pain Syndrome (CRPS)
Deol, N., Nuño, V., Schuman, M., Contreras, C.
The AAO Journal, 2021/12
Free full text
184

A Network Meta-Analysis of Randomized Controlled Trials Directed at Treating Lateral Epicondylalgia
Price, J. W.
The AAO Journal, 2021/12
Free full text
185

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text
186

Fast improvements in functional status after osteopathic manipulative treatment based on myofascial release in patients with moderate or severe fibromyalgia: a retrospective study
Farra, F., Chiesa, A., Risio, R. G., Vismara, L., Bergna, A.
Journal of Complementary and Integrative Medicine, 2021/11
Free full text
187

Der Einfluss der Osteopathie auf den Schmerz und die Beweglichkeit nach einer Rotatorenmanschettenrekonstruktion
(The influence of osteopathy on pain and mobility after rotator cuff reconstruction)
Schrempf, I.
Unpublished MSc thesis, 2021/11
188

An osteopathic approach to occipital neuralgia and tinnitus
Aiman, A., Skaug, J., Fleming, R. K.
Osteopathic Family Physician, 2021/11
189

Examining the peer-reviewed published literature regarding low back pain in rowing: A scoping review
Athy, V.
Unpublished MSc thesis, 2021/11
Free full text
190

Der Einfluss von osteopathischen Behandlungen auf die Beschwerdesymptomatik bei Patienten mit CPPS als Ergänzung zur konventionellen Therapie
(The influence of osteopathic treatments on symptomatology in patients with CPPS as an addition to conventional therapy)
Nezaj, B.
Unpublished MSc thesis, 2021/11
191

Osteopathie bei chronischen Beckenschmerzen
(Osteopathic treatment in patients with chronic pelvic pain)
Koza, M.
Unpublished MSc thesis, 2021/11
192

Effectiveness of myofascial release on pain, sleep, and quality of life in patients with fibromyalgia syndrome: A systematic review
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P.
Complementary Therapies in Clinical Practice, 2021/11
193

Spinal Manipulative Therapy for Acute Neck Pain: A Systematic Review and Meta-Analysis of Randomised Controlled Trials
Chaibi, A., Stavem, K., Russell, M. B.
Journal of Clinical Medicine, 2021/10
Free full text
194

Изучение полисинаптической рефлекторной возбудимости и соматосенсорных вызванных потенциалов у пациентов с миофасциальным болевым синдромом
(Study of polysynaptic reflex excitability and somatosensory evoked potentials in patients with myofascial pain syndrome)
Safiullina, A. A., Safiullina, G. I., Yakupov, R. A.
Russian Osteopathic Journal, 2021/10
Free full text
195

Опыт применения кинезиотейпирования для купирования альгоменореи у девочек-подростков в условиях детского реабилитационного стационара
(Experience in the use of kinesio taping for the relief of algomenorrhea in adolescent girls in a children′s rehabilitation hospital)
Vasilevich, S. V., Petrov, S. S.
Russian Osteopathic Journal, 2021/10
Free full text
196

Changing behaviour: role of theories and techniques in increasing physical activity in non-specific low back pain patients
Williamson, S. L.
Unpublished PhD thesis, 2021/09
Free full text
197

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, Dr C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09
198

The legacy and implications of the body-mind-spirit osteopathic tenet: a discussion paper evaluating its clinical relevance in contemporary osteopathic care
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/09
199

Preventing progression from chronic to widespread pain and its impact on health-related quality of life: a historical cohort study of osteopathic medical care
Licciardone, J. C.
Journal of Osteopathic Medicine, 2021/09
Free full text
200

Pain and symptom management in a case of cervical dystonia with comorbid generalized joint hypermobility using prolotherapy with osteopathic manipulative medicine
Mancini, J., Whitfield, D.
Movement Disorders, 2021/09
201

Effects of Osteopathic Manipulation and Other Manual Manipulative Treatments on Cystic Fibrosis
Ball, K. T., Kraft, D. E., Snider, K. T.
The AAO Journal, 2021/09
Free full text
202

Single Osteopathic Manipulative Treatment Session Eliminates Percutaneous Coronary Intervention-Induced Upper Thoracic Pain in Elderly Male
Hoffman, P., Belogorodsky, D., Noto-Bell, L.
The AAO Journal, 2021/09
Free full text
203

Osteopathic Manipulative Treatment for Chronic Low Back Pain
Licciardone, J. C.
JAMA Internal Medicine, 2021/08
204

Osteopathic Manipulative Treatment for Chronic Low Back Pain—Reply
Nguyen, C., Zegarra-Parodi, R, Boutron, I.
JAMA Internal Medicine, 2021/08
205

Patient-centered care or osteopathic manipulative treatment as mediators of clinical outcomes in patients with chronic low back pain
Licciardone, J. C., Aryal, S.
Journal of Osteopathic Medicine, 2021/08
Free full text
206

Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial
Brandl, A., Egner, C., Schleip, R.
Life (Basel), 2021/08
Free full text
207

Comparing the effect of thrust manipulation and muscle energy technique on pain and disability in patients with sacroiliac joint dysfunction
Fatima, I., Goyal, M., Singh, G.
Physiotherapy Quarterly, 2021/08
Free full text
208

Osteopathie bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom
(Osteopathy for chronic prostatitis/chronic pelvic pain syndrome)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
209

Effect of Muscle Energy Technique Versus Aerobic Exercise on Chronic Cyclic Pelvic Pain
Aziz, K. S. A., Mowafy, H.M., Hasanin, M. E., M., Ghazal, N. H. H.
The Egyptian Journal of Hospital Medicine, 2021/07
Free full text
210

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07
211

Muscle Energy Technique in the Rehabilitative Treatment for Acute and Chronic Non-Specific Neck Pain: A Systematic Review
Sbardella, S., La Russa, C., Bernetti, A., Mangone, M., Guarnera, A., Pezzi, L., Paoloni, M., Agostini, F., Santilli, V., Saggini, R., Paolucci, T.
Healthcare, 2021/07
Free full text
212

Effects of myofascial release or self-myofascial release and control position exercises on lower back pain in idiopathic scoliosis: A systematic review
López-Torres, O., Mon-López, D., Gomis-Marzá, C., Lorenzo, J., Guadalupe-Grau, A.
Journal of Bodywork and Movement Therapies, 2021/07
213

Secondary dysmenorrhea and dyspareunia associated with pelvic girdle dysfunction: A case report and review of literature
Origo, D., Piloni, S., Tarantino, A. G.
Journal of Bodywork and Movement Therapies, 2021/07
214

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07
215

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06
216

Efficacy of Stretching vs Muscle Energy Technique in Postoperative Elbow Stiffness: A Research Protocol
Shende, G., Deshmukh, M. P., Jain, D. K., Phansopkar, P.
Indian Journal of Forensic Medicine and Toxicology, 2021/06
217

“Who am I to disagree?” A qualitative study of how patients interpret the consent process prior to manual therapy of the cervical spine
Reed, B. R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06
218

Туннельная невропатия локтевого нерва: влияние остеопатической коррекции на снижение болевого синдрома
(Cubital tunnel neuropathy: Impact of osteopathic manipulative treatment on pain syndrome relief)
Belyaev, A. F., Belomestnov, P. V.
Russian Journal of Pain, 2021/06
Free full text
219

Comparison of effectiveness of muscle energy technique with Mulligan mobilization in patients with non-specific neck pain
Manzoor, A., Anwar, N., Khalid, K., Haider, R., Saghir, M., Javed, M. A.
Journal of the Pakistan Medical Association, 2021/06
Free full text
220

Integrating Osteopathic Evaluation and Treatment in a Case of Opioid-Induced Hyperalgesia
Rosendahl, N. O.
The AAO Journal, 2021/06
Free full text
221

Effect of Osteopathic Manipulative Treatment vs Sham Treatment on Activity Limitations in Patients With Nonspecific Subacute and Chronic Low Back Pain: A Randomized Clinical Trial
Nguyen, C., Boutron, I., Zegarra-Parodi, R., Baron, G., Alami, S., Sanchez, K., Daste, C., Boisson, M., Fabre, L., Krief, P., Krief, G., Lefèvre-Colau, M.M., Rannou, F.
JAMA Internal Medicine, 2021/05
222

A comparative study of Thai massage and muscle energy technique for chronic neck pain: A single-blinded randomized clinical trial
Buttagat, V., Muenpan, K., Wiriyasakunphan, W., Pomsuwan, S., Kluayhomthong, S., Areeudomwong, P.
Journal of Bodywork and Movement Therapies, 2021/05
223

Manual treatment for kidney mobility and symptoms in women with nonspecific low back pain and urinary infections
Lo Basso, F., Pilzer, A., Ferrero, G., Fiz, F., Fabbro, E., Oliva, E., Cazzarolli, C., Turrina, A.
Journal of Osteopathic Medicine, 2021/05
Free full text
224

Gnathological and osteopathic treatments with digital evaluations before and after therapies: a case report of a patient with ehlers-danlos syndrome
Di Giacomo, P., Cerignoli, E., D'Ermes, V., Ferrato, G., Polimeni, A., Di Paolo, C.
La Clinica Terapeutica, 2021/05
Free full text
225

Direct and mediated effects of treatment context on low back pain outcome: a prospective cohort study
Bishop, F., Al-Abbadey, M., Roberts, L., MacPherson, H., Stuart, B., Carnes, D., Fawkes, C., Yardley, L., Bradbury, K.
BMJ Open, 2021/05
Free full text
226

Can the sleep quality of patients with chronic neck pain be improved by muscle energy techniques combined with Swedish massage?
Hadamus, A., Wojda, A., Białoszewski, D.
Complementary Therapies in Clinical Practice, 2021/05
227

The effect of dry needling & muscle energy technique separately and in combination in patients suffering shoulder impingement syndrome and active trigger points of infraspinatus
Jalilipanah, P., Okhovatian, F., Serri, R. A., Bagban, A. A., Zamani, S.
Journal of Bodywork and Movement Therapies, 2021/04
228

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
229

Perceptions of nonopioid treatment for pain in a homeless population
Fraser, K. A., Nguyen, H., Kim, S., Park, F., Bernal, J., Westberg, A. D., Podawiltz, A.
Journal of Osteopathic Medicine, 2021/04
Free full text
230

Возможности коррекции нарушения статодинамического стереотипа у пациентов с дорсопатией на шейно-грудном уровне
(Possibilities of correction of the statodynamic stereotype violations in patients with dorsopathy at the cervical-thoracic level)
Belash, V. O., Vorobyova, A. E., Vasyukovich, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
231

Эффект техники освобождения при помощи давления на латентную миофасциальную триггерную точку в верхней части трапециевидной мышцы: рандомизированное контролируемое клиническое исследование
(Effects of the release technique by pressing on the latent myofascial trigger point of the upper trapezius muscle: random controlled clinical trial)
Ferreira Faria, M. A., Bautista Aguirre, F.
Russian Osteopathic Journal, 2021/04
Free full text
232

A Closer Look into the Association between the Sacroiliac Joint and Low Back Pain
Wieczorek, A., Campau, E., Pionk, E., Gabriel-Champine, M. E., Rios-Bedoya, C. F.
Spartan Medical Research Journal, 2021/04
Free full text
233

Effektivität einer osteopathischen Behandlung der Nieren bei Leistenschmerz von Sportlern – eine einfach verblindete randomisierte Studie
(Effectiveness of an osteopathic kidney treatment for groin pain in athletes – a single blinded randomized trial)
Pakosta, M.
Unpublished MSc thesis, 2021/04
Free full text
234

Der Effekt des osteopathischen Ansatzes und osteopathischer Techniken auf Symptome, insbesondere Schmerz, und Lebensqualität bei CMD – ein systematischer Review
(Efficacy of osteopathic approach and osteopathic techniques on pain, symptoms and quality of life in temporomandibular joint disorder: a systematic review)
Ixenmaier, D.
Unpublished MSc thesis, 2021/04
Free full text
235

Osteopathic manipulative treatment to improve exclusive breast feeding at 1 month
Danielo Jouhier, M., Boscher, C., Roze, J. C., Cailleau, N., Chaligne, F., Legrand, A., Flamant, C., Muller, J. B.
Archives of Disease in Childhood. Fetal and Neonatal Edition, 2021/04
236

Developing a psychologically-informed pain management course for use in osteopathic practice: The OsteoMAP cohort study
Abbey, H., Nanke, L., Brownhill, K.
International Journal of Osteopathic Medicine, 2021/03
237

Effects of osteopathic manipulative treatment and bio-electromagnetic energy regulation therapy on lower back pain
Auger, K., Shedlock, G., Coutinho, K., Myers, N. E., Lorenzo, S.
Journal of Osteopathic Medicine, 2021/03
Free full text
238

Support for osteopathic manipulative treatment inclusion in chronic pain management guidelines: a narrative review
Franzetti, M., Dries, E., Stevens, B., Berkowitz, L., Yao, S. C.
Journal of Osteopathic Medicine, 2021/03
Free full text
239

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03
240

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03
241

Effekt der Osteopathie auf Patientinnen mit Dysmenorrhoe - Ein Systematischer Review
(Effectiveness of Osteopathy in Patients with Dysmenorrhea - A systematic review)
Thurner, C.
Unpublished MSc thesis, 2021/03
Free full text
242

Der tiefsitzende Beckenschmerz: Ein osteopathischer Behandlungsalgorithmus in sieben Schritten
(The chronic pelvic pain: An osteopathic treatment algorithm in seven steps)
Liedtke, H.
Osteopathische Medizin, 2021/03
243

An Osteopathic Approach to Neck Pain
Zona, J. C., Cranor, M.
American Family Physician, 2021/03
244

Breathing and the Center of Command - The influence of respiration on the Central Nervous System
Auer-Rizzi, K.
Unpublished MSc thesis, 2021/03
Free full text
245

A splenic cyst causing a viscerosomatic reflex in the thoracic spine. A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2021/03
246

A blame game and sticky labels: A qualitative study of osteopaths’ experiences of managing patients with pain catastrophising
Pelekanou, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/03
247

Comparing the Effectiveness of the Muscle Energy Technique and Kinesiotaping in Mechanical Sacroiliac Joint Dysfunction: A Non-blinded, Two-Group, Pretest-Posttest Randomized Clinical Trial Protocol
Sarkar, M., Goyal, M., Samuel, A. J.
Asian Spine Journal, 2021/02
Free full text
248

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
249

A mixed treatment comparison of selected osteopathic techniques used to treat acute nonspecific low back pain: a proof of concept and plan for further research
Price, J. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
250

Effects of dynamic stabilization exercises and muscle energy technique on selected biopsychosocial outcomes for patients with chronic non-specific low back pain: a double-blind randomized controlled trial
Ahmed, U. A., Maharaj, S. S., Van Oosterwijck, J.
Scandinavian Journal of Pain, 2021/02
251

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text
252

Die osteopathische Anwendung der CV4 Technik bei Patientinnen und Patienten mit chemoinduzierter Polyneuropathie nach zytostatischer Chemotherapie
(The Osteopathic Application of the CV4 Technique in Patients with Chemotherapy-induced Polyneuropathy after Cytostatic Chemotherapy)
Flaschberger, P.
Unpublished MSc thesis, 2021/02
Free full text
253

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Spanish osteopaths
Alvarez, G., Justribo, C., Sundberg, T., Thomson, O. P., Leach, M. J.
BMC Health Services Research, 2021/02
Free full text
254

The Effect of Manual Therapy on Lower Extremity Joint Kinematics during Running: A single-subject case study
Drapeaux, A., Carlson, K.
Journal of Bodywork and Movement Therapies, 2021/01
255

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text
256

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text
257

Effectiveness of osteopathic interventions in chronic non-specific low back pain: A systematic review and meta-analysis
Dal Farra, F., Risio, R. G., Vismara, L., Bergna, A.
Complementary Therapies in Medicine, 2021/01
Free full text
258

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text
259

The short-form Orebro Musculoskeletal Pain Questionnaire (OMPQ-10): Associations with determinants of health and demographics in a musculoskeletal pain cohort
Vaughan, B., Fitzgerald, K., Flesichmann, M., Mulcahy, J.
International Journal of Osteopathic Medicine, 2020/12
260

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text
261

Osteopathic Approach to the Treatment of a Patient With Idiopathic Iliohypogastric Neuralgia
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
262

Efficacy of Muscle Energy Technique and Myofascial Release in Nonspecific Low Back Pain—A Comparative Study
Das, A., Bhattacharya, U., Chauhan, V.
Alternative and Complementary Therapies, 2020/12
263

Рефлексотерапия в лечении пациентов с дорсопатией
(Reflexology in the treatment of patients with dorsopathy)
Belash, V. O., Agasarov, L. G.
Russian Osteopathic Journal, 2020/12
Free full text
264

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12
265

The effect of osteopathic medicine on pain in musicians with nonspecific chronic neck pain: a randomized controlled trial
Rotter, G., Fernholz, I., Binting, S., Keller, T., Roll, S., Kass, B., Reinhold, T., Willich, S. N., Schmidt, A., Brinkhaus, B.
Therapeutic Advances in Musculoskeletal Disease, 2020/12
Free full text
266

Возможности и организационные проблемы диагностики и лечения пациентов с синдромом болевой дисфункции височно-нижнечелюстного сустава
(Possibilities and organizational problems of diagnostics and treatment of patients with the syndrome of temporomandibular joint pain dysfunction)
Milutka, Y. A., Fortin, A. E.
Russian Osteopathic Journal, 2020/12
Free full text
267

The effect of tongue and suprahyoid muscles release in the treatment of chronic non-specific neck pain: Study protocol for a randomized controlled trial
Silva, A. C., Godinho, M. M., Biasotto Gonzalez, D. A., Politti, F.
International Journal of Osteopathic Medicine, 2020/12
268

The clinical management of neck pain of novice and experienced Australian osteopaths: a secondary analysis of a nationally representative sample
Fleischmann, M., McLaughlin, P., Hayes, A., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2020/11
269

Evaluation of the Combination of Muscle Energy Technique and Trigger Point Therapy in Asymptomatic Individuals with a Latent Trigger Point
Wendt, M., Waszak, M.
International journal of environmental research and public health, 2020/11
Free full text
270

Ultrasonography to Assess the Efficacy of Osteopathic Manipulative Treatment for Lumbar Spine Asymmetry
Winter, J., Kimber, A., Montenegro, S., Gao, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
271

Der sternale Recoil als Alternative zu einer hochthorakalen HVLA-Technik bei unspezifischen Nackenschmerzen?
(Sternal Recoil as an alternative to thoracic HVLA?)
Rauch, B.
Unpublished MSc thesis, 2020/11
272

Einfluss einer osteopathischen Behandlung der Halswirbelsäule bei Schulterschmerzen
(Influence of an osteopathic treatment on shoulder pain)
Albrecht, J. M.
Unpublished MSc thesis, 2020/10
Free full text
273

Sample size, study length and inadequate controls were the most common self-acknowledged limitations in manual therapy trials: A methodological review
Alvarez, G., Núñez-Cortés, R., Solà, I., Sitjà-Rabert, M., Fort-Vanmeerhaeghe, A., Fernández, C., Bonfill, X., Urrutia, G.
Journal of Clinical Epidemiology, 2020/10
274

The Role of Musculoskeletal Disorders in Chronic Disease: A Narrative Review
Asahi, M. G., Briganti, D., Cam, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
275

Treating Complex Regional Pain Syndrome Using Counterstrain: A Novel Approach
Schranz, K., Meitz, D., Powers, B., Ables, A.
Cureus, 2020/10
Free full text
276

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09
277

Severe Viscerosomatic Neck Pain from Refractory Gastroesophageal Reflux
Uhrig, J., Rettos, J.
The AAO Journal, 2020/09
Free full text
278

Применение медикаментозных блокад в комплексной терапии пояснично-крестцовой радикулоишемии у пациентов с грыжами дисков больших размеров
(The use of pharmacological blockades in the complex treatment of lumbosacral radiculoischemia in patients with discs hernias of large sizes)
Andreev, V. V., Sychev, A. I., Barantsevich, E. R.
Russian Osteopathic Journal, 2020/09
Free full text
279

Обоснование сочетанного применения остеопатических методов коррекции и рефлексотерапии в комплексной терапии пациентов с дорсопатией на шейно-грудном уровне
(The rationale for the combined use of osteopathic methods of correction and reflexology in the complex treatment of patients with dorsopathy at the cervico-thoracic level)
Belash, V. O., Urazgalieva, L. R., Fayzullina, R. I., Agasarov, L. G.
Russian Osteopathic Journal, 2020/09
Free full text
280

Модель фасциальных дисторсий (FDM-терапия). Принципы диагностики и лечения (обзор литературы)
(Fascial distortion model (FDM-therapy). Principles of diagnosis and treatment (literature review))
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. I.
Russian Osteopathic Journal, 2020/09
Free full text
281

Способ топографической тензоалгометрии для оценки биомеханических характеристик мягких тканей
(The method of topographic tensoalgometry for assessing biomechanical characteristics of soft tissues)
Eremushkin, M. A., Kolyshenkov, V. A.
Russian Osteopathic Journal, 2020/09
Free full text
282

Mindfulness-Based Stress Reduction in the Management of Chronic Pain and Its Comorbid Depression
Marske, C., Shah, S., Chavira, A., Hedberg, C., Fullmer, R., Clark, C. J., Pipitone, O., Kaiser, P.
The Journal of the American Osteopathic Association, 2020/09
Free full text
283

Обоснование применения методов остеопатической коррекции у пациентов с синдромом Зудека
(Rationale for the use of osteopathic correction methods in patients with Sudeck syndrome)
Mikhnov, G. I., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/09
Free full text
284

Возможности применения остеопатических методов коррекции в лечении болевого синдрома при нефроптозе
(Possibilities of applying of osteopathic correction methods in the treatment of pain syndrome in nephroptosis)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/09
Free full text
285

Применение физио- и бальнеотерапии у пациентов с неспецифической болью в нижней части спины (обзор литературы)
(The application of physical therapy and balneology of the patients with non-specific low back pain (literature review))
Novikov, A. Y., Shaiakhmetov, A. R., Novikov, Y. O.
Russian Osteopathic Journal, 2020/09
Free full text
286

Instrumentation used to assess pain in osteopathic interventions: A critical literature review
Santiago, R. J., Esteves, J., Baptista, J. S., Marques, A. T., Costa, J. T.
International Journal of Osteopathic Medicine, 2020/09
287

What do UK osteopaths view as the safest lifting posture, and how are these views influenced by their back pain beliefs?
Smith, K., Thomson, O. P.
International Journal of Osteopathic Medicine, 2020/09
288

Comparison between high-velocity low-amplitude manipulation and muscle energy technique on pain and trunk neuromuscular postural control in male workers with chronic low back pain: A randomised crossover trial
Sturion, L. A., Nowotny, A. H., Barillecb, F., Barette, G., Santosa, G. K., Teixeirac, F. A., Fernandes, K. P., Da Silva, R.
South African Journal of Physiotherapy, 2020/08
Free full text
289

Rib Somatic Dysfunction Among General Surgical Patients
Baltazar, G. A., Kolwitz, C. E., Florek, M. G.
The Journal of the American Osteopathic Association, 2020/08
Free full text
290

Use of Osteopathic Manipulation for Treatment of Chronic Shoulder Injury Related to Vaccine Administration
Veera, S., Chin, J., Kleyn, L., Spinelli, S., Tafler, L.
Cureus, 2020/08
Free full text
291

Musculoskeletal Therapies: Osteopathic Manipulative Treatment
Jonas, C.
FP Essentials, 2020/07
292

Osteopathic Treatment leads to significantly greater reductions in chronic thoracic pain after CABG surgery: a randomised controlled trial
Roncada, Gert
Journal of Bodywork and Movement Therapies, 2020/07
293

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07
294

Osteopathic Manipulation in the Management of Chronic Pain: Current Perspectives
Licciardone, J. C., Schultz, M. J., Amen, B.
Journal of Pain Research, 2020/07
Free full text
295

Osteopathic Manipulative Treatment and Psychosocial Management of Dysmenorrhea
Matsushita, S., Wong, B., Kanumalla, R., Goldstein, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text
296

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text
297

Self-management behaviour and knowledge of patients with musculoskeletal complaints attending an Australian osteopathy clinic: A consecutive sampling design
Vaughan, B., Grant, M., Moroz, J., Ngawaka, C., Mulcahy, J.
International Journal of Osteopathic Medicine, 2020/06
298

Integrating Osteopathic Manipulative Treatment and Injections in the Diagnosis and Management of a Hip Labral Tear
Snyder, L. L., Knox, S. C., Smutny, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text
299

Implied Evidence of the Functional Role of the Rectus Capitis Posterior Muscles
Hallgren, R. C., Rowan, J. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text
300

Pain knowledge, attitudes and beliefs of Australian osteopaths drawn from a nationally representative sample of the profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Austin, P.
Journal of Bodywork and Movement Therapies, 2020/06
301

The Spanish Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross-sectional survey
Alvarez, G., Roura, S., Cerritelli, F., Esteves, J. E., Verbeeck, J., van Dun, P. L. S.
PLoS ONE, 2020/06
Free full text
302

Effects of Osteopathic Manipulative Treatment on Musicians: A Systematic Review
Kiepe, M. S., Fernholz, I., Schmidt, T., Brinkhaus, B., Schmidt, A., Weikert, C., Rotter, G.
Medical problems of performing artists, 2020/06
303

Остеопатическая коррекция при лечении боли в нижней части спины
(Osteopathic correction in the treatment of pain in the lower back)
Belash, V. O., Novikov, Y. O.
Russian Osteopathic Journal, 2020/06
Free full text
304

A subjective and objective analysis of the immediate effect of osteopathic manual treatment OMT on the golf swing
Maass, Z, Buffington, A, Miner, M, Hall, M
Clinical journal of sport medicine, 2020/06
305

Синдром Зудека — современные представления о патогенезе, факторах риска, диагностике и лечении (обзор литературы)
(Sudeck syndrome — current understanding of pathogenesis, risk factors, diagnosis and treatment (literature review))
Mikhnov, G. I., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/06
Free full text
306

Обоснование применения остеопатической коррекции при лечении пациенток с хроническим заболеванием вен нижних конечностей
(Rationale for the use of osteopathic correction in the treatment of patients with chronic lower limb vein disease)
Shmeleva, A. S., Mizonova, I. B.
Russian Osteopathic Journal, 2020/06
Free full text
307

Beliefs about chronic low back pain amongst osteopaths registered in Spain: A cross-sectional survey
Van Biesen, T., Alvarez, G.
International Journal of Osteopathic Medicine, 2020/06
308

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
309

Effects of static stretching as compared to autogenic inhibition and reciprocal inhibition muscle energy techniques in the management of mechanical neck pain: a randomized controlled trial
Osama, M., Shakil Ur Rehman, S.
Journal of the Pakistan Medical Association, 2020/05
Free full text
310

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text
311

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
312

Osteopathic manipulative treatment combined with exercise improves pain and disability in individuals with non-specific chronic neck pain: A pragmatic randomized controlled trial
Groisman, S, Malysz, T, de Souza da Silva, L., Rocha Ribeiro Sanches, T., Camargo Bragante, K., Locatelli, F., Pontel Vigolo, C., Vaccari, S., Homercher Rosa Francisco, C., Monteiro Steigleder, S., Jotz, G. P.
Journal of Bodywork and Movement Therapies, 2020/04
313

Influence of the phrenic nerve in shoulder pain: A systematic review
Fernández-López, I., Peña-Otero, D., Ángeles Atín-Arratibel, M., Eguillor-Mutiloa, M.
International Journal of Osteopathic Medicine, 2020/04
314

Muscle Energy Technique for Neck Pain: Systematic Review
Son, B. K., Yoo, H. J., Geum, J. H., Lee, J. H., Ha, W. B.
The Journal of Korea CHUNA Manual Medicine for Spine & Nerves, 2020/04
Free full text
315

Approach To Joint Pain In The Elderly For Osteopathic Providers
Daudfar, S., Nakajima, N., Faiss, K., Tegeler, L., Kuo, J., Dreibelbis, R., Goering, E., Katsaros, E., Pham, J. T.
Osteopathic Family Physician, 2020/04
Free full text
316

The Effect of High Velocity Low Amplitude Cervical Manipulations on the Musculoskeletal System: Literature Review
Giacalone, A., Febbi, M., Magnifica, F., Ruberti, E.
Cureus, 2020/04
Free full text
317

Platelet-Rich Plasma and Epidural Platelet Lysate: Novel Treatment for Lumbar Disk Herniation
Rawson, B.
The Journal of the American Osteopathic Association, 2020/03
Free full text
318

Chronically Exposed Knee Hardware
Dobracki, A.
The Journal of the American Osteopathic Association, 2020/03
Free full text
319

A new perspective for Somatic Dysfunction in Osteopathy: the Variability Model
Bergna, A., Vismara, L., Parravicini, G., Farra, F.
Journal of Bodywork and Movement Therapies, 2020/03
320

Assessment and Management of Somatic Dysfunctions in Patients With Patellofemoral Pain Syndrome
Tramontano, M., Pagnotta, S., Lunghi, C., Manzo, C., Manzo, F., Consolo, S., Manzo, V.
The Journal of the American Osteopathic Association, 2020/03
Free full text
321

Immediate effects of muscle energy technique and stabilization exercise in patients with chronic low back pain with suspected facet joint origin: A pilot study
Wahyuddin, W., Vongsirinavarat, M., Mekhora, K., Bovonsunthonchai, S., Adisaipoapun, R.
Hong Kong Physiotherapy Journal, 2020/03
Free full text
322

Efficacy of Combination Therapies on Neck Pain and Muscle Tenderness in Male Patients with Upper Trapezius Active Myofascial Trigger Points
Alghadir, A. H., Iqbal, A., Anwer, S., Iqbal, Z. A., Ahmed, H.
BioMed Research International, 2020/03
Free full text
323

Effects of eccentric muscle energy technique versus static stretching exercises in the management of cervical dysfunction in upper cross syndrome: a randomized control trial
Gillani, S. N., Ain, Q., Rehman, S. U., Masood, T.
Journal of the Pakistan Medical Association, 2020/03
Free full text
324

The ICD-11 and opportunities for the osteopathy profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Orchard, D.
International Journal of Osteopathic Medicine, 2020/03
325

La prise en charge de la douleur testiculaire chronique due a un syndrome de charniere thoraco-lombaire : étude pilote
(Management of chronic testicular pain due to thoracolumbar junction syndrome: A pilot study)
Aoun, F., Malek, E., Kazan, D., Albisinni, S., Peltier, A., Bollens, R., Roumeguère, T.
Progres en urologie : journal de l'Association francaise d'urologie et de la Societe francaise d'urologie, 2020/03
326

Barriers and facilitators experienced by osteopaths in implementing a biopsychosocial (BPS) framework of care when managing people with musculoskeletal pain – A mixed methods systematic review protocol
Kovanur Sampath, K., Darlow, B., Tumilty, S., Shillito, W., Hanses, M., Devan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2020/03
Free full text
327

Psychological context effects of participant expectation on pain pressure thresholds as an adjunct to cervicothoracic HVLA thrust manipulation: A randomised controlled trial
Shackleton, E., Toutt, C., Edwards, D. J.
International Journal of Osteopathic Medicine, 2020/03
328

Osteopathie zur Therapie bei unspezifischen Rückenschmerzen: Kritische Anmerkungen zu den Ergebnissen des IGeL-Monitors
(Osteopathy for the treatment of non-specific back pain: Critical comments on the results of the IGeL-Monitor)
Franke, H.
Osteopathische Medizin, 2020/03
Free full text
329

‘Tell me your story’ - How osteopaths apply the BPS model when managing low back pain - A qualitative study
Abrosimoff, M., Rajendran, D.
International Journal of Osteopathic Medicine, 2020/03
330

Antidepressant Discontinuation Syndrome: A Common but Underappreciated Clinical Problem
Rizkalla, M., Kowalkowski, B., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2020/02
Free full text
331

Short-term effect of muscle energy technique and mechanical diagnosis and therapy in sacroiliac joint dysfunction: - A pilot randomized clinical trial
Srivastava, S., Kumar K U, D., Mittal, H., Dixit, S., Nair, A.
Journal of Bodywork and Movement Therapies, 2020/02
332

Comparative study of muscle energy technique, craniosacral therapy, and sensorimotor training effects on postural control in patients with nonspecific chronic low back pain
Ghasemi, C., Amiri, A., Sarrafzadeh, J., Dadgoo, M., Jafari, H.
Journal of Family Medicine and Primary Care, 2020/02
Free full text
333

Osteopathic Medical Care With and Without Osteopathic Manipulative Treatment in Patients With Chronic Low Back Pain: A Pain Registry-Based Study
Licciardone, J. C., Gatchel, R. J.
The Journal of the American Osteopathic Association, 2020/02
Free full text
334

Evidence and recommendations for the use of segmental motion testing for patients with LBP – A systematic review
Stolz, M., von Piekartz, H., Hall, T., Schindler, A., Ballenberger, N.
Musculoskeletal Science and Practice, 2020/02
Free full text
335

Stretching exercises combined with ischemic compression in pectoralis minor muscle with latent trigger points: A single-blind, randomized, controlled pilot trial
Birinci, T., Mustafaoglu, R., Kaya Mutlu, E., Razak Ozdincler, A.
Complementary Therapies in Clinical Practice, 2020/02
Free full text
336

Arm Pain and Swelling in a College Swimmer: A Case of Paget-Schroetter Syndrome
Davis, R., Reed, E., Kraus, C.
The Journal of the American Osteopathic Association, 2020/01
Free full text
337

A mindful ACT: developing a brief ACT-based intervention for people receiving osteopathy treatment and living with persistent pain
Saracutu, M.
Unpublished PhD thesis, 2020/01
Free full text
338

Reexpansion Pulmonary Edema
Whitworth, K., Mancini, M.
The Journal of the American Osteopathic Association, 2020/01
Free full text
339

It is time to move beyond ‘body region silos’ to manage musculoskeletal pain: five actions to change clinical practice
Caneiro, J. P., Roos, E. M., Barton, C. J., Sullivan, K., Kent, P., Lin, I., Choong, P., Crossley, K. M., Hartvigsen, J., Smith, A. J., Sullivan, P.
British Journal of Sports Medicine, 2020/01
340

Efficacy of Muscle Energy Technique as an adjunct with Mulligans Mobilization in adhesive Capsulitis of Shoulder
Jaiswal, N., Saketa, J., Rajsekhar, H.
International Journal of Physiotherapy, 2019/2
Free full text
341

Efficacy of spinal extension exercise program versus muscle energy technique in treatment of chronic mechanical low back pain
Fahmy, E., Shaker, H., Ragab, W., Helmy, H., Gaber, M.
Egyptian Journal of Neurology, Psychiatry and Neurosurgery, 2019/12
Free full text
342

Influence of postoperative adhesions after caesarean section on chronic lower back pain – A pilot study of osteopathic manipulative treatment
Liedler, M., Woisetschläger, G.
European Journal of Osteopathic Research, 2019/12
Free full text
343

An Osteopathic Approach to Traumatically Induced Mechanical Dyspnea: A Case Report
Kanze, D. M.
The AAO Journal, 2019/12
Free full text
344

Comparing the efficacy of first rib maitland mobilisation and muscle energy technique on pain, disability and head position sense in patients with chronic mechanical neck pain
Sachdeva, S., Yadav, J., Gulati, M.
Journal of Clinical and Diagnostic Research, 2019/12
Free full text
345

Craniosacral therapy for chronic pain: a systematic review and meta-analysis of randomized controlled trials
Haller, H., Lauche, R., Sundberg, T., Dobos, G., Cramer, H.
BMC Musculoskeletal Disorders, 2019/12
Free full text
346

Роль генерализованной мышечной гиперфасилитации в патогенезе и клинической картине миофасциального болевого синдрома. Возможный вариант её коррекции
(The role of generalized muscule hyperfacilitation in pathogenesis and clinical picture of myofascial pain syndrome. Possible option of its correction)
Boldin, A. V., Agasarov, L. G., Tardov, M. V., Bokova, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
347

Исследование эффективности и безопасности кинезиотейпирования в коррекции острого и хронического миофасциального болевого синдрома у пациентов военного контингента средней и старшей возрастных групп
(Research on the effectiveness and safety of kinesiotaping in middle-aged and elderly military patients for reducing acute and chronic myofascial pain)
Bunin, A. V.
Russian Osteopathic Journal, 2019/12
Free full text
348

Efeitos da manipulação osteopática em trabalhadores feirantes com dor lombar crônica inespecífica: ensaio clínico randomizado
(Effects of osteopathic manipulation in fairground workers with chronic nonspecific low back pain: randomized clinical trial)
Estrázulas, J. A.
Unpublished MSc thesis, 2019/12
Free full text
349

Сегментарная иннервация: графический синтез соответствий между дерматомами, миотомами, склеротомами и висцеротомами. Систематический обзор научных работ и публикаций о дерматомах, миотомах, склеротомах и висцеротомах для разработки графического синтеза соматовисцеральных соответствий
(Segmental innervation: a graphic synthesis of correspondence between dermatomes, myotomes, sclerotomes and viscerotomes. Systematic review of existing works and publications about dermatomes, myotomes, sclerotomes and viscerotomes aimed to design a graphic synthesis of somato-visceral correspondences)
Gadet, P.
Russian Osteopathic Journal, 2019/12
Free full text
350

Интервенционное лечение боли в нижней части спины
(Interventional treatment of lower back pain)
Novikov, A. Y., Tsykunov, M. B.
Russian Osteopathic Journal, 2019/12
Free full text
351

Современные представления об этиологии и патогенезе шейного болевого синдрома: обзор литературы
(Modern views on etiology and pathogenesis of cervical pain syndromes: literature rewiew)
Novikov, Y. O., Belash, V. O., Novikov, A. Y.
Russian Osteopathic Journal, 2019/12
Free full text
352

The Osteopathic Approach to Chronic Pain Management: Assessing Its Biopsychosocial Processes and Relationships to Clinical Outcomes
Licciardone, J. C., Lin, A.
Journal of Osteopathic Medicine, 2019/12
353

The Effect of OMM on Opioid Users with Chronic Low Back Pain
Patel, K. C., Cooley, D. L., Bailey, J. W., Janora, D. M., Fusco, C.
Journal of Osteopathic Medicine, 2019/12
354

Role of Opioid Involved Drug Interactions in Chronic Pain Management
Bain, K. T., Knowlton, C. H.
The Journal of the American Osteopathic Association, 2019/12
Free full text
355

Review of Opioid Prescribing in the Osteopathic and Ambulatory Setting
Hussein, A. I., Bekampis, C. F., Jermyn, R. T.
The Journal of the American Osteopathic Association, 2019/12
Free full text
356

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text
357

Effectiveness of the muscle energy technique on respiratory muscle strength and endurance in patients with fibromyalgia
Uysal, S. C., Tuzun, E. H., Eker, L., Angin, E.
Journal of Back and Musculoskeletal Rehabilitation, 2019/11
Free full text
358

Einfluss einer osteopathischen Behandlung der vier Diaphragmen des Rumpfes nach Zink auf die Bewegungen des Center of pressure von Personen mit Rückenbeschwerden
(The impact of an osteopathic treatment of the four diaphragms after Zink on the movement of the center of pressure of individuals with back pain)
Arztmann, A.
Unpublished MSc thesis, 2019/10
Free full text
359

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10
360

Awareness of axial spondyloarthritis among chiropractors and osteopaths: findings from a UK Web-based survey
Yong, C. Y., Hamilton, J., Benepal, J., Griffiths, K., Clark, Z. E., Rush, A., Sengupta, R., Martindale, J., Gaffney, K.
Rheumatology Advances in Practice, 2019/10
Free full text
361

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10
362

Einfluss osteopathischer Behandlung der Fascia thoracolumbalis bei chronisch unspezifischen Rückenschmerzen
(The influence of osteopathic treatment on the thoracolumbar fascia in case of chronic non-specific low back pain)
Putz, F.
Unpublished MSc thesis, 2019/10
Free full text
363

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text
364

Osteopathic Approach for Lateral Knee Pain Caused by Iliotibial Band Friction Syndrome: A Case Report
Kostanjevec, J., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
365

Rückenschmerzen
(Back pain)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
366

Osteopathic approach with a patient undergoing cardiac transplantation: the five diaphragms
Bordoni, B., Morabito, B., Simonelli, M., Nicoletti, L., Rinaldi, R., Tobbi, F., Caiazzo, P.
International medical case reports journal, 2019/09
Free full text
367

Integrating Osteopathic Evaluation and Treatment in a Case Report of Acute Chest Pain
Yao, S. C.
The AAO Journal, 2019/09
Free full text
368

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text
369

Intervensi ultrasound dan Muscle Energy Technique lebih menurunkan disabilitas leher daripada intervensi ultrasound dan myfofascial release technique papda kasus myfofascial pain syndrome otot upper trapzius di denpasar
Ultrasound intervention and muscle energy technique further reduced neck disability than an ultrasound intervention and myofascial release technique in the case of myofascial pain syndrome upper trapezius muscle
Wibawa, A., Andayani, N. L. N., Trisna Narta Dewi, A. A. N.
Sport and Fitness Journal, 2019/09
Free full text
370

Beschleunigungstrauma der Halswirbelsäule
(Whiplash injury in the cervical spine)
Belz, S., Baum, N.
Osteopathische Medizin, 2019/09
371

Is visceral manipulation beneficial for patients with low back pain? A systematic review of the literature
Switters, Jacob Marten, Podar, Stefan, Perraton, Luke, Machotka, Zuzana
International Journal of Osteopathic Medicine, 2019/09
372

Empathy in Medicine Osteopathic and Allopathic Physician Interpersonal Manner, Empathy, and Communication Style and Clinical Status of Their Patients: A Pain Registry-Based Study
Licciardone, J. C., Schmitt, M. E., Aryal, S.
The Journal of the American Osteopathic Association, 2019/08
Free full text
373

The efficacy of muscle energy techniques in symptomatic and asymptomatic subjects: a systematic review
Thomas, E., Cavallaro, A. R., Mani, D., Bianco, A., Palma, A.
Chiropractic & Manual Therapies, 2019/08
Free full text
374

Assessment of shoulder pain and somatic dysfunction in young competitive swimmers: Preventive Osteopathic Manipulative Treatment
Granger, F., Etevenard, M., Kily, J. P., Garet, M.
Journal of Sports Medicine and Therapy, 2019/08
Free full text
375

Effect of muscle energy technique on pain pressure threshold in sacroiliac joint dysfunction
Srivastava, S., U., Dhanesh K. K., Mittal, H.
International Journal of Research in Pharmaceutical Sciences, 2019/07
Free full text
376

Mets and oscillating energy manual therapy in chronic lateral epicondylosis: A comparative study
Unnisa, R., Sivajyothi, N., G., Yatheendra K., Ur Rahman, M. A. W., Ahmed, I.
International Journal of Research in Pharmaceutical Sciences, 2019/07
Free full text
377

Rücken- und Beckenschmerzen bei Schwangeren und nach der Geburt – eine Metaanalyse
(Back and pelvic pain in pregnant women and after childbirth - a meta-analysis)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
378

Improving the quality of myofascial release research – A critical appraisal of systematic reviews
Ajimsha, M. S., Shenoy, P. D.
Journal of Bodywork and Movement Therapies, 2019/07
379

La lumbalgia: La visión desde la osteopatía y medicina tradicional del Palenque San Basilio
(Low back pain: The vision of osteopathy and traditional medicine of Palenque San Basilio)
Ayala Ardila, D. P.
Unpublished MSc thesis, 2019/07
Free full text
380

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text
381

Visceral Manipulation Decreases Pain, Increases Cervical Mobility and Electromyographic Activity of the Upper Trapezius Muscle in Non-Specific Neck Pain Subjects with Functional Dyspepsia: Two Case Reports
Silva, A. C. O., Oliveira, C. S., Biasotto-Gonzalez, D. A., Fumagalli, M. A., Politti, F.
International Journal of Therapeutic Massage and Bodywork, 2019/06
Free full text
382

A Study to Investigate the Effect of ‘Frontal Lift’ Osteopathic Manipulative Technique (OMT) in Patients with Chronic Sinusitis
Lintonbon, David
American Journal of Biomedical Science & Research, 2019/06
383

Do empathic osteopaths achieve better clinical results? An observational feasibility study
Acquati, A., Uberti, S., Aquino, A., Cerasetti, E., Castagna, C., Rovere-Querini, P., Pisa, V.
International Journal of Osteopathic Medicine, 2019/06
384

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06
385

Active Visceral Manipulation Associated With Conventional Physiotherapy in People With Chronic Low Back Pain and Visceral Dysfunction: A Preliminary, Randomized, Controlled, Double-Blind Clinical Trial
Villalta Santos, L., Lisboa Cordoba, L., Benite Palma Lopes, J., Santos Oliveira, C., Andre Collange Grecco, L., Bovi Nunes Andrade, A. C., Pasin Neto, H.
Journal of Chiropractic Medicine, 2019/06
Free full text
386

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06
387

Étude randomisée monocentrique évaluant l’efficacité de l’ostéopathie dans la prise en charge des douleurs chroniques après chirurgie mammaire en oncologie
(Osteopathy for chronic pain after breast cancer surgery: a monocentric randomised study)
Chvetzoff, G., Berthier, A., Blanc, E., Bourne Branchu, V., Millaret, A., Cropet, C., Pérol, D.
Bulletin du Cancer, 2019/06
388

OSLO – Effets d’un traitement ostéopathique manuel sur la lombalgie non spécifique aiguë dans un service d’accueil des urgences : un protocole d’essai randomisé contrôlé monocentrique
(OSLO – Effects of osteopathic manipulative therapy for acute nonspecific low back pain in emergency room: design of a randomised monocentric controlled trial)
Ginier-Gillet, M.
Unpublished MSc thesis, 2019/06
389

Der Einfluss einer viszeralen osteopathischen Behandlung auf das Bewegungsausmaß des straight leg raising tests am rechten und linken Bein beim akuten lateralen Bandscheibenvorfall
(The influence of visceral osteopathic treatment on the level of movement of the „straight leg raising tests“ on the left and right leg in case of an acute lateral herniated disc)
Akkoc, Ö.
Unpublished MSc thesis, 2019/05
Free full text
390

Manual therapy for musculoskeletal pain in cystic fibrosis: Review of the literature
Graziano, L., Giordani, B., Nico, D., Colella, E., Savi, D., Cimino, G., Di Vito, A., Valente, D., Palange, P.
Italian Journal of Pediatrics, 2019/04
391

The Impact of Spinal Manipulation on Migraine Pain and Disability: A Systematic Review and Meta-Analysis
Rist, P. M., Hernandez, A., Bernstein, C., Kowalski, M., Osypiuk, K., Vining, R., Long, C. R., Goertz, C., Song, R., Wayne, P. M.
Headache, 2019/04
Free full text
392

Osteopathic manipulative treatment in pudendal neuralgia: A case report
Origo, D., Tarantino, A. G.
Journal of Bodywork and Movement Therapies, 2019/04
393

Effects of Muscle Energy Technique and Neck Stabilization Exercise on Pain and Functional Disability, psychological status, sleep disturbance in Patients with Non-Specific Chronic Neck Pain
Zibiri, R. A., Akodu, A. K., Okafor, U. A. C.
Middle East Journal of Rehabilitation and Health Studies, 2019/04
394

Prevalence and profile of Australian osteopaths treating older people
Steel, A., Vaughan, B., Orrock, P., Peng, W., Fleischmann, M., Grace, S., Engel, R. M., Sibbritt, D., Adams, J.
Complementary Therapies in Medicine, 2019/04
395

Osteopathic Manipulative Treatment as a Novel Way to Manage Postvasectomy Pain Syndrome
Gray, R. E., Kasper, K.
The Journal of the American Osteopathic Association, 2019/04
Free full text
396

Rescued Root Canal: A Case Report on OMT for Jaw Pain Following Repeat Root Canal Procedure
Fong, K. F., Rummel, T. B.
The AAO Journal, 2019/03
Free full text
397

Effektivität von Osteopathie bei Patientinnen mit lumbalen Rückenschmerzen und/oder Beckengürtelschmerzen in der Schwangerschaft und Post Partum - systematic review
(The effectiveness of osteopathy for low back pain and pelvic girdle pain during and after pregnancy - a systematic review)
König, M.
Unpublished MSc thesis, 2019/03
Free full text
398

Benefits and harms of spinal manipulative therapy for the treatment of chronic low back pain: systematic review and meta-analysis of randomised controlled trials
Rubinstein, S. M., de Zoete, A., van Middelkoop, M., Assendelft, W. J. J., de Boer, M. R., van Tulder, M. W.
The BMJ, 2019/03
Free full text
399

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text
400

Sensitivity and specificity of the Neuropad for distal sensory peripheral neuropathy (DSPN) in subjects with HIV-Infection: A case controlled observational study
Laurin, K. L., Blanchard, P. D.
International Journal of Osteopathic Medicine, 2019/03
401

Effects of myofascial release in erector spinae myoelectric activity and lumbar spine kinematics in non-specific chronic low back pain: Randomized controlled trial
Arguisuelas, M. D., Lison, J. F., Domenech-Fernandez, J., Martinez-Hurtado, I., Salvador Coloma, P., Sanchez-Zuriaga, D.
Clinical Biomechanics, 2019/03
402

Short-term effectiveness of the flexion-distraction technique in comparison with high-velocity vertebral manipulation in patients suffering from low-back pain
Carrasco-Martínez, F., Ibáñez-Vera, A. J., Martínez-Amat, A., Hita-Contreras, F., Lomas-Vega, R.
Complementary Therapies in Medicine, 2019/03
403

Reflecting on new models for osteopathy – it's time for change
Smith, D.
International Journal of Osteopathic Medicine, 2019/03
404

Myofascial component of cancer pain review
Kalichman, L., Menahem, I., Treger, I.
Journal of Bodywork and Movement Therapies, 2019/02
405

Osteopathic Manipulative Treatment: A Primary Care Approach
Bodine, W. A.
American Family Physician, 2019/02
406

Manipulative Therapies: What Works
Smith, M. S., Olives, J., Smith, K.
American Family Physician, 2019/02
Free full text
407

The sacro-iliac joint: A potentially painful enigma. Update on the diagnosis and treatment of pain from micro-trauma
Le Huec, J. C., Tsoupras, A., Leglise, A., Heraudet, P., Celarier, G., Sturresson, B.
Orthopaedics & Traumatology: Surgery & Research, 2019/02
408

Evaluating Patient's Understanding of Pain Neurophysiology: Rasch Analysis of the Neurophysiology of Pain Questionnaire
Vaughan, B., Mulcahy, J., Fitzgerald, K., Austin, P.
The Clinical Journal of Pain, 2019/02
409

Immediate biomechanical, systemic, and interoceptive effects of myofascial release on the thoracic spine: A randomised controlled trial
Cathcart, E., McSweeney, T., Johnston, R., Young, H., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2019/01
410

Fascial manipulation vs. standard physical therapy practice for low back pain diagnoses: A pragmatic study
Harper, B., Steinbeck, L., Aron, A.
Journal of Bodywork and Movement Therapies, 2019/01
411

Effectiveness of Combined General Rehabilitation Gymnastics and Muscle Energy Techniques in Older Women with Chronic Low Back Pain
Wendt, M., Cieslik, K., Lewandowski, J., Waszak, M.
BioMed Research International, 2019/01
Free full text
412

Strain counter strain technique versus kinesio tape in treating patients with myofascial neck pain syndrome
Abdelfattah, A., Kattabei, O., Nasef, S.
Physiotherapy, 2019/01
413

Does muscle energy technique have an immediate benefit for women with pregnancy-related pelvic girdle pain?
Ceprnja, D., Gupta, A.
Physiotherapy Research International, 2019/01
414

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01
415

The role of soft tissue mobilization in reducing orofacial and general complaints in a patient with Kimmerle anomaly and temporomandibular joint disorder: A case report
Kuc, J., Szarejko, K. D., Aleksandrowicz, K., Golebiewska, M.
Cranio - Journal of Craniomandibular Practice, 2019/01
416

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text
417

Identification of prognostic factors and assessment methods on the evaluation of non-specific low back pain in a biopsychosocial environment: A scoping review
Draper-Rodi, J., Vogel, S., Bishop, A.
International Journal of Osteopathic Medicine, 2018/12
418

Controlled intervention to compare the efficacies of manual pressure release and the muscle energy technique for treating mechanical neck pain due to upper trapezius trigger points
Kashyap, R., Iqbal, A., Alghadir, A. H.
Journal of Pain Research, 2018/12
419

The beliefs and attitudes of UK registered osteopaths towards chronic pain and the management of chronic pain sufferers - A cross-sectional questionnaire based survey
Macdonald, R. J. D., Vaucher, P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/12
Free full text
420

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text
421

Funktionelle Therapie beim Morbus Sudeck („Complex Regional Pain Syndrome”, CRPS)
Functional therapy in Sudeck's disease (“Complex Regional Pain Syndrome“, CRPS)
Böger, A.
Osteopathische Medizin, 2018/12
422

Effect of Osteopathic Visceral Manipulation on Pain, Cervical Range of Motion, and Upper Trapezius Muscle Activity in Patients with Chronic Nonspecific Neck Pain and Functional Dyspepsia: A Randomized, Double-Blind, Placebo-Controlled Pilot Study
Silva, A. C. O., Biasotto-Gonzalez, D. A., Oliveira, F. H. M., Andrade, A. O., Gomes, Cafp, Lanza, F. C., Amorim, C. F., Politti, F.
Evidence-based Complementary and Alternative Medicine, 2018/11
Free full text
423

Die Auswirkungen der Atmung auf die maximale aktive Mundöffnung
(The breathing effect on maximal active mouth opening)
Schober, K.
Unpublished MSc thesis, 2018/11
Free full text
424

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text
425

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text
426

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
Journal of Osteopathic Medicine, 2018/11
427

An Osteopathic Approach to Leveraging Community Support for Prevention and Management of Chronic Disease in Rural and Appalachian Virginia
Slaymaker, K. A., Meacham, S., Horn, R., Goessl, C., Meisha, D., Mahaney, J.
Journal of Osteopathic Medicine, 2018/11
428

Eficácia da manipulação visceral osteopática em pacientes com constipação funcional e dor lombar crônica inespecífica: ensaio clínico placebo-controlado aleatorizado
(Effectiveness of osteopathic visceral manipulation in patients with functional constipation and non-specific chronic low back pain: randomized placebo-controlled clinical trial)
Fernandes, W. V. B.
Unpublished PhD thesis, 2018/10
Free full text
429

An Osteopathic Approach to Diagnosis and Management of Sacroiliac Joint Dysfunction
Glover, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/10
Free full text
430

Outpatient satisfaction with osteopathic manipulative treatment in a hospital center: A survey
Tramontano, M., Cinnera, A. M., Petracca, M., Gaeta, A., Tamburella, F., Audouard, M., Caltagirone, C.
Alternative Therapies in Health and Medicine, 2018/10
431

Is mulligan’s sustained natural apophyseal glides (Snags) or muscle energy technique is effective in the non-surgical management of cervicogenic headache? a two-group pretest-posttest randomized controlled trial
Veena Kirthika, S., Padmanabhan, K., Sudhakar, Selvaraj, Vijaya Kumar, M.
Asian Journal of Pharmaceutical and Clinical Research, 2018/10
Free full text
432

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text
433

(Effectiveness of osteopathic treatment in patients with chronic knee pain. A randomized controlled trial)
Weitendorff, A.
Unpublished D.O. thesis, 2018/10
434

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10
435

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text
436

Osteopathic Manipulative Treatment Including Specific Diaphragm Techniques Improves Pain and Disability in Chronic Nonspecific Low Back Pain: A Randomized Trial
Marti-Salvador, M., Hidalgo-Moreno, L., Domenech-Fernandez, J., Lison, J. F., Arguisuelas, M. D.
Archives of Physical Medicine and Rehabilitation, 2018/09
437

Effect of gong’s mobilisation versus muscle energy technique on pain and functional ability of shoulder in phase II adhesive capsulitis
Gopinath, Y., Seenivasan, S. K., Veeraraghavan, S. N. C., Viswanathan, R., Govindaraj, M. K.
Journal of Clinical and Diagnostic Research, 2018/09
438

Primary care physicians' attitude and reported prescribing behavior for chronic low back pain: An exploratory cross-sectional study
Rodondi, P. Y., Dubois, J., Bill, A. S., Koutaissoff, D., Ros, J., Aveni, E., Pasquier, J., Herzig, L., Decosterd, I., Burnand, B.
PLoS One, 2018/09
Free full text
439

Was ist Schmerzpsychotherapie?
(What is pain psychotherapy?)
Butz, M., Braun, C., Böger, A.
Osteopathische Medizin, 2018/09
440

University College of Osteopathy students' attitudes towards psychosocial risk factors and non-specific low back pain: A qualitative study
Delion, T. P. E., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2018/09
441

Effectiveness of an Osteopathic Abdominal Manual Intervention in Pain Thresholds, Lumbopelvic Mobility, and Posture in Women with Chronic Functional Constipation
Martinez-Ochoa, M. J., Fernandez-Dominguez, J. C., Morales-Asencio, J. M., Gonzalez-Iglesias, J., Ricard, F., Oliva-Pascual-Vaca, A.
The Journal of Alternative and Complementary Medicine, 2018/08
442

Medical Infrared Thermography in back pain osteopathic management
Polidori, G., Kinne, M., Mereu, T., Beaumont, F., Kinne, M.
Complementary Therapies in Medicine, 2018/08
443

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text
444

Behavioural activation and inhibition systems in relation to pain intensity and duration in a large chronic musculoskeletal pain sample
Sanson, N.
Unpublished MSc thesis, 2018/07
Free full text
445

Effect of HVLA on Chronic Neck Pain and Dysfunction
Cabahug, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text
446

Osteopathic Evaluation and Post-Surgical Rehabilitation Approach in a Patient With Myelopathy and Tetraparesis Related to Cervical Ependymoma: A Case Report
Lewis, D. D.
The AAO Journal, 2018/06
Free full text
447

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text
448

The attitudes and beliefs of UK osteopaths towards the management of low back pain: A cross-sectional study
Bar-Zaccay, A., Bailey, D.
International Journal of Osteopathic Medicine, 2018/06
449

Osteopathic manipulative treatment for post mastectomy pain: A case report
Downey, H. F.
International Journal of Osteopathic Medicine, 2018/06
450

The Lancet Low Back pain series: A call to action for osteopathy?
Fitzgerald, K., Vaughan, B., Austin, P., Grace, S., Orchard, D., Orrock, P.l, Fleischmann, M.
International Journal of Osteopathic Medicine, 2018/06
451

Leistenschmerzen aus Sicht des Hernienchirurgen
(Inguinal pain from the point of view of the hernia surgeon)
Kuthe, A.
Osteopathische Medizin, 2018/05
452

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05
453

Myofascial Release Therapy Beneficial for Patients With Chronic Low Back Pain
Jazayeri, S., Seffinger, M.
The Journal of the American Osteopathic Association, 2018/05
Free full text
454

Effectiveness of muscle energy technique on cervical range of motion and pain
Jalal, Y., Ahmad, A., Rahman, A. U., Daud, M.
Journal of the Pakistan Medical Association, 2018/05
Free full text
455

Manipulation and mobilization for treating chronic low back pain: a systematic review and meta-analysis
Coulter, I. D., Crawford, C., Hurwitz, E. L., Vernon, H., Khorsan, R., Suttorp Booth, M., Herman, P. M.
The Spine Journal, 2018/05
Free full text
456

The perceptions and experiences of osteopathic treatment among cancer patients in palliative care: a qualitative study
Steel, A., Tricou, C., Monsarrat, T., Ruer, M., Deslandes, C., Sisoix, C., Filbet, M.
Supportive Care in Cancer, 2018/05
457

Lokale klinische Diagnostik bei Leistenschmerzen
(Local clinical diagnosis of inguinal pain)
Dobler, T. K.
Osteopathische Medizin, 2018/05
458

Knieschmerz und fazilitierte Positionierung in Anlehnung an L.H. Jones
(Knee pain and facilitated positioning in the style of L.H. Jones)
Heidrich, M., Buchmann, J., Röper-Krejza, B.
Osteopathische Medizin, 2018/05
459

Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text
460

Neck-stomach syndrome in the cervical spondylosis: An update on preliminary 2017 data
Ramieri, A., Miscusi, M., Costanzo, G.
European Spine Journal, 2018/04
461

Effect of muscle energy technique with and without strain-counterstrain technique in acute low back pain - A randomized clinical trial
Patel, V. D., Eapen, C., Ceepee, Z., Kamath, R.
Hong Kong Physiotherapy Journal, 2018/04
Free full text
462

Osteopathic manipulative treatment in chronic coccydynia: A case series
Origo, D., Tarantino, A. G., Nonis, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2018/04
463

Profile of osteopathic practice in Spain: Results from a standardized data collection study
Alvarez Bustins, G., López Plaza, P. V., Carvajal, S. R.
BMC Complementary and Alternative Medicine, 2018/04
Free full text
464

An investigation of attitudes and underlying beliefs toward low back pain among osteopathy students using the Back Pain Attitudes Questionnaire (Back-PAQ)
Hilbink, H.
Unpublished MSc thesis, 2018/04
Free full text
465

Effectiveness of 2 Osteopathic Treatment Approaches on Pain, Pressure-Pain Threshold, and Disease Severity in Patients with Fibromyalgia: A Randomized Controlled Trial
Albers, J., Jäkel, A., Wellmann, K., von Hehn, U., Schmidt, T.
Complementary medicine research, 2018/04
466

Shaping conservative spinal services with the Spine Tango Registry
Morris, S., Booth, J.
European spine journal, 2018/03
467

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
468

OMT for Patients With Sacral Somatic Dysfunction
Yu, K., Pfotenhauer, K., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/03
Free full text
469

Prevention and treatment of low back pain: evidence, challenges, and promising directions
Foster, N. E., Anema, J. R., Cherkin, D., Chou, R., Cohen, S. P., Gross, D. P., Ferreira, P. H., Fritz, J. M., Koes, B. W., Peul, W., Turner, J. A., Maher, C. G.
The Lancet, 2018/03
470

‘I just don't have the tools’ - Italian osteopaths' attitudes and beliefs about the management of patients with chronic pain: A qualitative study
Formica, A., Thomson, O. P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/03
Free full text
471

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text
472

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text
473

Assessment of cervical stiffness in axial rotation among chronic neck pain patients: A trial in the framework of a non-manipulative osteopathic management
Dugailly, P. M., Coucke, A., Salem, W., Feipel, V.
Clinical Biomechanics, 2018/03
474

Effektivität der osteopathischen Behandlung bei Patienten mit chronischem Knieschmerz, eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with chronic knee pain, a randomized controlled study)
Weitendorff, A.
Unpublished MSc thesis, 2018/03
475

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03
476

The effects of osteopathic treatment on psychosocial factors in people with persistent pain: A systematic review
Saracutu, M., Rance, J., Davies, H., Edwards, D. J.
International Journal of Osteopathic Medicine, 2018/03
477

Osteopathie bei Rücken- und Beckengürtelschmerzen während und nach der Schwangerschaft
(Osteopathy in low back pain and pelvic girdle pain during and after pregnancy: Systematic review and meta-analysis)
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Osteopathische Medizin, 2018/03
478

Einfluss postoperativer Adhäsionen nach Sektio auf chronischen Low Back Pain - eine Pilotstudie
(Influence of postoperative adhesion after caesarean section on chronic lower back pain - a pilot study)
Liedler, M.
Unpublished MSc thesis, 2018/02
Free full text
479

Chronic Pain Management: Perspective of an Osteopathic Medical Student in New Mexico
Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text
480

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text
481

An evaluation of osteopathic treatment on psychological outcomes with patients suffering from chronic pain: A prospective observational cohort study collected through a health and well-being academy
Edwards, D. J., Toutt, C.
Health Psychology Open, 2018/01
Free full text
482

The Validity and Reliability of Provocation Tests in the Diagnosis of Sacroiliac Joint Dysfunction
Telli, H., Telli, S., Topal, M.
Pain Physician, 2018/01
Free full text
483

Vorderer Knieschmerz und Beckendysfunktion
(Anterior knee pain and pelvic dysfunction)
Liedtke, H.
Osteopathische Medizin, 2017/12
484

Use of pressure dynamometer in the assessment of the pressure pain threshold in trigger points in the craniocervical muscles in women with unilateral migraine and tension-type headache: An observational study
Pires, R., da Rocha, N. S., Esteves, J. E., Rodrigues, M. E.
International Journal of Osteopathic Medicine, 2017/12
485

Let's get physical!
Hickner, J.
The Journal of Family Practice, 2017/12
486

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text
487

Osteopathic Manipulative Treatment for the Management of Adjacent Segment Pathology
Lewis, D. D., Summers, G. K.
The Journal of the American Osteopathic Association, 2017/12
Free full text
488

Investigation of four self-report instruments (FABT, TSK-HC, Back-PAQ, HC-PAIRS) to measure healthcare practitioners' attitudes and beliefs toward low back pain: Reliability, convergent validity and survey of New Zealand osteopaths and manipulative physiotherapists
Moran, R. W., Rushworth, W. M., Mason, J.
Musculoskeletal Science and Practice, 2017/12
489

What are the risks of manual treatment of the spine? A scoping review for clinicians
Swait, G., Finch, R.
Chiropractic & Manual Therapies, 2017/12
Free full text
490

Developing a new approach to persistent pain management in osteopathic practice. Stage 1: A feasibility study for a group course
Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/12
491

Welchen Einfluss haben osteopathische Behandlungen auf die erlebte Schmerzintensität bei Kindern und Jugendlichen mit nichtklassifizierbaren Spannungskopfschmerzen?
(Which effect do osteopathic treatments have on the intensity of pain in children with non-classified tension headaches?)
Ginsberg, I., Noël, B.
unpublished D.O. thesis, 2017/12
Free full text
492

Current Clinical Status of Osteopathy: Study Based on Retrospective Evidences of Six Years, A Systemic Review
Ahmad, R.
Annual Research & Review in Biology, 2017/11
Free full text
493

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10
494

Manipulative scar treatment and ostheopatic manipulative treatment for pain, shoulder motion and quality of life in post-mastectomy pain syndrome (PMPS). A randomized clinical trial
Figini, D., Seghini, P., Bidin, L.
Annals of Oncology, 2017/10
495

Osteopathic management of chronic constipation in women patients. Results of a pilot study
Belvaux, A., Bouchoucha, M., Benamouzig, R.
Clinics and Research in Hepatology and Gastroenterology, 2017/10
496

Untersuchung der Effektivität von osteopathischen Behandlungen zusätzlich zur Standardtherapie bei Jugendlichen mit unspezifischen Kreuzschmerzen. Randomisierte kontrollierte Studie.
(Evaluation of effectiveness of osteopathic treatment in addition to standard therapy in adolescents with unspecific low lack pain (LBP). A randomized controlled trial)
Ringeisen, P.
Unpublished D.O. thesis, 2017/10
497

Osteopathische Behandlung von Patienten mit Impingement-Syndrom der Schulter. Prä-Post-Studie.
(Effectiveness of individual osteopathic treatment in patients with shoulder outlet impingement. A pre-post study)
Tallo, F.
Unpublished D.O. thesis, 2017/10
498

Developing an evidence base for osteopathic healthcare: an exploration of osteopathic healthcare to inform the design of an appropriate methodology to investigate its effectiveness
Orrock, P. J.
Unpublished PhD thesis, 2017/10
Free full text
499

Randomised controlled pilot trial of high-velocity, low-amplitude manipulation on cervical and upper thoracic spine levels in asymptomatic subjects
Galindez-Ibarbengoetxea, X., Setuain, I., González-Izal, M., Jauregi, A., Ramírez-Velez, R., Andersen, L. L., Izquierdo, M.
International Journal of Osteopathic Medicine, 2017/09/01/
500

Osteopathic Manipulative Treatment for Chronic Neck Pain, Headaches, and Referred Pain in a Patient With Myofascial Pain Syndrome: A Case Report
Lewis, D. D.
The AAO Journal, 2017/09
Free full text
501

The Use of Osteopathic Manual Therapy and Rehabilitation for Subacromial Impingement Syndrome: A Case Report
Bennett, S., Macfarlane, C., Vaughan, B.
Explore (NY), 2017/09
502

Effects of Cervical High-Velocity Low-Amplitude Techniques on Range of Motion, Strength Performance, and Cardiovascular Outcomes: A Review
Galindez-Ibarbengoetxea, X., Setuain, I., Andersen, L. L., Ramírez-Velez, R., González-Izal, M., Jauregi, A., Izquierdo, M.
The Journal of Alternative and Complementary Medicine, 2017/09
503

Acupuncture Meridian-Based Myofascial Release to Treat Knee Pain in Sinding-Larsen–Johansson Syndrome: A Case Report
Valvano, K. D., Sina, R. E.
The AAO Journal, 2017/09
Free full text
504

Entzündlicher Rückenschmerz – sind Warnsignallisten verlässlich?
(Inflammatory back pain - Are lists of warning signals reliable?)
Polivka, J. S.
Osteopathische Medizin, 2017/09
505

The effectiveness of osteopathic manipulative treatment in an abnormal uterine bleeding related pain and health related quality of life (HR-QoL) - A case report
Goyal, K., Goyal, M., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S., Arumugam, N.
Journal of Bodywork and Movement Therapies, 2017/07
506

Osteopathic approach to treating a patient with new onset low back pain following injury reveals unusual presentation of bilateral and symmetric symptoms: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/07
507

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text
508

Effects of Osteopathic Manipulative Therapy on Pain and Mood Disorders in Patients With High-Frequency Migraine
D'Ippolito, M., Tramontano, M., Buzzi, M. G.
The Journal of the American Osteopathic Association, 2017/06
Free full text
509

Osteopathic manipulative treatment in soccer players with chronic groin pain: a pilot study
Nolli, L., Baraggiolo, S., PaganiI, M, Origo, D., Bergna, A., Vismara, L.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2017/06
510

Osteopathie bei Low Back Pain in der Schwangerschaft – eine Fallstudie
(Osteopathy in low back pain during pregnancy - A case study)
Schreiber, C.
Osteopathische Medizin, 2017/06
511

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06
512

A systematic review of randomised controlled trials using Acceptance and commitment therapy as an intervention in the management of non-malignant, chronic pain in adults
Simpson, P. A., Mars, T., Esteves, J. E.
International Journal of Osteopathic Medicine, 2017/06
513

‘Talking a different language’: a qualitative study of chronic low back pain patients' interpretation of the language used by student osteopaths
Thomson, O. P., Collyer, K.
International Journal of Osteopathic Medicine, 2017/06
514

The effect of visceral osteopathic manual therapy applications on pain, quality of life and function in patients with chronic nonspecific low back pain
Tamer, S., Öz, M., Ülger, O.
Journal of Back and Musculoskeletal Rehabilitation, 2017/05
515

An Osteopathic Approach to Chronic Pain Management
Jerome, J. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text
516

Addition of Osteopathic Visceral Manipulation to OMT for Low Back Pain Decreases Pain and Increases Quality of Life
King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
517

Clinical classification in low back pain: best-evidence diagnostic rules based on systematic reviews
Petersen, T., Laslett, M., Juhl, C.
BMC Musculoskeletal Disorders, 2017/05
Free full text
518

Association of Spinal Manipulative Therapy With Clinical Benefit and Harm for Acute Low Back Pain: Systematic Review and Meta-analysis
Paige, N. M., Miake-Lye, I. M., Booth, M. S., Beroes, J. M., Mardian, A. S., Dougherty, P., Branson, R., Tang, B., Morton, S. C., Shekelle, P. G.
JAMA, 2017/04
Free full text
519

Preliminary evidence of Regional Interdependent Inhibition, using a 'Diaphragm Release' to specifically induce an immediate hypoalgesic effect in the cervical spine
McCoss, C. A., Johnston, R., Edwards, D. J., Millward, C.
Journal of Bodywork and Movement Therapies, 2017/04
520

Das chronische Beckenschmerzsyndrom : Hilfe durch Osteopathie.
(Chronic pelvic pain syndrome : Treatment options using osteopathy)
Marx, S.
Der Urologe, 2017/04
521

A mixed methods evaluation of a third wave cognitive behavioural therapy and osteopathic treatment programme for chronic pain in primary care (OsteoMAP)
Carnes, D., Mars, T., Plunkett, A., Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/03
522

Rehabilitation treatment for chronic lower back pain: New evidence for old methods? A randomized, controlled experimental trial
Rigoni, S., Scapin, M.
Minerva Ortopedica e Traumatologica, 2017/03
523

Osteopathy for primary headache patients: a systematic review
Cerritelli, F., Lacorte, E., Ruffini, N., Vanacore, N.
Journal of Pain Research, 2017/03
Free full text
524

Burnout: Worauf Sie bei Ihren Patienten achten sollten
(Burnout: What you should pay attention to in your patients)
Krautz, B.
Osteopathische Medizin, 2017/02
525

Quiet dissent: The attitudes, beliefs and behaviours of UK osteopaths who reject low back pain guidance - A qualitative study
Figg-Latham, J., Rajendran, D.
Musculoskeletal Science and Practice, 2017/02
526

Osteopathische Behandlung chronischer unspezifischer Nackenschmerzen
(Osteopathic treatment of chronic nonspecific neck pain)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2017/02
527

Developing an integrated osteopathy and acceptance-informed pain management course for patients with persistent pain
Abbey, H. A.
Unpublished PhD thesis, 2017/01
Free full text
528

Knee Pain in Adults with an Osteopathic Component
Datta, R., Burina, L., Romanelli, F., Flaum, T. B.
Osteopathic Family Physician, 2017/01
Free full text
529

Nationale VersorgungsLeitlinie Nicht-spezifischer Kreuzschmerz – Langfassung
(National Guideline for non-specific back pain)
Bundesärztekammer (BÄK), Kassenärztliche Bundesvereinigung (KBV), Arbeitsgemeinschaft der Wissenschaftli-, (AWMF).
, 2017
Free full text
530

Osteopathic Manipulative Treatment of Primary Dysmenorrhea and Related Factors: A Randomized Controlled Trial
Zecchillo, D., Acquati, A., Aquino, A., Pisa, V., Uberti, S., Ratti, S.
International Journal of Medical Research & Health Sciences, 2017
Free full text
531

Osteopathische Behandlung des Reizdarmsyndroms – ein Review
(Osteopathic treatment of irritable bowel syndrome - A review)
Krüger, S.
Osteopathische Medizin, 2016/12
532

Relationship Between Falls and Complementary and Alternative Medicine Use Among Community-Dwelling Older Adults
Caron, A., Gallo, W. T., Durbin, L. L., Mielenz, T. J.
The Journal of Alternative and Complementary Medicine, 2016/12
533

Effectiveness of osteopathic manipulative treatment versus osteopathy in the cranial field in temporomandibular disorders - a pilot study
Gesslbauer, C., Vavti, N., Keilani, M., Mickel, M., Crevenna, R.
Disability and Rehabilitation, 2016/12
534

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: The PROMOTE Study Protocol
Hensel, K. L., Carnes, M. S., Stoll, S. T.
The Journal of the American Osteopathic Association, 2016/11
Free full text
535

PROMOTE Study: Safety of Osteopathic Manipulative Treatment During the Third Trimester by Labor and Delivery Outcomes
Hensel, K. L., Roane, B. M., Chaphekar, A. V., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2016/11
Free full text
536

Effects of osteopathic treatment on pulmonary function and chronic thoracic pain after coronary artery bypass graft surgery (OstinCaRe): study protocol for a randomised controlled trial
Roncada, G.
BMC Complementary and Alternative Medicine, 2016/11
Free full text
537

A model for radiating leg pain of endometriosis
Bove, G. M.
Journal of Bodywork and Movement Therapies, 2016/10
538

Exploring Ambulance Officers' experiences of chronic low back pain and its treatment
Mohammad, S. B.
Unpublished MSc thesis, 2016/10
539

Osteopathische Imagination – ein Weg zur osteopathischen Selbstbehandlung
(Osteopathic Imagination - A way to osteopathic self-treatment)
Liedtke, H.
Osteopathische Medizin, 2016/09
540

The Attitudes of Physicians, Nurses, Physical Therapists, and Midwives Toward Complementary Medicine for Chronic Pain: A Survey at an Academic Hospital
Aveni, E., Bauer, B., Ramelet, A. S., Kottelat, Y., Decosterd, I., Finti, G., Ballabeni, P., Bonvin, E., Rodondi, P. Y.
Explore (NY), 2016/09
541

Lumbalgie bei Uterusdeszensus
(Low back pain in uterine descent)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
542

Osteopathic Manipulative Therapy for Preterm Infants, Acupuncture for Menopausal Symptoms, Mindfulness-Based Stress Reduction for Chronic Low Back Pain, Chocolate for Ischemic Heart Disease, Berberine for Irritable Bowel Syndrome
Pettit, J., Glickman-Simon, R.
Explore (NY), 2016/09
543

The Incidence of Somatic Dysfunction in Patients with Sudden Onset Atraumatic Neck Pain: A Retrospective Case Note Study
Snider, K. T., Ghouse, A., He, S. S., Pazdernik, V. K.
The AAO Journal, 2016/09
544

Osteopathy for Endometriosis and Chronic Pelvic Pain - a Pilot Study
Sillem, M., Juhasz-Boss, I., Klausmeier, I., Mechsner, S., Siedentopf, F., Solomayer, E.
Geburtshilfe Frauenheilkunde, 2016/09
545

R18 - Osteopathy for Post-Mastectomy Pain Syndrome (PMPS) in early breast cancer (EBC) patients: a pilot study in an Italian Oncology Unit
Putignano, F., Bidin, L., Belfiglio, B., Bordoni, F., Seghini, P., Cavanna, L.
Annals of Oncology, 2016/09
546

Effectiveness of neural mobilization with intermittent cervical traction in the management of cervical radiculopathy: A randomized controlled trial
Savva, C., Giakas, G., Efstathiou, M., Karagiannis, C., Mamais, I.
International Journal of Osteopathic Medicine, 2016/09
547

Benefits of Craniosacral Therapy in Patients with Chronic Low Back Pain: A Randomized Controlled Trial
Castro-Sánchez, A. M., Lara-Palomo, I. C., Matarán-Peñarrocha, G. A., Saavedra-Hernández, M., Pérez-Mármol, J. M., Aguilar-Ferrándiz, M. E.
The Journal of Alternative and Complementary Medicine, 2016/08
548

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text
549

The effectiveness of complementary manual therapies for pregnancy-related back and pelvic pain A systematic review with meta-analysis
Hall, H., Cramer, H., Sundberg, T., Ward, L., Adams, J., Moore, C., Sibbritt, D., Lauche, R.
Medicine (Baltimore), 2016/08
Free full text
550

Effects of an e-learning programme on osteopaths’ back pain attitudes: a mixed methods feasibility study
Draper-Rodi, J.
Unpublished PhD thesis, 2016/07
Free full text
551

HVLA or Stretch May Not Be Necessary for Nonspecific Back or Neck Pain Relief
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2016/07
Free full text
552

Exploration of clinical changes following a novel mobilisation technique for treatment of chronic low back pain: A single cohort design
Hanson, G. C., Jones, B., Bacon, C. J., Moran, R. W.
Journal of Bodywork and Movement Therapies, 2016/07
553

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text
554

Wirbeldrehen mit modifizierter Becker-Technik
(Vertebra twisting with modified Becker technique)
Liedtke, H.
Osteopathische Medizin, 2016/06
555

Use of Orthotics to Treat Persistent Low Back Pain After Left Sacroiliac Joint Fixation: A Case Report
Lipton, J. A., Granja Vasquez, J. A.
The AAO Journal, 2016/06
556

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06
557

Beliefs about back pain: The confluence of client, clinician and community
Darlow, B.
International Journal of Osteopathic Medicine, 2016/06
558

Muscle energy technique for non-specific low-back pain. A Cochrane systematic review
Franke, H., Fryer, G., Ostelo, R. W. J. G., Kamper, S. J.
International Journal of Osteopathic Medicine, 2016/06
559

Osteopatia e lombalgia
(Osteopathy and low back pain)
de Oliveira Meirelles, F.
Unpublished MSc thesis, 2016/06
Free full text
560

Non-specific mechanisms in orthodox and CAM management of low back pain (MOCAM): theoretical framework and protocol for a prospective cohort study
Bradbury, K., Al-Abbadey, M., Carnes, D., Dimitrov, B. D., Eardley, S., Fawkes, C., Foster, J., Greville-Harris, M., Harvey, J. M., Leach, J., Lewith, G., MacPherson, H., Roberts, L., Parry, L., Yardley, L., Bishop, F. L.
BMJ Open, 2016/05
561

Craniosacral therapy for the treatment of chronic neck pain: A randomized sham-controlled trial
Haller, H., Lauche, R., Cramer, H., Rampp, T., Saha, F. J., Ostermann, T., Dobos, G.
The Clinical Journal of Pain, 2016/05
Free full text
562

Effect of muscle energy technique and static stretching on pain and functional disability in patients with mechanical neck pain: A randomized controlled trial
Phadke, A., Bedekar, N., Shyam, A., Sancheti, P.
Hong Kong Physiotherapy Journal, 2016/04
Free full text
563

The patient experience of osteopathic healthcare
Orrock, P. J.
Manual Therapy, 2016/04
564

The Use of Osteopathic Manipulative Treatment for Acute Dental Pain: A Case Report
Snider, K. T.
The AAO Journal, 2016/03
565

Targeting Patient Subgroups With Chronic Low Back Pain for Osteopathic Manipulative Treatment: Responder Analyses From a Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
566

Recovery From Chronic Low Back Pain After Osteopathic Manipulative Treatment: A Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
567

Resolution of New Daily Persistent Headache After Osteopathic Manipulative Treatment
Alexander, J.
The Journal of the American Osteopathic Association, 2016/03
Free full text
568

Osteopaths' clinical reasoning during consultation with patients experiencing acute low back pain: A qualitative case study approach
Roots, S. A., Niven, E., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/03
569

Klinische Effektivität einer osteopathischen Behandlung bei Migräne
(Clinical effectiveness of osteopathic treatment for migraines)
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Osteopathische Medizin, 2016/03
570

Patients' experiences of living with persistent back pain
van Griensven, Hubert
International Journal of Osteopathic Medicine, 2016/03
571

The effect of the combination of dry needling and MET on latent trigger point upper trapezius in females
Yeganeh Lari, A., Okhovatian, F., Naimi, Ss, Baghban, A. A.
Manual Therapy, 2016/02
572

Prevalence and characteristics of women who consult with osteopathic practitioners during pregnancy; a report from the Australian Longitudinal Study on Women's Health (ALSWH)
Frawley, J., Sundberg, T., Steel, A., Sibbritt, D., Broom, A., Adams, J.
Journal of Bodywork and Movement Therapies, 2016/01
573

Lumbosakrale Schmerzen und Miktionsbeschwerden bei benignem Prostatasyndrom (BPS)
(Lumbosacral pain and micturition symptoms in benign prostatic hyperplasia (BPH))
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
574

Muscle energy technique improves chronic lateral epicondylitis
Koh, C., III, Seffinger
The Journal of the American Osteopathic Association, 2016/01
Free full text
575

Osteopathische Behandlung der Symphysensprengung – ein Fallbeispiel
(Osteopathic treatment of symphyseal disruption - A case study)
Past, A.
Osteopathische Medizin, 2015/12
576

Osteopathic manipulative treatment for chronic nonspecific neck pain: A systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
International Journal of Osteopathic Medicine, 2015/12
577

Intra-oral osteopathic technique for chronic temporomandibular disorders
Frederikson, H.
Unpublished MSc thesis, 2015/12
Free full text
578

2015 Updated Method Guideline for Systematic Reviews in the Cochrane Back and Neck Group
Furlan, A. D., Malmivaara, A., Chou, R., Maher, C. G., Deyo, R. A., Schoene, M., Bronfort, G., van Tulder, M. W.
Spine (Phila Pa 1976), 2015/11
579

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text
580

Analysis of provider specialties in the treatment of patients with clinically diagnosed back and joint problems
Wilson, F. A., Licciardone, J. C., Kearns, C. M., Akuoko, M.
Journal of Evaluation in Clinical Practice, 2015/10
581

Dysfunction in a Patient With Acute Knee Pain and Osteoarthritis: A Case Report
T., Snider. K.
The AAO Journal, 2015/09
582

Impact of McKenzie Method Therapy Enriched by Muscular Energy Techniques on Subjective and Objective Parameters Related to Spine Function in Patients with Chronic Low Back Pain
Szulc, P., Wendt, M., Waszak, M., Tomczak, M., Cieslik, K., Trzaska, T.
Medical Science Monitor, 2015/09
Free full text
583

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09
584

Interventions for preventing and treating low-back and pelvic pain during pregnancy
Liddle, S. D., Pennick, V.
Cochrane Database of Systematic Reviews, 2015/09
Free full text
585

Effectiveness of physical and rehabilitation techniques in reducing pain in chronic trapezius myalgia: A systematic review and meta-analysis
Nunes, A. M. P., Moita, J. P. A. M.
International Journal of Osteopathic Medicine, 2015/09
586

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text
587

Immediate changes in electroencephalography activity in individuals with nonspecific chronic low back pain after cranial osteopathic manipulative treatment: study protocol of a randomized, controlled crossover trial
Martins, W. R., Diniz, L. R., Blasczyk, J. C., Lagoa, K. F., Thomaz, S., Rodrigues, M. E., de Oliveira, R. J., Bonini-Rocha, A. C.
BMC Complementary and Alternative Medicine, 2015/07
Free full text
588

Can a light touch sham therapy be effective in cranial osteopathic manipulative medicine research?
King, H. H.
The Journal of the American Osteopathic Association, 2015/06
Free full text
589

Osteopathie als alternative Therapie bei Reizmagen – eine Pilotstudie
(Osteopathy as an alternative therapy for dyspepsia - A pilot study)
Elsing, C.
Osteopathische Medizin, 2015/06
590

Kritische Betrachtung einer Besprechung
(Critical consideration of a critique)
Franke, H., Franke, J.D., Fryer, G.
Manuelle Medizin, 2015/05
591

Clinical effectiveness of osteopathic treatment in chronic migraine: 3-Armed randomized controlled trial
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Complementary Therapies in Medicine, 2015/04
592

Osteopathische Behandlung der Entrapmentneuropathie des Nervus axillaris
(Osteopathic treatment of entrapment neuropathy of the axillary nerve)
Lefelmann, A.K.
Osteopathische Medizin, 2015/03
593

Day-to-day practice of osteopaths using osteopathy in the cranial field, who are affiliated with the Sutherland Cranial College of Osteopathy (SCCO): A national survey by means of a standardised data collection tool
Wilkinson, J., Thomas, K. J., Freeman, J. V., McKenna, B.
International Journal of Osteopathic Medicine, 2015/03
594

(Complementary notes to the article: “Osteopathic treatment for non-specific back pain“.)
listed, No authors
Osteopathische Medizin, 2015/03
595

Application of osteopathic manipulative technique in the treatment of back pain during pregnancy
Majchrzycki, M., Wolski, H., Seremak-Mrozikiewicz, A., Lipiec, J., Marszalek, S., Mrozikiewicz, P. M., Klejewski, A., Lisinski, P.
Ginekologia Polska, 2015/03
596

Investigation of instruments measuring healthcare practitioners’ attitudes and beliefs toward low back pain: psychometric properties and survey of New Zealand osteopaths and manipulative physiotherapists
Rushworth, W.
Unpublished MSc thesis, 2015/03
Free full text
597

Nervus-axillaris-Läsion als mögliche Ursache für Beschwerden in der Schulterregion
(Axillary nerve lesion as possible cause of symptoms in the shoulder region)
Beck, M.
Osteopathische Medizin, 2015/03
598

Interoception, body awareness and chronic pain: Results from a case–control study
Ribera d'Alcalà, C., Webster, D. G., Esteves, J. E.
International Journal of Osteopathic Medicine, 2015/03
599

Osteopathische Behandlung bei unspezifischen Rückenschmerzen – Literaturübersicht und Metaanalyse
(Osteopathic treatment for unspecific low back pain - systematic review and meta analysis)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2015/03
600

Osteopatia como meio terapêutico nas disfunções temporomandibulares e dores orofaciais
(Osteopathy as a therapeutic tool in temporomandibular disorders and orofacial pain)
Ferreira, L. T.
Unpublished MSc thesis, 2015/02
Free full text
601

Muscle energy technique for non-specific low-back pain
Franke, H., Fryer, G., Ostelo, R. W., Kamper, S. J.
Cochrane Database of Systematic Reviews, 2015/02
602

Pain: Alternative to a Narco-Epidemic
Moreau, M.
Unpublished Dissertation, 2015/01
603

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: the PROMOTE study
Hensel, K. L., Buchanan, S., Brown, S. K., Rodriguez, M., Cruser d, A.
American Journal of Obstetrics & Gynecology, 2015/01
Free full text
604

Clinical response and relapse in patients with chronic low back pain following osteopathic manual treatment: results from the OSTEOPATHIC Trial
Licciardone, J. C., Aryal, S.
Manual Therapy, 2014/12
Free full text
605

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12
606

Credibility of a comparative sham control intervention for craniosacral therapy in patients with chronic neck pain
Haller, H., Ostermann, T., Lauche, R., Cramer, H., Dobos, G.
Complementary Therapies in Medicine, 2014/12
607

‘I am afraid to make the damage worse’ – Fear of engaging in physical activity among patients with neck or back pain
Thomson, O.
International Journal of Osteopathic Medicine, 2014/12
608

Piriformis Syndrome: A Case Study
Lee, J. M., McCaffrey, K.
The AAO Journal, 2014/11
Free full text
609

Does the addition of visceral manipulation alter outcomes for patients with low back pain? A randomized placebo controlled trial
Panagopoulos, J., Hancock, M. J., Ferreira, P., Hush, J., Petocz, P.
European Journal of Pain, 2014/11
610

Przydatność terapii czaszkowo-krzyżowej w leczeniu chorych z niespecyficznymi bólami dolnego odcinka kręgosłupa. Doniesienie wstępne
Utility of craniosacral therapy in treatment of patients with non-specific low back pain. Preliminary report
Bialoszewski, D., Bebelski, M., Lewandowska, M., Slupik, A.
Ortopedia, Traumatologia, Rehabilitacja, 2014/11
611

Observational study fails to demonstrate the effectiveness of OMT in decreasing low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text
612

La osteopatía como instrumento de reducción de costes en el sistema sanitario español
(Osteopathy as a cost reduction tool in the Spanish healthcare system)
Ponce, D.
Unpublished PhD thesis, 2014/10
Free full text
613

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with persistent non-specific low back pain after childbirth. A randomized controlled trial)
Belz, S.
Unpublished MSc thesis, 2014/10
Free full text
614

Response to letter to the editor
Bolino, G., Mangiulli, T.
Medicine, Science and the Law, 2014/10
Free full text
615

Osteopathische Behandlung von Schwangeren mit Rückenschmerzen. Randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in pregnant women suffering from low back pain (LBP). A randomized controlled trial)
Röhrich, K.
Unpublished D.O. thesis, 2014/10
616

Onset of complications following cervical manipulation due to malpractice in osteopathic treatment: a case report
Cicconi, M., Mangiulli, T., Bolino, G.
Medicine, Science and the Law, 2014/10
617

Valuable information about current clinical practice
Vaughan, B., Thomson, O.
Medicine, Science and the Law, 2014/10
Free full text
618

Effekt von Lebermobilisation
(Effects of liver mobilization)
March, S.
Unpublished MSc thesis, 2014/10
Free full text
619

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in women with persistent non specific low back pain after childbirth. A randomized controlled trial)
Belz, S., Brix, K.
Unpublished D.O. thesis, 2014/10
620

Response to commentary on: A systematic review investigating complementary and alternative medicine in the management of low back and/or pelvic pain in pregnancy
Close, C., Sinclair, M., Liddle, D.
Journal of Advanced Nursing, 2014/10
621

Commentary on: Close et al. (2014) A systematic review investigating the effectiveness of Complementary and Alternative Medicine (CAM) for the management of low back and/or pelvic pain in pregnancy
Ernst, E.
Journal of Advanced Nursing, 2014/10
622

Spinal manipulation results in specific effects on pain sensitivity associated with altered central nociceptive processing in chronic low back pain
Rickards, L. D.
International Journal of Osteopathic Medicine, 2014/09/01/
623

Pilot trial of osteopathic manipulative therapy for patients with frequent episodic tension-type headache
Rolle, G., Tremolizzo, L., Somalvico, F., Ferrarese, C., Bressan, L. C.
The Journal of the American Osteopathic Association, 2014/09
Free full text
624

Effectiveness of myofascial release in the management of plantar heel pain; A randomised controlled trial
Walker, S.
International Journal of Osteopathic Medicine, 2014/09
625

Type of technique used on dorsal spine makes no difference to neck outcomes
Zegarra-Parrodi, R.
International Journal of Osteopathic Medicine, 2014/09
626

Osteopathie bei chronischen unteren Rückenschmerzen aus Sicht der PatientInnen. Eine qualitative Studie
(The patient's view on osteopathic treatment of chronic low back pain. A qualitative study)
Brenner, F.
Unpublished MSc thesis, 2014/09
Free full text
627

Primary reasons for osteopathic consultation: a prospective survey in Quebec
Morin, C., Aubin, A.
PLoS One, 2014/09
Free full text
628

Changes in biomechanical dysfunction and low back pain reduction with osteopathic manual treatment: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Crow, W. T.
Manual Therapy, 2014/08
Free full text
629

Osteopathic manipulative treatment for nonspecific low back pain: a systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
BMC Musculoskeletal Disorders, 2014/08
Free full text
630

A systematic review investigating the effectiveness of Complementary and Alternative Medicine (CAM) for the management of low back and/or pelvic pain (LBPP) in pregnancy
Close, C., Sinclair, M., Liddle, S. D., Madden, E., McCullough, J. E., Hughes, C.
Journal of Advanced Nursing, 2014/08
Free full text
631

Cost-effectiveness of manual therapy for the management of musculoskeletal conditions: a systematic review and narrative synthesis of evidence from randomized controlled trials
Tsertsvadze, A., Clar, C., Court, R., Clarke, A., Mistry, H., Sutcliffe, P.
Journal of Manipulative and Physiological Therapeutics, 2014/07
Free full text
632

Response: observational study demonstrates that OMT is associated with reduced analgesic prescribing and fewer missed work days
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text
633

Impact of osteopathic treatment on pain in adult patients with cystic fibrosis--a pilot randomized controlled study
Hubert, D., Soubeiran, L., Gourmelon, F., Grenet, D., Serreau, R., Perrodeau, E., Zegarra-Parodi, R., Boutron, I.
PLoS One, 2014/07
Free full text
634

The OSTEOPATHIC trial demonstrates significant improvement in patients with chronic low back pain as manifested by decreased prescription rescue medication use
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/07
Free full text
635

Treatment of Common Fibular (Peroneal) Nerve Palsy With Osteopathic Manipulative Medicine: A Case Study
Jahnke, B. M., Hopson, P., Worden, K.
The AAO Journal, 2014/06
Free full text
636

New gestational osteopathy unit at the University Hospital Quiron San Jose of Madrid
Guzman Mora, R.
Revista de Enfermeria, 2014/06
637

Short-term dosing of manual therapies for chronic low back pain
Licciardone, J. C.
The Spine Journal, 2014/06
638

Management of Levator Ani Syndrome With Osteopathic Manipulative Treatment: A Case Study
Yoshida, M., Derenge, D., Worden, K.
The AAO Journal, 2014/06
Free full text
639

Osteopathic manipulative treatment for inpatients with pulmonary exacerbations of cystic fibrosis: effects on spirometry findings and patient assessments of breathing, anxiety, and pain
Swender, D. A., Thompson, G., Schneider, K., McCoy, K., Patel, A.
The Journal of the American Osteopathic Association, 2014/06
Free full text
640

Manual therapy, exercise, and education for low back pain and pelvic pain during pregnancy
Licciardone, J. C., Aryal, S.
American Journal of Obstetrics & Gynecology, 2014/06
Free full text
641

Effectiveness of osteopathic manipulative therapy for managing symptoms of irritable bowel syndrome: a systematic review
Muller, A., Franke, H., Resch, K.L., Fryer, G.
The Journal of the American Osteopathic Association, 2014/06
Free full text
642

Response to Letter About “An Unexpectedly Progressed Lumbar Herniated Disk“
Lipton, J. A., McLeod, G. A.
The Journal of the American Osteopathic Association, 2014/05
Free full text
643

Association of Low Back Pain, Somatic Dysfunction, and Lumbar Bone Mineral Density: Reproducibility of Findings
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J., Burton, D. C.
The Journal of the American Osteopathic Association, 2014/05
Free full text
644

Osteopathy: helping pregnant women in pain
Randall, S.
The Practising Midwife, 2014/05
645

An Unexpectedly Progressed Lumbar Herniated Disk
Gilliss, A. C.
The Journal of the American Osteopathic Association, 2014/05
Free full text
646

Determination of Genetic Factors Associated with Response to Osteopathic Manipulative Treatment (OMT) in Individuals with Chronic Lower Back Pain (CLBP)
Richardson, K. K.
Unpublished MSc thesis, 2014/05
647

Approach to low back pain – osteopathy
Vaughan, B., Morrison, T., Buttigieg, D., Macfarlane, C., Fryer, G.
Australian Family Physician, 2014/04
Free full text
648

Tonische Immobilität als häufige Ursache für funktionelle Störungen
(Tonic immobility as a common cause of functional disorders)
Fleischhauer, M., Krebs, C.A.
Osteopathische Medizin, 2014/03
649

Assessment and management of back pain
Licciardone, J. C., Gatchel, R., Dagenais, S.
JAMA Internal Medicine, 2014/03
650

OMT associated with reduced analgesic prescribing and fewer missed work days in patients with low back pain: an observational study
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/02
Free full text
651

Schuhe und chronische Fußschmerzen im Alter
(Shoes and chronic foot pain in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
652

Osteopathic Manual Treatment and Ultrasound Therapy for Chronic Low Back Pain: An Illustration of Osteopathic Semantic Confusion
Cymet, T. C.
The Journal of the American Osteopathic Association, 2014/01
Free full text
653

Clinical reasoning in osteopathy: an investigation of diagnostic hypothesis generation for patients with acute low back pain
Roots, S. A.
Unpublished MSc thesis, 2014/01
Free full text
654

Osteopathy and low back pain, acupuncture and in vitro fertilization, Tai Chi and osteoarthritis, Andrographis paniculata and ulcerative colitis, and acupressure and vertigo
Pettit, J., Glickman-Simon, R.
Explore (NY), 2014/01
655

Emotional processing and its relationship to chronic low back pain
Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12
656

OMT especially recommended for severe low back pain
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/12
657

Does the diaphragm fatigue more easily in patients with recurrent low back pain?
Walker, S.
International Journal of Osteopathic Medicine, 2013/12
658

Treatment of refractory irritable bowel syndrome with visceral osteopathy: short-term and long-term results of a randomized trial
Attali, T. V., Bouchoucha, M., Benamouzig, R.
Journal of Digestive Diseases, 2013/12
659

Emotional processing and its relationship to chronic low back pain: results from a case-control study
Esteves, J. E., Wheatley, L., Mayall, C., Abbey, H.
Manual Therapy, 2013/12
660

The effectiveness of the ‘Bruce Jones sacroiliac technique’ in treatment of people with chronic low back pain: a single cohort design
Hanson, G.
Unpublished MSc thesis, 2013/12
Free full text
661

Outcomes of osteopathic manual treatment for chronic low back pain according to baseline pain severity: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Minotti, D. E.
Manual Therapy, 2013/12
Free full text
662

Effect of selected manual therapy interventions for mechanical neck pain on vertebral and internal carotid arterial blood flow and cerebral inflow
Thomas, L. C., Rivett, D. A., Bateman, G., Stanwell, P., Levi, C. R.
Physical Therapy, 2013/11
Free full text
663

Osteopathic manipulative treatment in tarsal somatic dysfunction: a case study
Batt, J., Neeki, M. M.
The Journal of the American Osteopathic Association, 2013/11
Free full text
664

Response to “Letter to the Editor Regarding ‘The Somatic Connection: Manual Therapy Is Beneficial for Cervical Radiculopathy””
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text
665

Effectiveness of osteopathic treatment in pregnant women suffering from low back pain (LBP). A randomized controlled trial
Gundermann, S.
Unpublished D.O. thesis, 2013/10
666

Prevention of progressive back-specific dysfunction during pregnancy: an assessment of osteopathic manual treatment based on Cochrane Back Review Group criteria
Licciardone, J. C., Aryal, S.
The Journal of the American Osteopathic Association, 2013/10
Free full text
667

The effects of osteopathic treatment on common femoral artery blood flow and skin temperature in spinal cord injured and able-bodied individuals
Murray, D.
Unpublished MSc thesis, 2013/10
Free full text
668

The effects of osteopathic treatment on non-specific chronic neck pain and disability
Gasson, M.
Unpublished MSc thesis, 2013/10
Free full text
669

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly: An Observational Study
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text
670

The repeatability of pressure algometry in asymptomatic individuals over consecutive days
Frank, L, McLaughlin, P, Vaughan, B
International Journal of Osteopathic Medicine, 2013/09
671

A Prognostic approach to defining chronic pain across a range of musculoskeletal pain sites
Mason, J.
International Journal of Osteopathic Medicine, 2013/09
672

Correlating increased stimulus sensitivity with objective biomarkers of spinal nociceptive hyperexcitability in chronic pain
Rickards, L. D.
International Journal of Osteopathic Medicine, 2013/09
673

Osteopathic manipulative treatment (OMT) during labor facilitates a natural, drug-free childbirth for a primigravida patient: A case report
Smallwood, C. R., Borgerding, C. J., Cox, M. S., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2013/09
674

Benefits of osteopathic manual treatment on chronic low back pain – At last, a large high quality clinical trial!
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/09
675

Adding chiropractic manipulative therapy to standard medical care for patients with acute low back pain
Vaughan, B.
International Journal of Osteopathic Medicine, 2013/09
676

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: an illustration of osteopathic semantic confusion. Author reply
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text
677

The Use of Orthotics in the Reduction of Self-reported Pain Scores in a Veterans Affairs Population: a Retrospective Study
Lipton, J. A.
The AAO Journal, 2013/09
Free full text
678

Interventions for preventing and treating pelvic and back pain in pregnancy
Pennick, V., Liddle, S. D.
Cochrane Database of Systematic Reviews, 2013/08
Free full text
679

Traction for low-back pain with or without sciatica
Wegner, I., Widyahening, I. S., van Tulder, M. W., Blomberg, S. E., de Vet, H. C., Bronfort, G., Bouter, L. M., van der Heijden, G. J.
Cochrane Database of Systematic Reviews, 2013/08
Free full text
680

Conservative approach to tardive dyskinesia-induced neck and upper back pain
Reifsnyder, J. W., Tettambel, M. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text
681

Effects of craniosacral therapy as adjunct to standard treatment for pelvic girdle pain in pregnant women: a multicenter, single blind, randomized controlled trial
Elden, H., Ostgaard, H. C., Glantz, A., Marciniak, P., Linner, A. C., Olsen, M. F.
ACTA Obstetricia et Gynecologica Scandinavica, 2013/07
Free full text
682

Does the addition of visceral manipulation improve outcomes for patients with low back pain? Rationale and study protocol
Panagopoulos, J., Hancock, M., Ferreira, P.
Journal of Bodywork and Movement Therapies, 2013/07
683

Osteopathic intervention for chronic pain, remaining thoracic stiffness and breathing impairment after thoracoabdominal oesophagus resection: A single subject design study
Bjerså, K., Sachs, C., Hyltander, A., Fagevik Olsén, M.
International Journal of Osteopathic Medicine, 2013/06
684

Alterations in the multifidus structure and activity in individuals with unilateral recurrent low back pain, despite being pain free and functionally recovered
Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2013/06
685

Acute low back pain patient satisfaction one year after presenting to primary care
Macfarlane, C.
International Journal of Osteopathic Medicine, 2013/06
686

Ruling out other causes than chest wall syndrome for patients with chest pain
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/06
687

Does lumbar spinal movement differ between patients who are healthy, those with simple low back pain and those with degenerative or pre-operative spinal conditions?
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2013/06
688

Osteopathic treatment of patients with long-term sequelae of whiplash injury: effect on neck pain disability and quality of life
Schwerla, F., Kaiser, A. K., Gietz, R., Kastner, R.
The Journal of Alternative and Complementary Medicine, 2013/06
689

Osteopathic manipulative treatment and nutrition: An alternative approach to the irritable bowel syndrome
Collebrusco, L., Lombardini, R.
Health, 2013/06
Free full text
690

Osteopathic manual treatment in patients with diabetes mellitus and comorbid chronic low back pain: subgroup results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2013/06
Free full text
691

How do experiences of physiotherapy and osteopathy vary between NHS and private practice?
Bradbury, K.
Unpublished PhD thesis, 2013/05
Free full text
692

Sham manual medicine protocol for cervical strain-counterstrain research
Brose, S. W., Jennings, D. C., Kwok, J., Stuart, C. L., O', Connell, S. M., Pauli, H. A., Liu, B.
PM&R: The Journal of Injury, Function and Rehabilitation, 2013/05
693

Back to back: postnatal osteopathic care
Johnson, C.
The Practising Midwife, 2013/05
694

Patienteninfo: Häusliche Versorgung – armer Rücken?
(Patient information: Home care - poor back?)
Janssen, A.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
695

Osteopathic intervention in chronic non-specific low back pain: a systematic review
Orrock, P. J., Myers, S. P.
BMC Musculoskeletal Disorders, 2013/04
Free full text
696

The use of placebo interventions in clinical practice
Linde, K.
Complementary Therapies in Medicine, 2013/04
Free full text
697

Welches Gewebe ist verantwortlich für Lumbalgien und Ischialgien?
(Which tissue is responsible for lumbagos and sciaticas?)
Barth, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
698

Die kaudale durale Insertion und das Lig. sacrodurale anterius (nach Trolard)
(The caudal dural insertion and the sacrodural anterior ligament (after Trolard))
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
699

Developing a chronic pain self-management clinic at the British School of Osteopathy: Quantitative pilot study results
Abbey, H., Nanke, L.
International Journal of Osteopathic Medicine, 2013/03
700

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03
701

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Minotti, D. E., Gatchel, R. J., Kearns, C. M., Singh, K. P.
Annals of Family Medicine, 2013/03
Free full text
702

Osteopathic manipulative treatment for colonic inertia
Cohen-Lewe, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text
703

Stabilometric platform as a diagnosis support for pain? Example of chronic low back pain
Huard, Y., Bertucci, W.
The AAO Journal, 2013/03
Free full text
704

Normalization of thoracoabdominal fascial and autononic tone: A case study for the diagnosis and treatment of atypical chest pain
Litman, R. G.
The AAO Journal, 2013/03
Free full text
705

Langzeiteffekte osteopathischer Behandlungen bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom : 5-Jahres-Follow-up einer randomisiert kontrollierten Studie und Uberlegungen zum pathophysiologischen Kontext.
(Long-term effects of osteopathic treatment of chronic prostatitis with chronic pelvic pain syndrome: a 5-year follow-up of a randomized controlled trial and considerations on the pathophysiological context)
Marx, S., Cimniak, U., Rutz, M., Resch, K.L.
Urologe A, 2013/03
706

Strain-counterstrain to treat restrictions of the mobility of the cervical spine in patients with neck pain: a sham-controlled randomized trial
Klein, R., Bareis, A., Schneider, A., Linde, K.
Complementary Therapies in Medicine, 2013/02
Free full text
707

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
708

Systematic review and meta-analysis conclusions relating to osteopathic manipulative treatment for low back pain remain valid and well accepted
Licciardone, J. C.
Journal of Bodywork and Movement Therapies, 2013/01
709

The suitability of sham treatments for use as placebo controls in trials of spinal manipulative therapy: a pilot study
Lougee, H., Johnston, R. G., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2013/01
Free full text
710

Investigating inter-relationships between pain, mobility, and posture following osteopathic treatment in patients with chronic neck pain
Frith, K. L.
Unpublished MSc thesis, 2013/01
Free full text
711

Prevalencia de incontinencia urinaria en mujeres que consultan por dolor lumbopélvico: estudio multicéntrico
(Prevalence of urinary incontinence in women consulting for lumbopelvic pain: a multicenter study.)
Gavira Pavón, A.
Unpublished PhD thesis, 2013
712

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12
713

Depression, somatization, and somatic dysfunction in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Gatchel, R. J., Kearns, C. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2012/12
Free full text
714

Manipulation of the coccyx with anesthesia for the management of coccydynia
Emerson, S. S., Speece III., A. J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
715

A research protocol to determine if OMM is effective in decreasing pain in chronic pain patients and decreasing opioid use: Brief report
Smith, J. B., Ridpath, L. C., Steele, K. M.
The AAO Journal, 2012/12
Free full text
716

Isolated calcaneofibular ligament injuries treated with osteopathic manipulative treatment: A case series
Olds, K., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/12
717

Why reservations remain: a critical reflection about the systematic review and meta-analysis “Osteopathic manipulative treatment for low back pain“ by Licciardone et al
Franke, H.
Journal of Bodywork and Movement Therapies, 2012/10
718

Die Auswirkungen von osteopathischen Behandlungen bei Patient/innen mit dem Fibromyalgiesyndrom. Prä-Post Studie.
(Osteopathic treatment effects in patients with fibromyalgia. Pre-Post Study)
Gleich, A., Klein, C., Sheriff, S.
Unpublished D.O. thesis, 2012/10
719

(Osteopathic treatment of patients with shoulder pain. A randomized controlled study)
Hinse, T., Klosterkamp, M.
Unpublished D.O. thesis, 2012/10
720

Die osteopathische Behandlung bei Frauen mit persistierenden Rückenschmerzen post partum. Randomisierte kontrollierte Studie.
(Osteopathic treatment in women with persistent low back pain after childbirth. A randomized controlled trial)
Rother, D., Rother, K.
Unpublished D.O. thesis, 2012/10
721

Osteopathic treatment during pregnancy reduces risk of birth interventions: The role of optimal foetal positioning
Brown, A., Johnston, R.
International Journal of Gynecology and Obstetrics, 2012/10
722

The immediate effects of sigmoid colon manipulation on pressure pain thresholds in the lumbar spine
McSweeney, T. P., Thomson, O. P., Johnston, R.
Journal of Bodywork and Movement Therapies, 2012/10
Free full text
723

Osteopathic manipulative treatment in obese patients with chronic low back pain: a pilot study
Vismara, L., Cimolin, V., Menegoni, F., Zaina, F., Galli, M., Negrini, S., Villa, V., Capodaglio, P.
Manual Therapy, 2012/10
Free full text
724

Posture and chronic gonalgia in the elderly: contribution of osteopathic treatment
Huard, Y.
Computer Methods in Biomechanics and Biomedical Engineering, 2012/10
725

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving the quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Gulisano, V., Orfei, S.
Clinical Cases in Mineral and Bone Metabolism, 2012/09
Free full text
726

Associations of cytokine concentrations with key osteopathic lesions and clinical outcomes in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Bergamini, M. V.
The Journal of the American Osteopathic Association, 2012/09
Free full text
727

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text
728

Neuropathy of the inferior alveolar nerve: A case report
Seals, R. A., Crow, T.
The AAO Journal, 2012/09
Free full text
729

Psoas syndrome: a frequently missed diagnosis
Tufo, A., Desai, G. J., Cox, W. J.
The Journal of the American Osteopathic Association, 2012/08
Free full text
730

Preventative Osteopathic Manipulative Treatment and the Elderly Nursing Home Resident: A Pilot Study
Snider, K. T., Snider, E. J., Johnson, J. C., Hagan, C., Schoenwald, C.
The Journal of the American Osteopathic Association, 2012/08
Free full text
731

Selbst anzuwendende Übungen für Patienten im osteopathischen Kontext
(Home-based exercises for patients in the osteopathic context)
Resch, A.
Unpublished MSc thesis, 2012/07
Free full text
732

Kreuzschmerzen während der Schwangerschaft
(Low back pain during pregnancy)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
733

Osteopathic manipulative treatment to resolve head and neck pain after tooth extraction
Meyer, P. M., Gustowski, S. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
734

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
735

Is the methodological quality of trials on spinal manipulative therapy for low-back pain improving?
Rubinstein, S. M., Terwee, C. B., de Boer, M. R., van Tulder, M. W.
International Journal of Osteopathic Medicine, 2012/06
736

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06
737

Differenzierung myofaszialer Schmerzpunkte in Genese und Therapie
(Differentiation of myofascial pain points in genesis and treatment)
Eisenreich, U.
Osteopathische Medizin, 2012/06
738

Osteopathic manipulative treatment in pregnant women
Lavelle, J. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
739

Application of osteopathic manipulative treatment to a patient with unremitting chest pain and shortness of breath undergoing “Rule-Out Myocardial Infarction” protocol for one week
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/06
740

Pudendal nerve entrapment in a bareback rodeo cowboy: A case study
Lafave, M. R., Sutter, B.
International Journal of Osteopathic Medicine, 2012/06
741

The effect of muscle energy techniques on disability and pain scores in individuals with low back pain
Day, J. M., Nitz, A. J.
Journal of Sport Rehabilitation, 2012/05
742

Efficacy of osteopathic manipulative treatment for low back pain in euhydrated and hypohydrated conditions: a randomized crossover trial
Parker, J., Heinking, K. P., Kappler, R. E.
The Journal of the American Osteopathic Association, 2012/05
Free full text
743

Iliacus tender points in young adults: a pilot study
Liu, Y., Palmer, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text
744

Assessment of Low Back and Pelvic Pain after applying the Pelvis Global Manipulation Technique in Patients with Primary Dysmenorrhea: A Pilot Study
Molins-Cubero, S., Boscá-Gandia, J. J., Rus-Martinez, M. A.
European Journal Osteopathy & Related Clinical Research, 2012/04
Free full text
745

Osteopathische Therapie in der Migränebehandlung: eine randomisierte kontrollierte Studie über die Wirksamkeit
(Osteopathic medicine: Osteopathic therapy in the treatment of migraine: A randomized controlled study about the effectiveness)
Burmeister, U., Beck, M., Voigt, K., Liebnitzky, J., Bergmann, A.
Osteopathische Medizin, 2012/03
746

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03
747

The dorsal sacral rami and branches: Sonographic visualisation of their vascular signature
McGrath, M.C., Jeffery, R., Stringer, M. D.
International Journal of Osteopathic Medicine, 2012/03
748

A pilot study to compare the views of traditionally trained and CAM-trained therapists using the clinical exemplar of the management of neck/upper limb pain to assess barriers to effective integration of approaches
Denyer, K., Smith, H., Davies, K., Horne, R., Hankins, M., Walker-Bone, K.
Complementary Therapies in Medicine, 2012/02-04
749

Strain counterstrain: current concepts and clinical evidence
Wong, C. K.
Manual Therapy, 2012/02
750

A randomized, controlled trial of osteopathic manipulative treatment for acute low back pain in active duty military personnel
Cruser d, A., Maurer, D., Hensel, K., Brown, S., White, K., Stoll, S.
Journal of Manual & Manipulative Therapy, 2012/02
751

Efficacy of Muscle Energy Technique versus Myofascial Release on function outcome measures in patients with chronic low back pain
Ellythy, M A
Bulletin of Faculty of Physical Therapy Cairo University, 2012/01
Free full text
752

Visceral mobilization can lyse and prevent peritoneal adhesions in a rat model
Bove, G. M., Chapelle, S. L.
Journal of Bodywork and Movement Therapies, 2012/01
753

Short Term Effect of Muscle Energy Technique on Individuals with Mechanical Neck Pain Due to Somatic Dysfunction
Rashmi, D.
Unpublished MSc thesis, 2012/01
754

A Study on the Efficacy of Muscle Energy Technique as Compared to Conventional Therapy in Chronic Low Back Pain Due to Sacroiliac Joint Dysfunction
Bindra, S, Kumar, M, Singh, P P, Singh, J
Indian Journal of Physiotherapy & Occupational Therapy, 2012
755

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
756

Subjektive Krankheitstheorien bei Patienten mit lumbalem Rückenschmerz
(Subjective theories of illness of patients with low back pain)
Penger, S.
Unpublished MSc thesis, 2011/12
Free full text
757

Fascial release effects on patients with non-specific cervical or lumbar pain
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2011/10
758

Patterns of chronic pain in the population
Carnes, D.
International Journal of Osteopathic Medicine, 2011/09
759

Groin pain in sacral insufficiency fracture. Avoiding delayed diagnosis
Ungaro, E. F., Astore, F., Bonora, C., Ferrari, M. C.
International Journal of Osteopathic Medicine, 2011/09
760

Medición de la emisión biofotónica antes y después de la intervención osteopática en pacientes con lumbalgia mecánica
(Measurement of biophotonic emission before and after osteopathic intervention in patients with mechanical low back pain)
Prieto Murillo, E. F.
Unpublished MSc thesis, 2011/09
Free full text
761

Dynamics of indicators of quality of life in patients with chronic pain syndrome in the lumbus and lower extremities after osteopathic treatment
Yakovets, G. V., Novoseltsev, S. V.
The AAO Journal, 2011/09
Free full text
762

Revisión sistemática del tratamiento manipulativo para el hombro doloroso
(A systematic review of manipulative therapy for the treatment of shoulder pain)
Pribicevic, M., Pollar, H., Bonell, R., de Luca, K.
Osteopatía Científica, 2011/09
763

Spinal manipulation: an update of a systematic review of systematic reviews
Posadzki, P., Ernst, E.
The New Zealand Medical Journal, 2011/08
764

Re: The Fall of the postural-structural-biomechanical model in manual therapy: exemplified by lower back pain. A response to reviewers and further thoughts
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/07
765

A pilot study of the prevalence of leg pain among women with endometriosis
Missmer, S. A., Bove, G. M.
Journal of Bodywork and Movement Therapies, 2011/07
Free full text
766

Therapie chronischer Rückenschmerzen: Vergleich der Wirksamkeit von Weichteilosteopathie gegenüber klassischer Krankengymnastik sowie einer Kombination beider Therapiearten mit einem Herzratenvariabilitätstraining
(Therapy of chronic back pain: Comparison of the effectivity of soft part osteopathy with conventional physiotherapy and a combination of both treatments with a heart rate variability training)
Beutinger, D.
Unpublished PhD thesis, 2011/07
Free full text
767

Is it feasible and effective to provide osteopathy and acupuncture for patients with musculoskeletal problems in a GP setting? A service evaluation
Cheshire, A., Polley, M., Peters, D., Ridge, D.
BMC Family Practice, 2011/06
Free full text
768

Osteopathic manipulative treatment in patients with low back pain
Licciardone, J. C.
Clinical Rheumatology, 2011/06
769

The effectiveness of osteopathic treatment in women with endometriosis-related pain
Schneider-Milo, U.
Unpublished MSc thesis, 2011/06
Free full text
770

Der viszeral assoziierte Schulterschmerz
(Viscerally Associated Shoulder Pain. Subjective Perspectives and Diagnostic Procedures ? The Osteopathic Point of View)
Fischer, U.
Unpublished MSc thesis, 2011/06
Free full text
771

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text
772

Efectos de las técnicas de anclaje miofascial y energía muscular en pacientes con bruxismo
(Effects of the myofascial anchorage and muscular energy techniques in patients with bruxism)
Cejo, P. E., Legal, L.
Osteopatía Científica, 2011/05
773

Mecanismo de acción del tratamiento manipulativo vertebral
(Mechanism of action of spinal manipulative therapy)
Maigne, J.Y., Vautravers, P.
Osteopatía Científica, 2011/05
774

Kieferbeschwerden aus Sicht des Fasziendistorsionsmodells (FDM)
(Jaw complaints from the point of view of the fascial distortion model (FDM))
Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
775

Is a postural-structural-biomechanical model, within manual therapies, viable?: A JBMT debate
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04
776

A rich seam
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04
777

Invited response: (without science, there must be art)
Hannon, J. C.
Journal of Bodywork and Movement Therapies, 2011/04
778

Invited response (the postural structural model, with boundary conditions)
Irvin, R. E.
Journal of Bodywork and Movement Therapies, 2011/04
779

The fall of the postural-structural-biomechanical model in manual and physical therapies: exemplified by lower back pain
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/04
780

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04
781

Osteopathic manipulative treatment is effective on pain control associated to spinal cord injury
Arienti, C., Dacco, S., Piccolo, I., Redaelli, T.
Spinal Cord, 2011/04
Free full text
782

An Osteopathic Approach to Chronic Sinusitis
Lee-Wong, M., Karagic, M., Doshi, A., Gomez, S., Resnick, D.
Journal of Allergy & Therapy, 2011/04
Free full text
783

Invited response
McGill, S.
Journal of Bodywork and Movement Therapies, 2011/04
784

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03
785

Chronische Prostatitis: Gemeinsam geht's besser! 
(Chronic prostatitis: Let's work together!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
786

Low back pain, somatic dysfunction, and segmental bone mineral density T-score variation in the lumbar spine
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J.
The Journal of the American Osteopathic Association, 2011/02
Free full text
787

Ist der Rumpf stabil, bessern sich die Beschwerden: Behandlungskonzept bei lumbalen Rückenschmerzen
(Concept of treatment of low back pain)
Müller, R., Linz, W., Buchmann, J.
MMW - Fortschritte der Medizin, 2011/01
788

Gekonnte Handgriffe bei Blockaden, Verspannungen und Schiefstand: Diagnostik und Therapie muskuloskelettaler Schmerzen
(Manual medicine - A powerful “hands on“ facility to treat somatic and segmental dysfunction with musculosceletal pain, increased muscule tension, restrictions of fascia and posture asymmetries)
Müller, R., Linz, W., Buchmann, J.
MMW - Fortschritte der Medizin, 2011/01
789

Influencia de la thumb move de C7/T1 combinada con el stretching del ligamento anular del carpo sobre el área de sección transversal del nervio mediano en un caso de STC bilateral
(Influence of the thumb move at C7/T1 combined with stretching of the carpal annular ligament on a cross sectional area of the median nerve in a case of bilateral carpal tunnel syndrome)
Aguirrea, F. B., Boscá Gandíaa, J. J., Brizb, Vicente H., Pascual-Vacaa, J. O.
Osteopatía Científica, 2011/01
790

Técnica semidirecta de thrust para una disfunción somática no neutra en ERS izquierda de la tercera vértebra cervical
(Thrust technique for left ERS somatic dysfunction of the third cervical vertebra)
Guerrero, A. M., Rodríguez, R. P.
Osteopatía Científica, 2011/01
791

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011
792

Clinical effects of Muscle Energy Technique (MET) for nonspecific back pain. A systematic review
Franke, H.
Unpublished MSc thesis, 2011
Free full text
793

Langjährige Schilddrüsenunterfunktion und muskuläre Beschwerden: Ist Osteopathie für die betroffenen Frauen von Nutzen?
(Long-term hypothyroidism and muscle diseases: Is osteopathy of use to the afflicted women?)
Sonberg, M., Mullinger, B., Rajendran, D.
Osteopathische Medizin, 2010/12
794

American Osteopathic Association guidelines for osteopathic manipulative treatment (OMT) for patients with low back pain
Seffinger, M. A., Buser, B. R., Licciardone, J. C., Lipton, J. A., Lynch, J. K., Patterson, M. M., Snow, R., Troutman, M. E.
The Journal of the American Osteopathic Association, 2010/11
Free full text
795

Hat die osteopathische Behandlung Einfluss auf Immunparameter bei Patienten mit chronischen Rückenschmerzen? Prä-Post Pilotstudie
(Does osteopathic treatment influence immune parameters in patients with chronic low back pain? A pre-post pilot trial)
Conrady, A., Döring, R.
Unpublished D.O. thesis, 2010/10
796

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests over a 4-month period
Degenhardt, B. F., Johnson, J. C., Snider, K. T., Snider, E. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text
797

OMT relieves low back pain during pregnancy
Kleman, P. G.
The Journal of the American Osteopathic Association, 2010/10
Free full text
798

Übertragener Muskelschmerz ist primär peripheren Ursprungs: die Barrier-Dam-Hypothese
(Referred muscle pain is primarily of peripheral origin: The barrier-dam theory)
Farasyn, A.
Osteopathische Medizin, 2010/09
799

Magnetic resonance imaging of subjects with acute unilateral neck pain and restricted motion: A feasibility study
Fryer, G., Adams, J.
International Journal of Osteopathic Medicine, 2010/09
800

Osteopathic manipulative treatment for chronic neck pain: A randomized placebo controlled trial on the effect on pain and disability
Mandara, A., Ceriani, A., Guzzetti, G., Gulisano, V., Fusaro, A., Bado, F.
International Journal of Osteopathic Medicine, 2010/09
801

Emotional Processing and its contribution to chronic lower back pain – A pilot study
Mayall, C., Esteves, J. E.
International Journal of Osteopathic Medicine, 2010/09
802

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Mosca, G., Orfei, S.
International Journal of Osteopathic Medicine, 2010/09
803

Osteopathic treatment of patients with shoulder pain: A randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2010/09
804

Are student attitudes to back pain aligned with European guidelines? A survey within UK osteopathic educational institutions (OEIs) using the Attitudes to Back Pain Scale for musculoskeletal practitioners (ABS-mp)
Stokoe, J., Rajendran, D.
International Journal of Osteopathic Medicine, 2010/09
805

Efectos de la desactivación de los puntos-gatillo de los músculos de la pantorrilla en las fascitis plantares
(The effects of calf muscle trigger-points disactivation in plantar fasciitis)
Renan Ordine, R., Alburquerque Sendín, F.
Osteopatía Científica, 2010/09
806

CRPS und Osteopathie – Möglichkeiten und Grenzen
(CRPS and osteopathy - possibilities and limits)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
807

Comparison of muscle energy technique and positional release therapy in acute low back pain – RCT
Naik, P. P., Heggannavar, A., Khatri, S. M.
Indian Journal of Physiotherapy & Occupational Therapy, 2010/06
Free full text
808

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text
809

Low Back Pain in Rowers
Fleming, R. K., Snider, K. T.
The AAO Journal, 2010/06
Free full text
810

Kognitive Gruppen-Verhaltenstherapie in der primären Gesundheitsversorgung bei LWS-Syndrom: eine randomisierte, kontrollierte Studie und Analyse der Kostenwirksamkeit
(Group cognitive behavioral intervention in primary care in low back pain: A randomized, controlled study and analysis of cost-effectiveness)
Lamb, S. E., Hansen, Z., Lall, R., Castelnuova, E., Withers, E., Nichols, V., Potter, R.
Osteopathische Medizin, 2010/06
811

Osteopathic Diagnosis and Treatment of Dorsalgia Caused by Disturbance of Proprioception in the Cervical Spine
Lepin, A. L., Mokhov, D. E., Novoseltsev, S. V.
The AAO Journal, 2010/06
Free full text
812

Fließende Kunst an Körper und Seele: die traditionelle Thai-Massage
(Flowing art on body and soul: The traditional Thai massage)
Möller, H.
Osteopathische Medizin, 2010/06
813

Rückenstärkung für die Schmerztherapie: Symposium in der Klinik für Manuelle Therapie Hamm
(Strengthening the back for pain therapy: Symposium held at the Clinic for Manual Therapy, Hamm)
Niemier, K.
Osteopathische Medizin, 2010/06
814

Somatic Dysfunction Following Sigmoid Colon Resection for Diverticulitis: A Case Report
Ridgeway, V., Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text
815

Methoden der osteopathischen Diagnostik und der Reflexdiagnostik bei Zervikalgiepatienten
(Methods of osteopathic diagnostics and reflex diagnostics in patients with cervicalgia)
Usupbékova, B. C., Mokhov, D. E., Vasilenko, A. M., Paoletti, S.
Osteopathische Medizin, 2010/06
816

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06
817

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05
818

L'osteopathie pour soulager certaines douleurs.
(Osteopathy for relieving certain pain)
Gnaho, S.
Revue de l'infirmiere, 2010/05
819

Estudio comparativo sobre la eficacia de las técnicas de thrust y energía muscular en el músculo piriforme
(Comparative study on the efficacy of thrust and muscle energy techniques in the piriformis muscle)
Hunt, G. M., Legal, L.
Osteopatía Científica, 2010/05
820

Fe de errores de “El efecto en el umbral del dolor en un miotoma tras la manipulación vertebral del nivel correspondiente, ¿es infl uenciable por las expectativas del sujeto?”
(Erratum to “The effect on the pain threshold in a myotome after a spinal manipulation… is it influenced by the subject's expectations?“)
Manso, M. G., Rodríguez Díaz, J.
Osteopatía Científica, 2010/05
821

Repercusión de la maniobra lift de vejiga sobre el punto gatillo miofascial del músculo tibial anterior y de la apófisis espinosa de lumbar 5
(Repercussions of the urinary bladder lift manipulation on the myofascial trigger point of the tibialis anterior muscle and fifth lumbar spinous process)
Marchuk, C., Legal, L.
Osteopatía Científica, 2010/05
822

Modificaciones radiológicas del espacio entre el occipucio y el cuerpo del atlas tras una manipulación global (OAA) de Fryette
(Radiological changes in the atlanto-occipital space after Fryette global manipulation (OAA))
Otaño, L., Legal, L.
Osteopatía Científica, 2010/05
823

Klinische Relevanz statt Placebo-Kontrolle
(Clinical relevance instead of placebo control)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
824

Morbus Sudeck und Osteopathie?
(Complex Regional Pain Syndrome and Osteopathy?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
825

Diagnose und Behandlung von Zahnschmerzen nach dem Fasziendistorsionsmodell (FDM)
(Diagnosis and treatment of dental pain according to the Fascial Distortion Model (FDM))
Stein, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
826

Die Fascia thoracolumbalis als potenzielle Ursache für Rückenschmerzen: anatomische Grundlagen und klinische Aspekte
(The thoracolumbar fascia as potential cause of back pain: Anatomical bases and clinical aspects)
Tesarz, J.
Osteopathische Medizin, 2010/03
827

Composite sacroiliac joint pain provocation tests: A question of clinical significance
McGrath, M. C.
International Journal of Osteopathic Medicine, 2010/03
828

Can osteopathy help women with a history of hypothyroidism and musculoskeletal complaints? Outcome of a preliminary, prospective, open investigation
Sonberg, M., Mullinger, B., Rajendran, D.
International Journal of Osteopathic Medicine, 2010/03
829

Effectiveness of manual therapies in the UK
Bronfort, G., Haas, M., Evans, R., Leininger, B., Triano, J.
Chiropractic & Osteopathy, 2010/02
Free full text
830

The myth of core stability
Lederman, E.
Journal of Bodywork and Movement Therapies, 2010/01
831

Effectiveness of muscle energy technique on quadratus lumborum in acute low back pain-randomized controlled trial
Patil, P. N., Chandu, B., Metgud, S., Khatri, S.
Indian Journal of Physiotherapy & Occupational Therapy, 2010/01
Free full text
832

Osteopathic manipulative treatment of back pain and related symptoms during pregnancy: a randomized controlled trial
Licciardone, J. C., Buchanan, S., Hensel, K. L., King, H. H., Fulda, K. G., Stoll, S. T.
American Journal of Obstetrics & Gynecology, 2010/01
Free full text
833

Dolor y estrategias terapéuticas en osteopatía (IV)
(Pain and therapeutics approaches in osteopathy (IV))
Hernández Xumet, J. E.
Osteopatía Científica, 2010/01
834

El efecto en el umbral del dolor de un miotoma tras la manipulación vertebral del nivel correspondiente, ¿es influenciable por las expectativas del sujeto?
(The effect on the pain threshold in a myotome after a spinal manipulation… is it influenced by the subject's expectations?)
Manso, M. G., Rodríguez Díaz, J.
Osteopatía Científica, 2010/01
835

Diseño de un modelo de atención en osteopatía desde el componente de la prestación de servicios, orientado hacia el manejo de pacientes con lumbalgia de tipo mecánico, para instituciones prestadoras de servicios de salud de mediana complejidad en Colombia
(Design of an osteopathic care model from the service delivery component, oriented towards the management of patients with mechanical low back pain, for medium complexity health care institutions in Colombia)
Mejía Arango, A.
Unpublished MSc thesis, 2010/01
Free full text
836

Correlación entre el diagnóstico de lesiones osteopáticas de la articulación sacroilíaca obtenido mediante la aplicación del Test de Movilidad de Espinas Ilíacas Postero Superiores (EIPS), el test de flexión de cadera de Gillet y el downing test, en pacientes con dolor de espalda bajo
(Correlation between diagnosis of osteopathic lesions of the sacro iliac joint obtained by applying The test of Mobility of Posterior Superior Iliac Spines (PSIS), the test of flexion of hip of Gillet and downing test, in patients with low back pain)
Ramírez Cumplido, B. E.
Unpublished MSc thesis, 2010/01
Free full text
837

Contribution of the osteopathy on the flexibility of the lumbar column and intensity of pain in young adult patients with acute low back pain
Rocha, R., Pereira, J. S.
Revista Terapia Manual, 2010
838

Osteopathic Treatment of Patients with Chronic Non-Specific Neck Pain: Development of a Study Protocol
Schwerla, F.
Unpublished MSc thesis, 2010
Free full text
839

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12
840

NICE clinical guidelines. Low back pain: The early management of persistent non-specific back pain
Vogel, S.
International Journal of Osteopathic Medicine, 2009/12
Free full text
841

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text
842

Osteopathy and Evidence Based Medicine. Analysis of Studies Investigating Benefits of Osteopathy as Treatment of Back Pain
Richter, A.
Unpublished MSc thesis, 2009/12
Free full text
843

Effects of an osteopathic clinical based approach for the treatment of chronic non-specific low back pain in factory workers: A single cohort, pilot study
Yardley, S.
Unpublished MSc thesis, 2009/12
Free full text
844

Chronische Prostatitis/chronisches Beckenschmerzsyndrom. Einfluss osteopathischer Behandlungen - eine randomisiert kontrollierte Studie.
(Chronic prostatitis/chronic pelvic pain syndrome. Influence of osteopathic treatment - a randomized controlled study)
Marx, S., Cimniak, U., Beckert, R., Schwerla, F., Resch, K.L.
Urologe A, 2009/11
845

Osteopathische Behandlung von Patienten mit Schulterschmerz. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of patients with shoulder pain. A randomized controlled trial)
Bube, J., Hettasch, J.
Unpublished D.O. thesis, 2009/10
846

Untersuchung der therapeutischen Wirksamkeit osteopathischer Behandlungen bei Patienten mit chronischen Nackenschmerzen nach einem posttraumatischen Zervikalsyndrom durch ein Beschleunigungstrauma.
(Evaluation of the effectiveness of osteopathic treatments in patients with chronic neck pain after a posttraumatic cervical syndrome following a whiplash injury. A randomized controlled trial)
Engemann, K., Hofmeier, G.
Unpublished D.O. thesis, 2009/10
847

(Does osteopathic treatment influence thoracolumbar junction back pain positively?)
Lützelberger, N.
Unpublished D.O. thesis, 2009/10
848

The effects of osteopathic treatment on constipation in children with cerebral palsy: a pilot study
Tarsuslu, T., Bol, H., Simsek, I. E., Toylan, I. E., Cam, S.
Journal of Manipulative and Physiological Therapeutics, 2009/10
Free full text
849

Management of chronic posttraumatic headache: a multidisciplinary approach
Channell, M. K., Mueller, L. L., Hahn, R.
The Journal of the American Osteopathic Association, 2009/09
Free full text
850

A case report of Osteopathic Manipulative Treatment in a 14 year-old girl with McCune-Albright Syndrome
Colonvega, M., Hensel, K., Minotti, D. II., Williams, S.
The AAO Journal, 2009/09
Free full text
851

The treatment of Chronic Low Back Pain following the principles of the Fascial Distortion Modell (FDM)
Engel, R.
Unpublished MSc thesis, 2009/09
Free full text
852

Impact of osteopathic manipulative treatment on cost of care for patients with migraine headache: a retrospective review of patient records
Schabert, E., Crow, W. T.
The Journal of the American Osteopathic Association, 2009/08
Free full text
853

Time for the osteopathic profession to take the lead in musculoskeletal research
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/07
Free full text
854

Osteopathie bei akuten Erkrankungen
(Osteopathy for acute diseases)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
855

A comparison of Australian and European evidence-based guidelines for intervention in acute, non-specific low back pain
Penney, J. N.
International Journal of Osteopathic Medicine, 2009/06
856

The effects of high-velocity low-amplitude thrust manipulation and mobilisation techniques on pressure pain threshold in the lumbar spine
Thomson, O. P., Haig, L., Mansfield, H.
International Journal of Osteopathic Medicine, 2009/06
857

Efectos inmediatos del estiramiento de los músculos isquiosurales en el sistema estomatognático en la cervicalgia mecánica
(The immediate effects of hamstring muscle stretching on the stomatognathic system in mechanical neck pain)
Bretischwerdt, C., Rivas, L., Palomeque, L., Alburquerque, F.
Osteopatía Científica, 2009/05
858

Estenosis foraminal con radiculopatía debida a hernia de disco cervical en un varón de 33 años tratado con manipulación de flexión-distracción de Cox de descompresión
(Foraminal stenosis with radiculopathy from a cervical disc herniation in a 33-year-old man treated with flexion distraction decompression manipulation)
Gudavalli, S., Kruse, R. A.
Osteopatía Científica, 2009/05
859

Dolor y estrategias terapéuticas en osteopatía (III)
(Pain and therapeutic approaches in osteopathy (III))
Hernández Xumet, J. E.
Osteopatía Científica, 2009/05
860

Técnica semidirecta de thrust con kick para lesión de ilíaco anterior izquierdo
(Semidirect thrust kick technique in left anterior iliac dysfunction)
Mancha, J. A. D., Martín, C. O.
Osteopatía Científica, 2009/05
861

Estimating cost of care for patients with acute low back pain: a retrospective review of patient records
Crow, W. T., Willis, D. R.
The Journal of the American Osteopathic Association, 2009/04
Free full text
862

Dolor y estrategias terapéuticas en osteopatía (II)
(Pain and therapeutic approaches in osteopathy (II))
Hernández Xumet, J. E.
Osteopatía Científica, 2009/04
863

Validez del test de deslizamiento posteroanterior cervical medio respecto a análisis radiológico dinámico
(Validity of the postero-anterior middle cervical spine gliding test with respect to dynamic radiological analysis)
Rey Eiriz, G., Alburquerque Sendín, F., Barrera Mellado, I., Martín Vallejo, F. J.
Osteopatía Científica, 2009/04
864

Pruebas para la detección de hipersensibilidad sensorial o hiperexcitabilidad central asociada al dolor cervical
(Testing for sensory hypersensitivity or central hyperexcitability associated with cervical spine pain)
Sterling, M.
Osteopatía Científica, 2009/04
865

Therapeutic needling in osteopathic practice: An evidence-informed perspective
Rickards, L. D.
International Journal of Osteopathic Medicine, 2009/03
866

The Use Of Heel Lifts and Custom Orthotics In Reducing Self-Reported Chronic Musculoskeletal Pain Scores
Lipton, J. A., Flowers-Johnson, J., Bunnell, M. T., Carter, L.
The AAO Journal, 2009/03
Free full text
867

Manipulative therapy and clinical prediction criteria in treatment of acute nonspecific low back pain
Hallegraeff, J. M., de Greef, M., Winters, J. C., Lucas, C.
Perceptual and Motor Skills, 2009/02
868

Osteopathy and pregnancy
Hyde, D.
The Practising Midwife, 2009/02
869

Attitudes and beliefs of New Zealand osteopaths towards chronic pain
Carrington, A. L.
Unpublished MSc thesis, 2009/01
Free full text
870

Changes in masseter muscle trigger points following strain-counterstrain or neuro-muscular technique
Ibanez-Garcia, J., Alburquerque-Sendin, F., Rodriguez-Blanco, C., Girao, D., Atienza-Meseguer, A., Planella-Abella, S., Fernandez-de-Las Penas, C.
Journal of Bodywork and Movement Therapies, 2009/01
871

Short-term effect of muscle energy technique on pain in individuals with non-specific lumbopelvic pain: a pilot study
Selkow, N. M., Grindstaff, T. L., Cross, K. M., Pugh, K., Hertel, J., Saliba, S.
Journal of Manual & Manipulative Therapy, 2009/01
872

Study on the effectiveness of a test-dependent osteopathic treatment for women with persistent post partum back pain: A randomized controlled trial
Recknagel, C., Roß, J., Recknagel, A., Ruetz, M., Schwerla, F.
International Journal of Osteopathic Medicine, 2008/12
873

A randomised controlled trial on the effectiveness of osteopathic manipulative treatment of chronic low back pain
Mandara, A., Fusaro, A., Musicco, M., Bado, F.
International Journal of Osteopathic Medicine, 2008/12
874

Pilot clinical study of osteopathic manipulative treatment in pregnant patients with acute low back pain
Caragan, C., Tang, P.Y., Slack, M., Leiber, J. D., Koskinen, J., Zust, D., Cragun, T.
International Journal of Osteopathic Medicine, 2008/12
875

Eficacia de una técnica de thrust para la disfunción glenohumeral en superioridad
(Efficacy of a thrust technique for upward glenohumeral dysfunction)
García Vila, S. F., Sánchez, C. C.
Osteopatía Científica, 2008/12
876

Dolor y estrategias terapéuticas en osteopatía (I)
(Pain and therapeutic approaches in osteopathy (I))
Hernández Xumet, J. E.
Osteopatía Científica, 2008/12
877

Eficacia del tratamiento osteopático en la rinosinusitis crónica del adulto
(Efficacy of osteopathic treatment in adult chronic rhinosinusitis)
Méndez Sánchez, R.
Osteopatía Científica, 2008/12
878

La prueba de la movilidad cervical: metodología e implicaciones clínicas
(Cervical motion testing: methodology and clinical implications)
Prushansky, T., Dvir, Z.
Osteopatía Científica, 2008/12
879

Patient perception of osteopathic manipulative treatment in a hospitalized setting: a survey-based study
Pomykala, M., McElhinney, B., Beck, B. L., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2008/11
Free full text
880

Osteopathie bei chronischem Schmerz
(Osteopathy applied to chronic pain patients)
Deichmeier, A., von Fischern, F., Heinbücher, I.
Unpublished D.O. thesis, 2008/10
881

Die osteopathische Behandlung von kindlichen und juvenilen Wachstumsschmerzen. Eine randomisierte kontrollierte Studie
(The osteopathic treatment of infantile and juvenile growing pains. A randomized controlled trial)
Löhr, M., Treinies, T.
Unpublished D.O. thesis, 2008/10
882

Improvement of L4-L5 disc positioning following treatment with orthotics used to correct gait dysfunction and level the sacral base
Lipton, J. A., Carter, L.
The AAO Journal, 2008/09
Free full text
883

Le perinee douloureux sous toutes ses formes. Apport de la medecine manuelle et osteopathie. Etude clinique.
(Painful perineum in all its forms. Contribution of manual medicine and osteopathy. Clinical study)
Grimaldi, M.
Journal de Gynecologie, Obstetrique et Biologie de la Reproduction, 2008/09
884

Can back pain caused by symptom-giving sacroiliac joint relaxation during pregnancy be reduced by applying osteopathic treatment?
Aspalter, W.
Unpublished MSc thesis, 2008/09
Free full text
885

ED physicians beware when using OMT for patients with motor vehicle injuries
Fletcher, S. A.
The Journal of the American Osteopathic Association, 2008/08
Free full text
886

Dolor craneofacial, craneomandibular y craneocervical. Diseño de caso único
(Craniofacial, craniocervical and/or craniomandibular pain: a single case design)
Hernández Xumet, J. E.
Osteopatía Científica, 2008/08
887

Efectos de un protocolo secuenciado de terapia manual en los puntos gatillo latentes miofasciales de los maseteros
(Effects of a protocol of two manual techniques on latent myofascial trigger points of the masseter muscle)
Ibáñez García, J., Alburquerque Sendín, F.
Osteopatía Científica, 2008/08
888

Efecto de la manipulación de la charnela occipito-atlo-axoidea en la apertura de la boca
(Effect of upper cervical spine manipulation on mouth opening)
Mansilla Ferragud, P., Boscá Gandia, J. J.
Osteopatía Científica, 2008/08
889

Osteopathic treatment of patients with chronic non-specific neck pain: a randomised controlled trial of efficacy
Schwerla, F., Bischoff, A., Nurnberger, A., Genter, P., Guillaume, J.P., Resch, K.L.
Forschende Komplementärmedizin, 2008/07
890

Educating osteopaths to be researchers - what role should research methods and statistics have in an undergraduate curriculum?
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2008/06
Free full text
891

Spanien - eine neue wissenschaftliche Zeitschrift für die Osteopathie
(A new scientific journal for osteopathy in Spain)
Ricard, F.
Osteopathische Medizin, 2008/05
892

The virtual haptic back: a simulation for training in palpatory diagnosis
Howell, J. N., Conatser, R. R., Williams II., R. L., Burns, J. M., Eland, D. C.
BMC Medical Education, 2008/04
893

Das komplexe regionale Schmerzsyndrom
(The complex regional pain syndrome)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
894

Asociación entre hipomovilidad cervical y cambios morfológicos de los músculos multífidos cervicales en pacientes con cervicalgia mecánica
(Association between cervical joint dysfunction and morphological changes in the cervical multifidus in patients with mechanical neck pain)
Albert i Sanchis, J. C., Boscá Gandía, J. J.
Osteopatía Científica, 2008/04
895

Características de los movimientos intervertebrales y los cambios de presión intradiscal durante la manipulación de la columna lumbar: estudio de viabilidad
(Highlighting of intervertebral movements and variations of intradiskal pressure during lumbar spine manipulation: a feasibility study)
Maigne, J.Y., Guillon, F.
Osteopatía Científica, 2008/04
896

Un caso de pelviespondilitis atípica
(A case of atypical pelvispondylitis)
Ricard, F.
Osteopatía Científica, 2008/04
897

OSTEOPAThic Health outcomes in chronic low back pain: The OSTEOPATHIC Trial
Licciardone, J. C., King, H. H., Hensel, K. L., Williams, D. G.
Osteopathic Medicine and Primary Care, 2008/04
898

Osteopathic manipulation & its use for low back pain
Wolf, C. J.
Missouri Medicine, 2008/03-04
899

Osteopathic manipulative treatment (OMT) effects on mandibular kinetics: kinesiographic study
Monaco, A., Cozzolino, V., Cattaneo, R., Cutilli, T., Spadaro, A.
European Journal of Paediatric Dentistry, 2008/03
Free full text
900

The importance of monitoring patient's ability to achieve functional tasks in those with musculoskeletal pain
Carnes, D., Underwood, M.
International Journal of Osteopathic Medicine, 2008/03
901

A prospective study of patients with chronic back pain randomised to group exercise, physiotherapy or osteopathy
Chown, M., Whittamore, L., Rush, M., Allan, S., Stott, D., Archer, M.
Physiotherapy, 2008/03
Free full text
902

The Phenomenon Spondylolisthesis from an Osteopathic Point of View
Schiener, M.
Unpublished MSc thesis, 2008/02
Free full text
903

Medical conditions in works of art
Salter, V., Ramachandran, M.
British Journal of Hospital Medicine, 2008/02
904

Growing pains in children- can osteopathy improve the clinical picture?
Kramer, B.
Unpublished MSc thesis, 2008/02
Free full text
905

Die visuelle Analogskala
(The visual analog scale)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
906

Pregnancy-related pelvic girdle pain: intertester reliability of 3 tests to determine asymmetric mobility of the sacroiliac joints
van Kessel-Cobelens, A. M., Verhagen, A. P., Mens, J. M., Snijders, C. J., Koes, B. W.
Journal of Manipulative and Physiological Therapeutics, 2008/02
Free full text
907

Inter-examiner reliability of four static palpation tests used for assessing pelvic dysfunction
Holmgren, U., Waling, K.
Manual Therapy, 2008/02
908

Intertester reliability and validity of motion assessments during lumbar spine accessory motion testing
Landel, R., Kulig, K., Fredericson, M., Li, B., Powers, C. M.
Physical Therapy & Rehabilitation Journal, 2008/01
Free full text
909

A systematic review of low back pain cost of illness studies in the United States and internationally
Dagenais, S., Caro, J., Haldeman, S.
The Spine Journal, 2008/01
910

Evidence-informed management of chronic low back pain with prolotherapy
Dagenais, S., Mayer, J., Haldeman, S., Borg-Stein, J.
The Spine Journal, 2008/01
911

A supermarket approach to the evidence-informed management of chronic low back pain
Haldeman, S., Dagenais, S.
The Spine Journal, 2008/01
912

What have we learned about the evidence-informed management of chronic low back pain?
Haldeman, S., Dagenais, S.
The Spine Journal, 2008/01
913

Osteopathic Manipulative Medicine and Acupuncture Combined: A Retrospective case study to determine if order of treatment makes a difference in outcome for acute mechanical low back pain
Stager, W. H.
The AAO Journal, 2007/12
Free full text
914

Psychological response in spinal manipulation (PRISM): a systematic review of psychological outcomes in randomised controlled trials
Williams, N. H., Hendry, M., Lewis, R., Russell, I., Westmoreland, A., Wilkinson, C.
Complementary Therapies in Medicine, 2007/12
Free full text
915

Using the concept of ideomotor therapy in the treatment of a patient with chronic neck pain: A single system research design
McCarthy, S., Rickards, L. D., Lucas, N. P.
International Journal of Osteopathic Medicine, 2007/12
916

Applying osteopathic principles to formulate treatment for patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2007/11
Free full text
917

Is operative delivery associated with postnatal back pain at eight weeks and eight months? A cohort study
Patel, R. R., Peters, T. J., Murphy, D. J.
Acta obstetricia et gynecologica Scandinavica, 2007/11
918

Using integrative therapies to treat women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2007/11
Free full text
919

Schmerzsyndrome in der Regio Inguinalis
(Pain syndroms of the inguinal region)
Beck, M.
Osteopathische Medizin, 2007/10
920

Manuelle Medizin wirkt auf schmerzhemmende Systeme!
(Manual medicine acts on pain inhibitory systems)
Locher, H., Sell, K.
Osteopathische Medizin, 2007/10
921

Hat die osteopathische Behandlung einen positiven Effekt bei Frauen mit persistierenden Rückenschmerzen post partum? Eine randomisierte kontrollierte Studie
(Study on the effectiveness of osteopathic treatment for women with persistent post partum back pain. A randomized controlled trial)
Recknagel, C., Roß, J.
Unpublished D.O. thesis, 2007/10
922

Chronic pelvic pain: Pelvic floor problems, sacro-iliac dysfunction and the trigger point connection
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2007/10
923

Stellt die osteopathische Behandlung von Patienten mit chronischer Zervikalgie eine wirksame Alternative zur Physiotherapie dar? Eine randomisierte kontrollierte Studie
(Osteopathy as an efficient treatment alternative to physical therapy for patients suffering from chronic non specific neck pain? A randomized controlled trial)
Steffen, S., Tempel, R.
Unpublished D.O. thesis, 2007/10
924

Effektivität der osteopathischen Behandlung bei Patienten mit Patellofemoralen Schmerzsyndrom. Eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with patellofemoral pain syndrome. A randomized controlled trial)
Wendel, J., Rudisch, B., Berger, G.
Unpublished D.O. thesis, 2007/10
925

An investigation into the efficacy of strain-counterstrain technique to produce immediate changes in pressure pain thresholds in symptomatic subjects
Hutchinson, J. R.
Unpublished MSc thesis, 2007/09
926

Role of osteopathic manipulative treatment in altering pain biomarkers: a pilot study
Degenhardt, B. F., Darmani, N. A., Johnson, J. C., Towns, L. C., Rhodes, D. C., Trinh, C., McClanahan, B., DiMarzo, V.
The Journal of the American Osteopathic Association, 2007/09
Free full text
927

Neuromusculoskeletal Causes of Back Pain in Competitive Figure Skaters
Goldman, S. I., Moyer, M.
The AAO Journal, 2007/06
Free full text
928

Editorial comment on ‘developing clinical guidelines for the physiotherapy management of whiplash associated disorder (WAD)’ by C. Mercer, A. Jackson and A. Moore
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2007/06
929

Should your GP be an osteopath? Patients' views of an osteopathy clinic based in primary care
Westmoreland, J. L., Williams, N. H., Wilkinson, C., Wood, F., Westmoreland, A.
Complementary Therapies in Medicine, 2007/06
Free full text
930

Developing clinical guidelines for the physiotherapy management of whiplash associated disorder (WAD)
Mercer, C., Jackson, A., Moore, A.
International Journal of Osteopathic Medicine, 2007/06
931

Optimising the psychological benefits of osteopathy
Williams, N. H.
International Journal of Osteopathic Medicine, 2007/06
932

Eine Einführung in die Harmonischen Techniken
(An introduction to Harmonic Technique)
Lederman, E.
Osteopathische Medizin, 2007/05
933

Attitudes to back pain amongst musculoskeletal practitioners: a comparison of professional groups and practice settings using the ABS-mp
Pincus, T., Foster, N. E., Vogel, S., Santos, R., Breen, A., Underwood, M.
Manual Therapy, 2007/05
934

Integration of osteopathic manipulative medicine into differential diagnosis training: A study evaluating teaching strategies and their influence on student learning
Irvine-Moore, L. R.
Unpublished MSc thesis, 2007/05
935

Cervicobrachialgia. Efficiency and Effectiveness of Osteopathic Treatment in Comparison with Conventional Ultrasound Therapy
Rumer, H.
Unpublished MSc thesis, 2007/03
Free full text
936

A Case Study on the Osteopathic Approach to Chronic Low Back Pain and Radiculopathy
Schmied, A.
Unpublished MSc thesis, 2007/03
Free full text
937

Is it possible to intensify the effect of an osteopathic treatment through automobilisation (in a structural and visceral way), regarding success of treatment and long-term result instancing chronic low back pain patients?
Bilgeri, E.
Unpublished MSc thesis, 2007/03
Free full text
938

The Influence of osteopathy on the vegetative nervous system in chronic pain patients
Fürpaß, E.
Unpublished MSc thesis, 2007/03
Free full text
939

Sensory motor training for active completion of the osteopathic treatment
Mätzler, M.
Unpublished MSc thesis, 2007/03
Free full text
940

Back pain and the homoeostatic requirements of the spinal system
Brownhill, K.
International Journal of Osteopathic Medicine, 2007/03
941

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03
942

Erratum to “The effectiveness of non-invasive treatments for active myofascial trigger point pain: A systematic review of the literature” [International Journal of Osteopathic Medicine 9 (2006) 120–136]
Rickards, L. D.
International Journal of Osteopathic Medicine, 2007/03
943

Validity of an electronic pressure algometer
Vaughan, B., McLaughlin, P., Gosling, C.
International Journal of Osteopathic Medicine, 2007/03
944

Influence of Osteopathic Treatment on Congestive Menstrual Disorders and Premenstrual Syndrome
Riepler-Reisecker, I.
Unpublished MSc thesis, 2007/01
Free full text
945

Changing the practice of osteopaths, chiropractors and musculoskeletal physiotherapists in relation to the management of low back pain
Evans, D. W.
Unpublished PhD thesis, 2007/01
946

OMT for Post-mastectomy Lymphedema and Rib Pain: Case Report
Bradshaw, D., Snider, K.
The AAO Journal, 2006/12
Free full text
947

The effectiveness of non-invasive treatments for active myofascial trigger point pain: A systematic review of the literature
Rickards, L. D.
International Journal of Osteopathic Medicine, 2006/12
948

Algometer reliability in measuring pain pressure threshold over normal spinal muscles to allow quantification of anti-nociceptive treatment effects
Potter, L., McCarthy, C., Oldham, J.
International Journal of Osteopathic Medicine, 2006/12
949

Pelvic Pain Due to Placement of the Vaginal Cuff after Hysterectomy: Case Report and Osteopathic Manipulative Approach to Treatment
Pasquarello, G. J.
The AAO Journal, 2006/12
Free full text
950

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11
951

Osteopathische Behandlung von Frauen mit Rückenschmerzen während der Schwangerschaft. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of women with low back pain during pregnancy. A randomized controlled trial)
van der Linde, M., Peters, R.
Unpublished D.O. thesis, 2006/10
952

Osteopathic reasoning for the treatment of low back pain
Rennie, P. R.
Manuelle Medizin, 2006/10
953

Unspezifische, pseudoradikuläre Schmerzen nach lumbaler Bandscheibenoperation
(Nonspecific, pseudoradicular low back pain after lumbar nucleotomy)
Müller, P.
Unpublished D.O. thesis, 2006/10
954

The effectiveness of a holistic osteopathic treatment in subacute low back pain. A randomized controlled trial
Heinze, G.
Unpublished D.O. thesis, 2006/10
955

Palpation of the sacroiliac joint: An anatomical and sensory challenge
McGrath, M. C.
International Journal of Osteopathic Medicine, 2006/09
956

Interexaminer reliability of three methods of combining test results to determine side of sacral restriction, sacral base position, and innominate bone position
Tong, H. C., Heyman, O. G., Lado, D. A., Isser, M. M.
The Journal of the American Osteopathic Association, 2006/08
Free full text
957

Blinding protocols, treatment credibility, and expectancy: methodologic issues in clinical trials of osteopathic manipulative treatment
Licciardone, J. C., Russo, D. P.
The Journal of the American Osteopathic Association, 2006/08
Free full text
958

Cochrane Library's summary of review on manipulative treatment misleading, cheats readers
Michaud, R. G.
The Journal of the American Osteopathic Association, 2006/07
Free full text
959

Post Operative Osteopathic Manipulative Protocol for Delivery by Students in an Allopathic Environment
Clark, R. C., McCombs, T. M.
The AAO Journal, 2006/06
Free full text
960

Psychology and low back pain
Bogduk, N.
International Journal of Osteopathic Medicine, 2006/06
961

Sciatic Neuritis: A Research Study
Beal, M. C.
The AAO Journal, 2006/06
Free full text
962

Osteopathy and pain: Does psychology matter?
Pincus, T.
International Journal of Osteopathic Medicine, 2006/06
963

A systematic review of systematic reviews of spinal manipulation
Ernst, E., Canter, P. H.
Journal of the Royal Society of Medicine, 2006/04
Free full text
964

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain: A pilot study
Alvizatos, J., Lamaro, J., Fryer, G.
International Journal of Osteopathic Medicine, 2006/03
965

Attitudes to back pain amongst musculoskeletal practitioners: differences and similarities between professional groups and practice settings using the Attitudes to Back Pain Scale—Musculoskeletal Practitioners (ABS-mp)
Vogel, S., Pincus, T., Foster, N. E., Breen, A. C., Underwood, M.
International Journal of Osteopathic Medicine, 2006/03
966

Intraexaminer Reliability of Identifying a Dysfunctional Segment in the Thoracic and Lumbar Spine
Potter, L., McCarthy, C., Oldham, J.
Journal of Manipulative and Physiological Therapeutics, 2006/03
967

Does osteopathic treatment have an influence on the symptoms of patients with chronic prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial
Marx, S.
International Journal of Osteopathic Medicine, 2006/03
968

Die Neue Schmerz- und Organtherapie (NPSO) nach Rudolf Siener - Geschichte und Anwendung
(The new pain and organ therapy (NPSO) according to Rudolf Siener - History and application)
Münch, M., Kaufmann, W.
Osteopathische Medizin, 2006/02
969

Low back pain in pregnancy - do Austrian women know about the osteopathic approach?
Albrecht, M.
Unpublished MSc thesis, 2006/01
Free full text
970

Immediate changes in radiographically determined lateral flexion range of motion following a single cervical HVLA manipulation in patients presenting with mechanical neck pain: A case series
Fernández-de-las-Peñas, C., Downey, C., Miangolarra-Page, J. C.
International Journal of Osteopathic Medicine, 2005/12
971

American Osteopathic Association adopts policies on treatment of patients in pain: an overview
D'Alonzo, G. E., Jr., Stipp
The Journal of the American Osteopathic Association, 2005/11
Free full text
972

Haben osteopathische Behandlungen einen Einfluss auf die Symptome bei Patienten mit chronischer abakterieller Prostatitis/chronischem Beckenschmerzsyndrom ? Eine randomisierte kontrollierte Studie
(Does an osteopathic treatment have an influence on the symptoms of patients with a chronic abacterial prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial)
Marx, S.
Unpublished D.O. thesis, 2005/10
973

The effect of manual pressure release on myofascial trigger points in the upper trapezius muscle
Fryer, G., Hodgson, L.
Journal of Bodywork and Movement Therapies, 2005/10
974

Interventional pain management: an overview for primary care physicians
Boyajian, S. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text
975

Pelvic postural asymmetry revisited
Davidson, S. M., Juhl, J. H.
The Journal of the American Osteopathic Association, 2005/09
Free full text
976

Management of neuropathic pain
Galluzzi, K. E.
The Journal of the American Osteopathic Association, 2005/09
Free full text
977

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text
978

An osteopathic approach to treating women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2005/09
Free full text
979

The cranio-cervical flexion test using pressure biofeedback: A useful measure of cervical dysfunction in the clinical setting?
Hudswell, S., von Mengersen, M., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09
980

Osteopathic manipulative treatment for low back pain: a systematic review and meta-analysis of randomized controlled trials
Licciardone, J. C., Brimhall, A. K., King, L. N.
BMC Musculoskeletal Disorders, 2005/08
Free full text
981

Testing the effectiveness of an innovative information package on practitioner reported behaviour and beliefs: the UK Chiropractors, Osteopaths and Musculoskeletal Physiotherapists Low back pain ManagemENT (COMPLeMENT) trial
Evans, D. W., Foster, N. E., Underwood, M., Vogel, S., Breen, A. C., Pincus, T.
BMC Musculoskeletal Disorders, 2005/07
Free full text
982

Preoperative intravenous morphine sulfate with postoperative osteopathic manipulative treatment reduces patient analgesic use after total abdominal hysterectomy
Goldstein, F. J., Jeck, S., Nicholas, A. S., Berman, M. J., Lerario, M.
The Journal of the American Osteopathic Association, 2005/06
Free full text
983

Psychosocial factors in osteopathic practice: To what extent should they be assessed?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/06
984

The UK BEAM trial – a review and discussion
Vogel, S., Dear, J., Evans, D. W.
International Journal of Osteopathic Medicine, 2005/06
985

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain: A pilot study
Fryer, G., Alvizatos, J., Lamaro, J.
International Journal of Osteopathic Medicine, 2005/06
986

IM ketorolac versus OMT: was agent at peak analgesic effect in JAOA study?
Coston, J. L., McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
987

Sources of bias in reviews of spinal manipulation for back pain
Canter, P. H., Ernst, E.
Wiener Klinische Wochenschrift, 2005/05
988

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text
989

Pain management in end-of-life care
Leleszi, J. P., Lewandowski, J. G.
The Journal of the American Osteopathic Association, 2005/03
Free full text
990

The effect of osteopathy in the treatment of chronic low back pain – a feasibility study
Kirk, L., Underwood, M., Chappell, L., Martins-Mendez, M., Thomas, P.
International Journal of Osteopathic Medicine, 2005/03
991

Intramuscular ketorolac versus osteopathic manipulative treatment in the management of acute neck pain in the emergency department: a randomized clinical trial
McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/02
Free full text
992

Chronic low back pain: osteopaths' attitudes and management
Griffiths, L.
Unpublished MSc thesis, 2005/01
Free full text
993

The effect of a muscle energy stretch on suboccipital tenderness
Boswell, C.
Unpublished MSc thesis, 2005/01
Free full text
994

Melburnian women's use of osteopathy as therapy for low back pain and posterior pelvic pain during pregnancy
Burns, C.
Unpublished MSc thesis, 2005/01
Free full text
995

Melburnian women's use of osteopathy as therapy for low back pain and posterior pelvic pain during pregnancy
Burns, C.
Unpublished MSc thesis, 2005/01
Free full text
996

The effect of mobilisation on pressure pain thresholds in the lumbar spine
Medle, M.
Unpublished MSc thesis, 2005/01
Free full text
997

The relative effectiveness of muscle energy technique as opposed to specific passive mobilization in the treatment of acute and sub-acute mechanical low back pain
Pillay, K.
Unpublished MSc thesis, 2005/01
Free full text
998

The effect of a single application of muscle energy technique on pressure pain thresholds in the lumbar spine
Rogers, T.
Unpublished MSc thesis, 2005/01
Free full text
999

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1000

Subakuter Rückenschmerz: Osteopathie als nützliche und kosteneffektive Ergänzung der Routinebehandlung
(Subacute spinal pain: Osteopathy as a useful and cost effecticve add-on to usual care)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1001

Spondylodiszitis
(Spondylodiscitis)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1002

Cognitive bias in back pain patients attending osteopathy: testing the enmeshment model in reference to future thinking
Read, J., Pincus, T.
European Journal of Pain, 2004/12
1003

Cost-utility analysis of osteopathy in primary care: results from a pragmatic randomized controlled trial
Williams, N. H., Edwards, R. T., Linck, P., Muntz, R., Hibbs, R., Wilkinson, C., Russell, I., Russell, D., Hounsome, B.
Family Practice, 2004/12
Free full text
1004

The unique role of osteopathic physicians in treating patients with low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/11
Free full text
1005

Kann eine osteopathische Behandlung die Dyspareunie beeinflussen?
(Can patients, suffering from Dyspareunia, expect improvement from an osteopathic treatment? A controlled and prospective trial)
Hoffmann, A., Band, I.
Unpublished D.O. thesis, 2004/10
1006

Anatomical observations related to radiological findings in spina bifida occulta of the lumbosacral spine
McGrath, M. C., Tayles, N.
Journal of Osteopathic Medicine, 2004/10
1007

The effectiveness and efficiency of a primary care osteopathy clinic for spinal pain
Williams, N. H.
Unpublished PhD thesis, 2004/10
1008

Effectiveness and efficiency of a primary care based osteopathy clinic for spinal pain
Williams, N. H.
Unpublished PhD thesis, 2004/10
Free full text
1009

Chronic Pelvic Pain Syndrome
Rossi, P. J., Dickey, J. L.
The AAO Journal, 2004/09
Free full text
1010

Wirksamkeit der Manipulation bei der Behandlung von Lumbago: Die Gültigkeit der Schlussfolgerungen bei Metaanalysen
(Effectiveness of manipulation in the treatment of low back pain: Validity of the conclusions in metaanalyses)
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Osteopathische Medizin, 2004/08
1011

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text
1012

Osteopathische versus orthopädische Behandlung der chronischen Epicondylopathia humeri radialis: Eine randomisiert kontrollierte Untersuchung.
[Osteopathic versus orthopedic treatments for chronic epicondylopathia humeri radialis: a randomized controlled trial]
Geldschlager, S.
Forschende Komplementärmedizin, 2004/05
1013

Use of osteopathic or chiropractic services among people with back pain: a UK population survey
Ong, C.K., Doll, H., Bodeker, G., Stewart-Brown, S.
Health & Social Care in the Community, 2004/05
1014

The effect of manipulation and mobilisation on pressure pain thresholds in the thoracic spine
Fryer, G., Carub, J., McIver, S.
Journal of Osteopathic Medicine, 2004/04
1015

Breathing pattern disorders, motor control, and low back pain
Chaitow, L.
Journal of Osteopathic Medicine, 2004/04
1016

Akuter Lumbago - ein funktioneller Ansatz
(Acute lumbago: a functional approach)
Debroux, J.J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1017

Sturzgeburt und fasziales System
(Precipitate labor and fascial system)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1018

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text
1019

Efficacy of manipulation in low back pain treatment: The validity of meta-analysis conclusions
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Journal of Bodywork and Movement Therapies, 2004/01
1020

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain
Alivizatos, J.
Unpublished MSc thesis, 2004/01
Free full text
1021

Pain, depression, anxiety and disability in back pain: do people seeking osteopathic treatment fit known profiles?
Delaney, C.
Unpublished MSc thesis, 2004/01
Free full text
1022

Frequency and duration of low back pain in female hockey players compared to two other populations
Edwards, F.
Unpublished MSc thesis, 2004/01
Free full text
1023

The importance of an early positive change in pain and function in determining overall clinical improvement following strengthening treatment for chronic neck pain
Harding, L.
Unpublished MSc thesis, 2004/01
Free full text
1024

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain
Lamaro, J.
Unpublished MSc thesis, 2004/01
Free full text
1025

The relationship between hip internal rotation and groin pain in elite Australian Rules Football players
McKay, N., Hynes, J., McLaughlin, P.
Unpublished MSc thesis, 2004/01
Free full text
1026

Emu oil for osteoarthritic hand pain
Power, R.
Unpublished MSc thesis, 2004/01
Free full text
1027

The effect of manipulation on pressure pain thresholds in the lumbar spine in asymptomatic participants
Wallis, C.
Unpublished MSc thesis, 2004/01
Free full text
1028

Randomized osteopathic manipulation study (ROMANS): pragmatic trial for spinal pain in primary care
Williams, N. H., Wilkinson, C., Russell, I., Edwards, R. T., Hibbs, R., Linck, P., Muntz, R.
Family Practice, 2003/12
Free full text
1029

Review of integrated neuromusculoskeletal release and the novel application of a segmental anterior/posterior approach in the thoracic, lumbar, and sacral regions
Danto, J. B.
The Journal of the American Osteopathic Association, 2003/12
Free full text
1030

Hat die osteopathische Behandlung bei Frauen mit menstrueller Migräne einen Effekt?
(The osteopathic treatment of menstrual migraine)
Ecker, H., Thomas, C.
Unpublished D.O. thesis, 2003/10
1031

Study to evaluate osteopathic treatment in late whiplash syndrome
(Study to evaluate osteopathic treatment in late whiplash syndrome)
Gietz, R., Kaiser, A., Kastner, K.
Unpublished D.O. thesis, 2003/10
1032

Osteopathische Selbsthilfe bei Unterleibsschmerzen und Beckenbodendysfunktion
(Osteopathic self-help for abdominal pain and pelvic floor dysfunction)
Tettambel, M. A.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
1033

Place de l’acupuncteur et du thérapeute manuel dans la prise en charge pluridisciplinaire des douloureux chroniques
(Place of acupuncturist and osteopath in multidisciplinary chronic pain management)
Meas, Y., Nizard, J., Rouxeville, Y., Lajat, Y.
Douleur et Analgesie, 2003/09
1034

Muscle energy technique in patients with acute low back pain: a pilot clinical trial
Wilson, E., Payton, O., Donegan-Shoaf, L., Dec, K.
Journal of Orthopaedic & Sports Physical Therapy, 2003/09
1035

Osteopathic manipulative treatment for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Stoll, S. T., Fulda, K. G., Russo, D. P., Siu, J., Winn, W., Swift, J.
Spine (Phila Pa 1976), 2003/07
1036

Schlüsselfunktionen des Peritoneums bei Rückenschmerzen
(Key functions of the peritoneum in back pain)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
1037

Bauchschmerzen - Wer untersucht? Wer behandelt?
(Abdominal pain - Who examines? Who treats?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
1038

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
1039

Spinal manipulation for low-back pain: a treatment package agreed to by the UK chiropractic, osteopathy and physiotherapy professional associations
Harvey, E., Burton, A. K., Moffett, J. K., Breen, A.
Manual Therapy, 2003/02
1040

The effect of mobilisation on pressure pain thresholds in the thoracic spine
Carub, J.
Unpublished MSc thesis, 2003/01
Free full text
1041

Osteopathic treatments and the techniques used in the treatment of acute mechanical low back pain
Daskalou, D.
Unpublished MSc thesis, 2003/01
Free full text
1042

The effect of manipulation on pressure pain thresholds in the thoracic spine
McIver, S.
Unpublished MSc thesis, 2003/01
Free full text
1043

Etiology of lumbar pain in pregnancy
Rodriguez, W.
Unpublished MSc thesis, 2003/01
Free full text
1044

Re-discovery of self: the impact of osteopathic treatment on women who suffer from perimenstrual low backache
Lonergan, B.
Unpublished PhD thesis, 2003/01
1045

Die Arthrose in die Knie gezwungen? Studie zu chronisch-degenerativen Knie- bzw. Hüftschmerzen
(Osteoarthritis brought to its knees? Study on chronic degenerative knee or hip pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
1046

Das schmerzhafte Knie: Eine Übersicht
(The painful knee: an overview)
Resch, K.L., Bachem, S., Salzmann, I., Schwartz, U., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
1047

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
1048

Die osteopathische Behandlung der chronischen Zervikalgie. Eine randomisierte kontrollierte Studie
(Osteopathy alleviates pain in chronic non-specific neck pain: A randomized controlled trial)
Bischoff, P., Nürnberger, A., Voigt, A.
Unpublished D.O. thesis, 2002/10
1049

Die therapeutische Wirksamkeit einer osteopathischen Behandlung beim Reizdarmsyndrom: Eine randomisierte kontrollierte Studie
(Osteopathy as a promising short-term strategy for irritable bowel syndrome: randomized controlled trial)
Müller, A., Salomon, J., Stiedl, M.
Unpublished D.O. thesis, 2002/10
1050

Osteopathy for Back- and Pelvic Pain in Pregnancy
Kofler, G.
Unpublished MSc thesis, 2002/09
Free full text
1051

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text
1052

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
1053

Osteopathic manipulative treatment in conjunction with medication relieves pain associated with fibromyalgia syndrome: results of a randomized clinical pilot project
Gamber, R. G., Shores, J. H., Russo, D. P., Jimenez, C., Rubin, B. R.
The Journal of the American Osteopathic Association, 2002/06
Free full text
1054

Mechanisms and effects of spinal high-velocity, low-amplitude thrust manipulation: previous theories
Evans, D. W.
Journal of Manipulative and Physiological Therapeutics, 2002/05
1055

Unrelenting Abdominal Pain of Elusive Origin: A Case Study
Chapello, I. A., Templin, M. A.
The AAO Journal, 2002/03
Free full text
1056

Improved Pain Score Outcomes Achieved Through The Cooperative And Cost-Effective Use Of Physical (Osteopathic Manipulative) Medicine In The Treatment Of Outpatient Musculoskeletal Complaints
Lipton, J. A., Meneses, P., Martin, J. B., Mizera, A. C., Kappler, R. E., Brooks, J. S., Parr, C.
The AAO Journal, 2002/03
Free full text
1057

Effektivität einer osteopathischen Behandlung bei chronischem Knieschmerz
(Effectiveness of an osteopathic treatment in patients with chronic knee pain)
Bachem, U., Salzmann, S., Schwartz, I.
Unpublished D.O. thesis, 2001/10
1058

A Study to Evaluate the Prognostic validity of Three Clinical Tests Serving as an Indicator of Dysfunction of the Sacroiliac Joint and Low Back Pain
Jung, J.
Unpublished MSc thesis, 2001/10
1059

The value of magnetic resonance imaging of the lumbar spine to predict low-back pain in asymptomatic subjects: a seven-year follow-up study
Borenstein, D. G., O'Mara, J. W., Boden, S. D., Lauerman, W. C., Jacobson, A., Platenberg, C., Schellinger, D., Wiesel, S. W.
Journal of Osteopathic Medicine, 2001/10
1060

Review of the literature prognostic values of physical examination findings in patients with chronic low back pain treated conservatively: A systematic literature review
Borge, J. A., Leboeuf-Yde, C., Lothe, J.
Journal of Osteopathic Medicine, 2001/10
1061

Reviews of the literature efficacy of spinal manipulation for chronic headache: A systematic review
Bronfort, G., Assendelft, W., Evans, R., Haas, M., Bouter, L. M.
Journal of Osteopathic Medicine, 2001/10
1062

Patient positioning and spinal locking for lumbar spine rotation manipulation
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10
1063

The percentage improvement in pain scale as a measure of physiotherapy treatment effects
Gridley, L., Van den Dolder, P.
Journal of Osteopathic Medicine, 2001/10
1064

Long-term effects of specific stabilizing exercises for first-episode low back pain
Hides, J., Jull, G., Richardson, C.
Journal of Osteopathic Medicine, 2001/10
1065

Spinal manipulation causes variable spine kinematic and trunk muscle electromyographic responses
Lehman, G. J., McGill, S. M.
Journal of Osteopathic Medicine, 2001/10
1066

Should we give detailed advice and information booklets to patients with back pain? A randomised controlled factorial trial of a self-management booklet and doctor advice to take exercise for back pain
Little, P., Roberts, L., Blowers, H., Garwood, J., Cantrell, T., Langridge, J., Chapman, J.
Journal of Osteopathic Medicine, 2001/10
1067

Thoracic spine dysfunction in upper extremity complex regional pain syndrome type I
Menck, J. Y., Requejo, S. M., Kulik, K.
Journal of Osteopathic Medicine, 2001/10
1068

The efficacy of adjusting the ankle in the treatment of subacute and chronic grade I and grade II ankle inversion sprains
Pellow, J. E., Brantingham, J. W.
Journal of Osteopathic Medicine, 2001/10
1069

Specific manipulative therapy treatment for chronic lateral epicondylalgia produces uniquely characteristic hypoalgesia
Vicenzino, B., Paungmali, A., Buratowski, S., Wright, A.
Journal of Osteopathic Medicine, 2001/10
1070

Efficacy of spinal manipulation for chronic headache: A systematic review
Bronfort, G.
Journal of Manipulative and Physiological Therapeutics, 2001/09
1071

Osteopathic manipulative treatment of low back pain during labor
Carpenter, S., Woolley, A.
The AAO Journal, 2001/09
1072

Recall bias, pain, depression and cost in back pain patients
Pincus, T., Newman, S.
British Journal of Clinical Psychology, 2001/06
1073

Innovative approach to headaches
Mellick, G. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text
1074

Are neck flexion, neck rotation, and sitting at work risk factors for neck pain? Results of a prospective cohort study
Ariëns, G. A. M., Bongers, P. M., Douwes, M., Miedema, M. C., Hoogendoorn, W. E., van der Wal, G., Bouter, L. M., van Mechelen, W.
Journal of Osteopathic Medicine, 2001/04
1075

Chronic pain in Australia: a prevalence study
Blyth, F. M., March, L. M., Brnabic, A. J., Jorm, L. R., Williamson, M., Cousins, M. J.
Journal of Osteopathic Medicine, 2001/04
1076

A randomized clinical trial of exercise and spinal manipulation for patients with chronic neck pain
Bronfort, G., Evans, R., Nelson, B., Aker, P. D., Goldsmith, C. H., Vernon, H.
Journal of Osteopathic Medicine, 2001/04
1077

Pelvic skeletal asymmetry, postural control, and the association with low back pain: A review of the evidence
Egan, D. A., Al-Eisa, E.
Journal of Osteopathic Medicine, 2001/04
1078

A study to investigate whether golfers with a history of low back pain show a reduced endurance of transverse abdominis
Evans, C., Oldreive, W.
Journal of Osteopathic Medicine, 2001/04
1079

Extensibility and stiffness of the hamstrings in patients with nonspecific low back pain
Halbertsma, J. P. K., Göeken, L. N. H., Hof, A. L., Groothoff, J. W., Eisma, W. H.
Journal of Osteopathic Medicine, 2001/04
1080

Pressure pain threshold and needle acupuncture in chronic tension-type headache- a double-blind placebo-controlled study
Karst, M., Rollnik, J. D., Fink, M., Reinhard, M., Piepenbrock, S.
Journal of Osteopathic Medicine, 2001/04
1081

A systematic review of workplace interventions to prevent low back pain
Maher, C. G.
Journal of Osteopathic Medicine, 2001/04
1082

Pain management in osteopathic medicine: The efficacy of flotation REST as an adjunct to spinal manipulation for acute non-specific low back pain. A case report
Rogan, A., Morris, T., Gibbons, P.
Journal of Osteopathic Medicine, 2001/04
1083

Balanced on a tight rope between low back pain and evidence-based practice
Shacklock, M.
Journal of Osteopathic Medicine, 2001/04
1084

Centralization phenomenon as a prognostic factor for chronic low back pain and disability
Werneke, M., Hart, D. L.
Journal of Osteopathic Medicine, 2001/04
1085

Characteristics of a mechanical assessment for chronic lumbar facet joint pain
Young, S., Aprill, C.
Journal of Osteopathic Medicine, 2001/04
1086

Osteopathic treatment considerations for rheumatic diseases
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
1087

Osteopathic medicine in the treatment of low back pain
Newswanger, D. L., Patel, A. T., Ogle, A.
American Family Physician, 2000/12
Free full text
1088

Low back pain: Cost and treatment
Swords, W. J.
The AAO Journal, 2000/12
Free full text
1089

The clinical spectrum of acute coronary syndromes
Rogers, F. J.
The Journal of the American Osteopathic Association, 2000/11
Free full text
1090

Individualizing treatment plan and combining approaches key to pain management and holistic care: a student's perspective
Lawlor, T. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text
1091

Headache as a manifestation of otolaryngologic disease
Cosenza, M. J.
The Journal of the American Osteopathic Association, 2000/09
Free full text
1092

Patients' satisfaction with osteopathic and GP management of low back pain in the same surgery
Pincus, T., Vogel, S., Savage, R., Newman, S.
Complementary Therapies in Medicine, 2000/09
1093

Osteopathic treatment of low back pain
Sweetman, B. J.
The New England Journal of Medicine, 2000/03
1094

Lift Treatment in Naval Special Warfare (NSW) Personnel: A Retrospective Study
Lipton, J. A., Brooks, J. S., Hickey, M. J., Drew, B. G., Eggleston, M. T., Gemmer, C. H.
The AAO Journal, 2000/03
Free full text
1095

Osteopathic treatment of low back pain
Cherkin, D.
The New England Journal of Medicine, 2000/03
1096

Osteopathic treatment of low back pain
Foster, D., Johnson, M. D., Harrelson, A.
The New England Journal of Medicine, 2000/03
1097

Osteopathic treatment of low back pain
Oppenheim, J. S.
The New England Journal of Medicine, 2000/03
1098

Paradox answered
Parker, C.
The Journal of the American Osteopathic Association, 2000/02
Free full text
1099

The economic burden of back pain in the UK
Maniadakis, N., Gray, A.
Pain, 2000/01
1100

A comparison of osteopathic spinal manipulation with standard care for patients with low back pain
Andersson, G. B., Lucente, T., Davis, A. M., Kappler, R. E., Lipton, J. A., Leurgans, S.
The New England Journal of Medicine, 1999/11
Free full text
1101

(Osteopathic treatment of chronic low back pain. A randomized controlled trial)
Osteopathische Behandlung der chronischen Lumbalgie
Adorjàn-Schaumann, A., Höhrhan, G., Wille, H., Wolff, A.
Unpublished D.O. thesis, 1999/10
1102

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain. A randomized controlled trial)
Adorjàn-Schaumann, A., Höhrhan, G., Wille, H., Wolff, A.
Unpublished D.O. thesis, 1999/10
1103

The origin and relief of common pain
Irvin, R. E.
Journal of Back and Musculoskeletal Rehabilitation, 1998/09
1104

Positional release techniques in the treatment of muscle and joint dysfunction
Chaitow, L.
Clinical Bulletin of Myofascial Therapy, 1998/01
1105

Low back pain: Evaluation of osteopathic manipulation therapy via integration and power spectrum of electromyography and psychophysical-physical analysis
Park, H. K.
Unpublished PhD thesis, 1993/01
1106

Lower back pain: Evaluation of osteopathic manipulation therapy via magnetic resonance imaging and biomechanical modeling
Sumer, A.
Unpublished PhD thesis, 1993/01
1107

Low back pain: Evaluation of osteopathic manipulation therapy via biomechanical modeling, electromyography, muscle rigidity and pain quantification
Bolecek-Skeggs, C. M.
Unpublished PhD thesis, 1990/01
 
 
 






  • Impressum • Legal notice • Datenschutz •


ostlib.de/advanced



Supported by

OSTLIB recommends