Advanced search



 
 82.7% of the records
 
 17.3 % of the records
 
 55.7 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Medically Underserved Area*Osteopathic Medicine*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabducens nerveabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsolute alpha powerabstractabstractsacademicacademic barrieracademic difficultiesacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic surgeryacademies and institutesacademy of osteopathyaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive release techniqueactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadmissionadmission criteriaadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced trainingadvancing TBI careadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective empathyaffective touchafferenceAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcoholismalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltingAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappraisalsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismArcticarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory test foilartifical intelligenceartificial jointartificial respirationartificial ventilationartilcleartsartticleasanaaspirationassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical swallowingaudiovisual aidsauditory canalauditory channelauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawards and prizesawarenessawareness of spaceaxesaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberinebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioenergetic modelbioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumabladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood supplyblood systemblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrand disputeBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksC-reactive proteinC-tactileC-tactile afferentsC. BowlesC. DoveC. J. Smutny IIIC. S. GonsteadC. SteeleC. WeaverC1cability crisiscadavercadaver dissectioncadaveric dissectioncadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciumcalfCaliforniacaloric restrictioncalot’s triangleCAMCanadaCanadiancanal syndromecancercancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecarbon dioxidecarbon emissionscarcinoid tumorcarcinomacardiac arrestcardiac frequencycardiac implantable electronic devicecardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase reportcase reportscase seriescase studycase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicothoracic diaphragmcervicothoracic junctioncesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wall defectchewingChiari I malformationChicagoChicago College of Osteopathic Medicinechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communitychinese medicinechinese traditional medicinechiropracticchiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclavicleclavicle fractureCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoituscold temperaturecoliccolitis ulcerosacollaborationcollagencollagen fiberscollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasesColoradocolorectal endometriosisCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phasecongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontol interventionscontraceptive carecontract governing medical treatmentcontractilitycontractioncontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapycooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilitycostal cartilagescostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial volumecranial-sacral-motioncraniocranio sacral osteopathycranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutionculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniquecybernetic systemcyberneticscynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. HerbertD. J. ClauwD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latadeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdeglutition disordersdegreesdehydrationdelayed developmentdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissolutiondistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational resourceeducational standardseducational statuseducational technologyeducational toolsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30elastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselbowelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic fieldselectromagnetic interactionelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyempirical approachempirical evidenceempirical researchempiricismemployee disciplineemployment disabilityemu oilenactivismencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineEpley maneuverEpstein-Barr virusEQ-5Dequilibriumeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerythrocyte counterythrocytesesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidenced based osteopathyeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitionexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocular musclesextrinsic sleep disorderseyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial structurefacial tumorsfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitationfactfactor analysisfactual databasesfacultyfaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyfast fourier transformfastingfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst trimester pregnancyfirst year of lifefirst-choice residencyfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexion distraction techniqueflexion rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot lesionsfoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionfracture healingfracturesFraminghamFranceFrankfurt DeclarationFred Mitchellfree energy principlefree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency-tuningfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principlefulcrumfull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilityGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenetic mutationgeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenomicsgentlenessgeodesicgeographic factorsGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingivitisgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral jointglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteus maximusglycated hemoglobin Aglycosylationglygoaminoglycansglymphaticglymphatic systemglymphaticsgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaitihallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand painhand strengthhandballhandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharmonic techniqueharmonic therapyHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead painhead positionhead repositioninghead retraction reflexheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare costhealthcare costshealthcare deliveryhealthcare initiativehealthcare needshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity, low-amplitudeHigher educationhiphip arthroplastyhip dislocationhip dysplasiahip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistorical articlehistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organshome carehome exercisehomeless personshomeless populationhomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axishrvHTA-Report 124humanhuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehumanitiesHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourhurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronic acidhydrationhydraulic mechanismhydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogonadismhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueicosahedronICPideal muscle functionidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimage-guided spine interventionimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantationsimpotenceimpotence medicineimpulsein vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationInfrared thermal camerainfrared thermographyinfraspinatusinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninpatientinpatient outcomeinpatient rehabilitationinpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8Interleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternationalityinternetinternet useinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterviewsintestinalintestinal constipationintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra ocular pressureintra- and inter-rater reliabilityintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemic compressionischemic pressureischialgiaIsele-methodisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohnston’s functional methodsjointjoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejoyful discoursejudgmentjugular compressionjumpingjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketorolac tromethaminekeyword searchkidneykidney mobilitykidney motilitykidney stonekidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory testlaboratory valueslabral tearlacerationslack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislarynxLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture seriesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevel of evidencelevels of anxiety and depressionLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdle muscular dystrophylimb injurieslimb placodelimb symmetrylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylorazepamlordosislordotic angleloss of a childloss of childlovelow anorectal malformationlow backlow back injurylow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelunglung capacitylung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusm. piriformism. rectus capitis posterior minorM. WilsonM. Wyvekensmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratesmatched-pair analysismateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatrix-rhythm-therapymattermaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionmediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical graduatesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmelancholic wholenessmelanomaMelicien TettambelmembranesmemorymenMeniere’s diseasemeningesmeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental disordermental disordersmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticameridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetastasismetastatic abdominal cancermetastudiesmethodismmethodological qualitymethodologymethodsmethyl-sulfonyl-methanemethylprednisolonemetronidazoleMFI-20mfrMFT challenge discmiceMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studymobile appsmobile clinicmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMöbius syndromemolar shimmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRImsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle contractilitymuscle contractionmuscle developmentmuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tendernessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal injurymusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathyMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymytonometryN. Mithanaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessneedle biopsyneedlesneeds assessmentnegentropyNelson-Dennyneonatalneonatal abstinence syndromeneonatal hyperbilirubinemianeonatal intensive care unitneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsnephroptosisnerve activitynerve compressionnerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingneumuscular therapyneuracneural canalneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroinflammationneurokinesiologyneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular junctionneuromuscular rehabilitationneuromuscular systemneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuropsychiatric disorderneuropsychological testsneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotransmissionneurotransmitterneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstetic populationobstetric deliveryobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal planeocclusal splintocclusal splint therapyocclusionocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid use disorderopioid-related disordersopioidsopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoral ?uidoral aversionoral cavityoral diagnosisoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan of perceptionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic manipulationorthopedic proceduresorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteochondrosisosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. KimberlyP. MisslinP. Schwindpad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepaintingspalatal disjunctionpalatine bonepaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackspanic disorderspapillomavirus infectionspapillomavirus vaccinesparaesophageal herniaparafunctionparallel accreditationparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentpartient-reported outcomesparturitionpassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpelvicpelvic adhesionspelvic anatomypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centered carepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalguspharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphytotherapyPIC syndromepicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disordersplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespopulation dynamicspopulation healthpopulation surveillanceportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromeposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencypovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based research networkpracticespractitionersPrader-Willi syndromePrader–Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-menopausal womenpre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive processingpredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnancy trimester,thirdpregnant uteruspregnant womenprejudicepremanipulative screeningprematurepremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologypreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepreserved ejection fraction exacerbationspressurepressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprisonprivate collegesprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsproceduresprocess approachprocessesprocessus styloideusprofesional ethicsprofessionprofessionalprofessional artistryprofessional asscociationprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationProfessional Practice Location/*statistics & numerical dataprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusProfessional surveyprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studyPROMsprone positionproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostata cancerprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disordersPsychosomatic medicinepsychosomatic osteopathypsychosomaticspsychotherapyPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapudental neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testqi gongqigongQLQ-C30qsteopathyquackeryQuadrantanopsiaquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of life,quality of life;quality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiograohyradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsrctre-findingsre-orientation processreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregional Inhibitoryregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseasesrespiratory disordersrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory tract tnfectionsrespiratory volumeresponses to treatmentrespratory infectionsResPubID19525rest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoscopyretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordROIrole playrolfingrolfing methodroll-glidingRollin BeckerromRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroutine examinationroutine findingsroutine physical therapyrowingrual arearual areasrual primary carerule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. Typaldossacral basesacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal regionsacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearsSacroiliac joint testSacroiliac ligamentssacroiliac painsacroiliac regionSacroiliac syndromesacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2sassatisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsscalesscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniascholarshioscholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolsSchools, Medicalsciatic nervesciatic neuritissciatic neuropathysciatic painsciaticasciencescientific journalscientific proofscientific publicationscientific researchscientific writingscientometric analysisScimitar syndromeSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreeningscreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-Managementself-management strategiesself-measurementself-organisationself-perceived perceptionself-perceived- perceptionself-perceived-perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeSevere acute respiratory syndrome coronavirus 2severity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshared decision makingsharing informationsharp painshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshiftworkshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-effectsidebendingSIDSsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulation equipmentsimulation technologiessimulation trainingSimulation Training/*methodssimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusskatersskeletalskeletal muscleskiersskiingskillskills transferskinskin blood flow indexskin burning sensationskin cancerskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmokerssmokingsmoking cessationsmoking preventionsmooth musclesneezingSOAP notessoccersoccer playersoccer playerssoccer,social acceptancesocial aspectssocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial perceptionsocial responsibilitysocial securitySocial skillsocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessofttissue techniquesolar keratosissoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishspanish fluSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspeakingspecial needs childrenspecializationspecialty boardspecialty boardsspecialty trainingspecific adjustmentspecific laryngeal manipulationspecificityspectroscopyspeechspeech acousticsspeech developmentspeech development disordersspeech disorderspeech disordersspeed of blood flowspelling disordersspencer techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolSpine/*metabolismspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesspnal manipulationSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainsSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stephen Tyremanstereoidssterilitysternal painsternal recoil techniquesternotomiesternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoragestrabismstrabismusStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniqueStretchingstretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsStudents, Pharmacystudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubclavian arterysubclavian steal syndromesubcutaneous hemorrhageSubject Headingssubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointSubtle energy measurementsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicidesumatriptanSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperoxide anion radicalssupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessuprarenal gland,supraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurveysSurveys and Questionnairessurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationSynergeticsynostosis sphenooccipitalis,synovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetastwelttattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBI careteachersteachingteaching assistantteaching clinicteaching effectivenessteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteamUP Short-FormteamUP-SFteamworktechnical requirementsTechniquetechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth settingtelemanagementtelemedicinetelemetrytelephonetelescopic bridgeworktemperamenttemperaturetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendonitistendonstenetstennistennis elbowtenotomytensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?TGF-?Thai foot reflex zone massagethai massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical basistheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelsTherapeutic presencetherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal, skin temperaturethermodiagnosisthermographythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree months colicthree-dimensional imagingthree-dimensional printingthroacic transverse processesthroatthrombolytic therapythrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticksticstideTietze syndromeTiffeneau indextilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?tnf-?TNF-atnterpretation analysis comparative studiestobacco use disordertoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstrainingtraining deliverytraining hourstraining programmstraining programstraining requirementstraining supporttranscranial Doppler ultrasonographytranscranial magnetic stimulationtransdisciplinarytransferencetransformation phasestransgendertransgender personstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretrauma-informes caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatically induced lesiontraumatized patientstravelTravell trigger pointstreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerstrimesters of pregnancytrinitytrisomy 21triunetriune mantriune osteopathytriunity Routine-diagnosistroponin itroubles musculo-squelettiquestruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk stabilizationtrunk torsiontrusttruthtruth disclosuretryptaminestuba auditiva techniqueTug navicular techniquetumortumor necrosis factortumor necrosis factor-alphatunnel syndrometurbttutoringtwin pregnancytwinstympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderservedunderserved areaunderserved areasunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionUnified Parkinson Disease Rating Scaleunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beingUniversitiesuniversityuniversity outpatient departmentsunna nevusunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamicsurogenital stage or phallic stageurogenital systemurogenital tracturologic systemurologyurticariaUSAusmleUSMLE scoresUSMLE Step 1usmle step 2uterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvaliditityvalidityvalidity of testsvalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverificationVermontvertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcarewestern worldWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwoman?s organismwomenwomen’s healthworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopworld health organisationWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenZ. ComeauxzenZIMMTzinczinc deficiencyZink modelZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

2328 results (please see below)  Sort:    
1

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06
2

Relational clinical practice: A hermeneutic, enactive, intersubjective model of osteopathy
Banton, A., Vogel, S.
International Journal of Osteopathic Medicine, 2024/03
3

Combating Modern DO Stigmatization
Cooney, A., Vega, L., Goodwin, B. J., Adams, J., Mangrola, F., Price, L. M., Powell, L.
International Journal of Osteopathic Medicine, 2024/03
4

A framework for the interpretation of heart rate variability applied to transcutaneous auricular vagus nerve stimulation and osteopathic manipulation
Kania, A., Roufail, J., Prokop, J., Stauss, H. M.
Physiological Reports, 2024/03
Free full text
5

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/03
Free full text
6

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03
7

Introduction to running analysis in the clinical setting: A masterclass
Tripodi, N., Feehan, J., Corcoran, D., Vaughan, B., McLaughlin, P.
International Journal of Osteopathic Medicine, 2024/03
Free full text
8

Werden osteopathische Studien zu Unrecht methodisch abgewertet?: Über die Ergebnisse einer meta-epidemiologischen Studie hinsichtlich der Verblindung von Teilnehmer*innen in randomisiert kontrollierten Studien
(Are osteopathic studies wrongly methodologically downgraded?: On the results of a meta-epidemiological study regarding the blinding of participants in randomized controlled trials)
Franke, H.
Osteopathische Medizin, 2024/03
Free full text
9

Strain Relief – Teil 2: Technische Ausführung: Behandlung chronischer Schmerzen in der unteren Extremität
(Strain Relief - Part 2: Technical performance: Treatment of chronic pain in the lower extremity)
Liedtke, H.
Osteopathische Medizin, 2024/03
Free full text
10

Das GRADE-System und die Bewertung der Evidenz
(The GRADE system and the evaluation of evidence)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
11

Osteopathie und evidenzbasierte Medizin, Teil 2: Kritik an der EBM
(Osteopathy and evidence-based medicine, part 2: Criticism of EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
12

Funktionelle Anatomie der Interozeption
(Functional anatomy of interoception)
Luthin, D., Neuhuber, W.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
13

Der Schluckakt
(The act of swallowing)
Sergueef, N.
Osteopathische Medizin, 2024/03
Free full text
14

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
15

Aus der digitalen Welt
(From the digital world)
Sonntag, M.
Osteopathische Medizin, 2024/03
Free full text
16

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
17

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03
18

The Sentient Cell: Implications for Osteopathic Medicine
Bordoni, B., Escher, A. R., Castellini, F., Vale, J.
Cureus, 2024/02
Free full text
19

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/02
20

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text
21

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/02
22

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text
23

Analysis of Variation in the Origin of the Obturator Artery in Midwestern American Donor Bodies
Diemer, C., Schubert, B., Funk, S., Markand, S.
Cureus, 2024/02
Free full text
24

Wie wirksam ist die osteopathische Behandlung von Kindern?
(How effective is osteopathic treatment for children?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
25

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
26

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
27

Das Mundatmungssyndrom in der osteopathischen Praxis
(Mouth breathing syndrome in the osteopathic practice)
Keller, M., Brümmer, M., Schulz, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
28

Mitleid und Mitgefühl
(Pity and compassion)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
29

Osteopathie und evidenzbasierte Medizin, Teil 1: die EBM
(Osteopathy and evidence-based medicine, part 1: EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
30

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
31

The effectiveness of an osteopathic manual technique compared with a breathing exercise on vagal tone as indicated by heart rate variability, a crossover study
Cavanagh, M., Cope, T., Smith, D., Tolley, I., Orrock, P., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2024/01
Free full text
32

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text
33

Does Osteopathic Heart-Focused Palpation Modify Heart Rate Variability in Stressed Participants with Musculoskeletal Pain? A Randomised Controlled Pilot Study
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Healthcare, 2024/01
Free full text
34

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/01
Free full text
35

A superficial dissection approach to the sphenopalatine (pterygopalatine) ganglion to emphasize osteopathic clinical relevance
Matz, O. C., Rudberg-Post, L. J., Gustafson, H. C., Matz, D. G.
Journal of Osteopathic Medicine, 2024/01
Free full text
36

„Alles im Griff” – Osteopathischer Universalgriff für das Kniegelenk
(“Everything under control“ - Osteopathic universal grip for the knee joint)
Engel, M.
Osteopathische Medizin, 2023/12
37

Osteopathie als Beruf: Zur Praxeologie des osteopathischen Handelns
(Osteopathy as a profession: The praxeology of osteopathic practice)
Kaiser, A. K.
Osteopathische Medizin, 2023/12
38

Strain Relief – Teil 1: Grundlagen: Ein neues Verfahren zur Behandlung chronischer Schmerzen im Bewegungsapparat am Beispiel von therapieresistenten, funktionellen Beschwerden in der unteren Extremität
(Strain Relief - Part 1: Basics: A new procedure for the treatment of chronic pain in the musculoskeletal system using the example of therapy-resistant, functional complaints in the lower extremities)
Liedtke, H.
Osteopathische Medizin, 2023/12
39

Psychosomatische Osteopathie
(Psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2023/12
40

Besonderheiten osteopathischer Forschung
(Peculiarities of osteopathic research)
Scheuchl, F., Peuker, E., Kamp, R.
Osteopathische Medizin, 2023/12
41

(Gender competence in medicine and osteopathy)
Wikus, P., Wimpissinger, A.
Osteopathische Medizin, 2023/12
42

Power and capital: In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
43

Effects of combined taping of quadriceps and hamstring muscles on pain and disability in patients with knee osteoarthritis: Randomized assessor-blinded controlled study
Mohamed, Y. E., Abd-Alkareem, D. S., Balbaa, A.E. A.A., Samy, M. M., Ashour, R. S.
International Journal of Osteopathic Medicine, 2023/12
44

Application of high-velocity low-amplitude technique in cervicothoracic junction produces cardiovascular responses in subjects with C7-T1 dysfunction: Randomized crossover trial
Zago, J., de Souza, B. U. L., Amatuzzi, F., Rondinel, T. Z., Queiroz, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2023/12
45

An Osteopathic Approach to Urinary Incontinence Including Biopsychosocial Aspects and Multiple Modalities for a Holistic Approach to Optimize Ongoing Care
Trivelas, N., Slaughter, K., Zaremski, K., Kirila, C.
Osteopathic Family Physician, 2023/12
46

Патофизиологические аспекты микрогравитации и гравитационной терапии при сердечно-сосудистых заболеваниях
(Pathophysiological aspects of microgravity and gravity therapy in cardiovascular diseases)
Pereshein, A. V., Kuznetsova, S. V., Petrova, D. A., Potemina, T. E.
Russian Osteopathic Journal, 2023/12
47

(Features of the state of occlusion with partial loss of teeth (literature review))
Zhulev, E. N., Saakyan, M. Y., Vel'makina, I. V., Bragina, O. M., Vokulova, Y. A.
Russian Osteopathic Journal, 2023/12
48

Simplicity of Osteopathy
Fryette, H. H.
The AAO Journal, 2023/12
49

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
50

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12
51

Effectiveness of Osteopathic Tenet Integration into Basic Science Learning Objectives Using Generative Artificial Intelligence
Harp, E., Hughes, G.
Journal of Osteopathic Medicine, 2023/12
52

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12
53

Analyzing ChatGPT’s Proficiency In Multiple Choice Osteopathic Manipulative Medicine Questions: Insights and Implications
Sundin, A., Gawash, A., Zia, H., Lo, D. F., Averell, N., King, A., Powell, L.
Journal of Osteopathic Medicine, 2023/12
54

Augmentation of immune response to vaccinations through osteopathic manipulative treatment: a study of procedure
Sanchez, J., Martinez, E. S., Loveless, B., Sees, J. P., Zammuto, J., Szurmant, H., Fuchs, S., Crone, P., Hostoffer, R.
Journal of Osteopathic Medicine, 2023/11
Free full text
55

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text
56

L’expertise en ostéopathie, une prérogative médicale?
(Legal expertise in osteopathy, a medical privilege?)
Beaume, S.
Medecine et Droit, 2023/10
57

Dermal Reflections of Neural Disorders: An Hypothesis
Patriquin, D. A.
The AAO Journal, 2023/09
58

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text
59

Adductor magnus: Extending the knowledge – A short review of structure and function
Corcoran, D., McNamara, T., Feehan, J., Tripodi, N.
International Journal of Osteopathic Medicine, 2023/09
60

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09
61

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09
62

Klinische Differenzialdiagnostik bei 4–12-jährigen kieferorthopädischen Patienten
(Clinical differential diagnostics in 4-12-year-old orthodontic patients)
Medlitsch, A., Pittschieler, E.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
63

Stomatognathes System: Stellenwert für die Osteopathie
(Stomatognathic system: Significance for osteopathy)
Prätorius, O., Herdick, T.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
64

Die Rolle des Menstruationszyklus bei Sportverletzungen
(The role of the menstrual cycle in sports injuries)
Stierl, J. A., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
65

Mechanische Eigenschaften der Arterien
(Mechanical characteristics of the arteries)
Wyvekens, M., Hirth, T., Wyvekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
66

Модели медицинской реабилитации: проблемы и их решения
(Models of medical rehabilitation: problems and solutions)
Eremushkin, M. A.
Russian Osteopathic Journal, 2023/09
67

Остеопатия в мире современной медицины
(Osteopathy in the world of modern medicine)
Konopleva, E. L., Ostapenko, V. M., Tarasov, N. A.
Russian Osteopathic Journal, 2023/09
68

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09
69

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09
70

The biomechanical links between pelvic floor dysfunction and testicular pain: A clinical review
Jackson, C., Fawcett, L.
Osteopathic Family Physician, 2023/09
71

Short-term effects on heart rate variability of occipito-mastoid suture normalization in healthy subjects
Besson, C., Mur, T., Benaim, C., Schmitt, L., Gremeaux, V.
Frontiers in Neuroscience, 2023/09
Free full text
72

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text
73

Gleichgewicht und Propriozeption
(Balance and proprioception)
Barral, J.P.
Osteopathische Medizin, 2023/09
74

Und die Osteopathie wirkt doch!: Eine Entgegnung zu dem Artikel „Dreimonatskoliken: Alternativmedizin ohne nachgewiesenen Effekt“ von Elke Oberhofer
(And osteopathy does work!: A reply to the article “Three-month colic: Alternative medicine without proven effect“ by Elke Oberhofer)
Franke, H., Prediger, G.
Osteopathische Medizin, 2023/09
Free full text
75

Die Schilddrüse aus der Sicht der Osteopathie: Teil 3: Behandlung
(The thyroid gland from the point of view of osteopathy: Part 3: Treatment)
Frühwein, J.
Osteopathische Medizin, 2023/09
76

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09
77

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text
78

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text
79

Effects of the Fourth Ventricle Compression Technique and Rib Raising Osteopathic Technique on Autonomic Nervous System Activity Measured by Heart Rate Variability in 35 Healthy Individuals
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2023/08
Free full text
80

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text
81

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07
82

Peritoneal Adhesions in Osteopathic Medicine: Theory, Part 1
Bordoni, B., Escher, A. R., Girgenti, G. T.
Cureus, 2023/07
Free full text
83

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text
84

Operative Herangehensweise bei und osteopathische Behandlung nach Hüft-TEP-Implantation
(Operative approach to and osteopathic treatment after hip TEP implantation)
Grasmück, J., Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
85

Sprechen wir noch eine Sprache?
(Are we still speaking the same language?)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
86

Die Lebendigkeit des Selbst – das gesunde Immunsystem
(The vitality of the self - the healthy immune system)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
87

Investigating the mechanism of dextrose prolotherapy in vitro: fibroblast proliferation and production of growth factors
Harting, B., Fox, S., Motyka, T., Hinkelman, A.
The AAO Journal, 2023/06
88

Osteopathy—A philosophical perspective. Reflections on Sutherland’s experience of the tide
Masiello, D. J.
The AAO Journal, 2023/06
89

Die Schilddrüse aus der Sicht der Osteopathie: Teil 2: Pathologie und Dysfunktion
(The thyroid gland from the point of view of osteopathy: Part 2: Pathology and dysfunction)
Frühwein, J.
Osteopathische Medizin, 2023/06
Free full text
90

Anatomy Trains: die Schienenverkehrsordnung
(Anatomy Trains: the rail transport regulations)
Myers, T. W.
Osteopathische Medizin, 2023/06
Free full text
91

Faszien als sensorisches und emotionales Organ: Emotionen, Faszien und Immunsystem
(Fasciae as sensory and emotional organ: Emotions, fasciae and immune system)
Schleip, R., Bartsch, K.
Osteopathische Medizin, 2023/06
Free full text
92

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06
93

Combating poor mental health in emergency responders: Helping Emergency Responders Overcome (HERO) Act
Derynda, B., Gupta, K. A., Bhattacharya, S., Hollar, T. L.
Osteopathic Family Physician, 2023/06
94

Embryologie und Midline
(Embryology and midline)
Wojtowicz, A., Freeman, B., Dijs, P.
Osteopathische Medizin, 2023/06
Free full text
95

Muskulatur im entwicklungs-dynamischen Kontext
(Muscles in the developmental-dynamic context)
Engel, M.
Osteopathische Medizin, 2023/06
96

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06
97

Влияние остеопатической коррекции на объем движения и качество жизни у пациентов с артрозом плечевого сустава I–II степени
(Influence of osteopathic correction on range of motion and quality of life in patients with arthrosis of the shoulder joint of I–II degrees)
Avzaletdinov, B. K., Akhmetov, B. H.
Russian Osteopathic Journal, 2023/06
98

Соматическая дисфункция. Клинические рекомендации 2023
(Somatic Dysfunction. Clinical Guidelines 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
99

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
100

The effect of cranial techniques on the heart rate variability response to psychological stress test in firefighter cadets
Wójcik, M., Siatkowski, I.
Scientific Reports, 2023/05
Free full text
101

The Short-Term and Long-Term Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D. Y., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
102

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
103

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text
104

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text
105

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text
106

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
107

Abwertung als Ziel
(Devaluation as a goal)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
108

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
109

Anatomie der Halswirbelsäule
(Anatomy of the cervical spine)
Mihajlovic, Z., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
110

Schmerz – ein mögliches Erklärungsmodell im Patientengespräch
(Pain - a possible explanatory model in the patient interview)
Serafin, A.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
111

Die Rolle des Nervus phrenicus in der Hirn-Darm-Achse
(The role of the phrenic nerve in the brain-gut axis)
Camirand, N.
Osteopathische Medizin, 2023/03
Free full text
112

Die Schilddrüse aus der Sicht der Osteopathie: Teil 1: Grundlagen
(The thyroid gland from the point of view of osteopathy: Part 1: Fundamentals)
Frühwein, J.
Osteopathische Medizin, 2023/03
Free full text
113

Naturwissenschaftliche Entsprechungen für osteopathische Begriffe: Ausgehend von ursprünglichen Überlegungen des Rollin Becker
(Scientific equivalents of osteopathic terms: Starting from original thoughts of Rollin Becker)
Pelz, H.
Osteopathische Medizin, 2023/03
Free full text
114

Osteopathische Forschung an der Charité Berlin: Aufruf zur Unterstützung von qualitativ hochwertiger Forschung – fördern Sie die Akzeptanz von Osteopathie
(Osteopathic research at the Charité Berlin: Call for support of high-quality research - Promote the acceptance of osteopathy)
Rotter, G.
Osteopathische Medizin, 2023/03
Free full text
115

Faszien als sensorisches und emotionales Organ: Faszien als Sinnesorgan
(Fasciae as sensory and emotional organ: Fasciae as sensory organ)
Schleip, R., Bartsch, K.
Osteopathische Medizin, 2023/03
Free full text
116

Fascia; facts and fantasies
Hoppeler, H.
European Journal of Translational Myology, 2023/03
117

A Heart for Medicine: Palpitations In the Midst of Training
Coggins, J.
Osteopathic Family Physician, 2023/03
118

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text
119

Die osteopathische Technik – ein Metakonzept
(The osteopathic technique - a meta concept)
Engel, M.
Osteopathische Medizin, 2023/03
120

Abwertung als Ziel: Über den Artikel „Die Scheinwirkung der Osteopathie” von Edzard Ernst
(Devaluation as a Goal: About the Article “The Sham Effect of Osteopathy“ by Edzard Ernst)
Franke, H.
Osteopathische Medizin, 2023/03
121

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03
122

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text
123

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03
124

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text
125

Prostate Cancer with a Presenting Symptom of Lower Thoracic Back Pain
Malhotra, V., Singh, C., Weening, A., Patel, S., Mayi, B., Migliozzi, J., Malhotra, V.
Osteopathic Family Physician, 2023/03
126

Российский остеопатический журнал: основные этапы развития в 2012–2022 гг.
(Russian Osteopathic Journal: the main stages of development in 2012–2022)
Tregubova, E. S., Plokhov, R. A., Potekhina, Y. P., Belash, V. O.
Russian Osteopathic Journal, 2023/03
127

Патогенетические предпосылки применения остеопатической коррекции при хроническом тонзиллите
(Pathogenetic prerequisites for the use of osteopathic correction in chronic tonsillitis)
Vedyashkina, A. S., Potekhina, Y. P., Mokhov, D. E.
Russian Osteopathic Journal, 2023/03
128

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03
129

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text
130

Mind, Body and Spirit: What Makes Osteopathic Medicine is Hands on
Williams, B. R.
Osteopathic Family Physician, 2023/03
131

Der Effekt einer Stillpunktinduktion am Sakrum auf das vegetative Nervensystem, im Vergleich zu einer Scheinbehandlung, gemessen anhand der Herzratenvariabilität (HRV)
(The Effect of a sacrum stillpoint induction on the autonomic nervous system compared to a sham treatment, as measured by heart rate variability (HRV))
Franzin, K.
Unpublished MSc thesis, 2023/03
132

Effekt einer Unwinding-Technik des zervikothorakalen Diaphragmas auf die Herzratenvariabilität (HRV) im Vergleich zu einer Scheinbehandlung
(Effect of an unwinding technique of the cervicothoracic diaphragm on the heart rate variability (HRV) compared to a sham treatment)
Gwendolyn, A.
Unpublished MSc thesis, 2023/03
133

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text
134

Characteristics of patients presenting at a university outpatient department for com-plementary and integrative medicine
Rotter, G., Binting, S., Teut, M., Ortiz, M., Willich, S. N., Brinkhaus, B.
Complementary Medicine Research, 2023/02
135

An Update on Medical School Accreditation in the United States: Implications for the Single Graduate Medical Education (GME) Era
Ahmed, H., Kortz, M., Carmody, J. B.
Cureus, 2023/02
Free full text
136

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text
137

Reconceptualizing Somatic Dysfunction in the Light of a Neuroaesthetic Enactive Paradigm
Consorti, G., Castagna, C., Tramontano, M., Longobardi, M., Castagna, P., Di Lernia, D., Lunghi, C.
Healthcare, 2023/02
Free full text
138

Bedeutung des differenzierten Säuglingsbefunds
(Importance of the differentiated infant finding)
Ginsberg, I.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
139

Fragen und die Existenz verschiedener Wahrheiten
(Questions and the existence of various truths)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
140

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
141

Die Gewebe des Menschen – mehr als nur Baumaterial des Organismus
(The tissues of a human - more than just building material of the organism)
Spohr, G.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
142

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text
143

The US Residency Selection Process After the United States Medical Licensing Examination Step 1 Pass/Fail Change: Overview for Applicants and Educators
Ozair, A., Bhat, V., Detchou, D. K. E.
JMIR Medical Education, 2023/01
Free full text
144

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text
145

COVID-19 in Patients with Asthma: Review and Implications for Care of Adult Patients with an Osteopathic Component
Frasca, D. J., Wolf, S.
Osteopathic Family Physician, 2022/12
Free full text
146

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12
147

Die Geschichte der Osteopathie in Deutschland
(The history of osteopathy in Germany)
Engel, M.
Osteopathische Medizin, 2022/12
148

Osteopathie als personenzentrierte und integrierende Behandlungsmethode (Teil 2)
(Osteopathy as a person-centered and integrative treatment method (Part 2))
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/12
149

Osteopathische Geriatrie. Teil 2: Behandlung - Prinzipien und Methoden
(Osteopathic geriatrics. Part 2: Treatment - Principles and methods)
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/12
150

Модель фасциальных дисторсий (FDM) Стивена Типальдоса с позиций современных исследований и терапевтических концепций
(Fascial Distortion Model (FDM) by Stephen Typaldos from the modern research and therapeutic concepts point of view)
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. E., Agasarov, L. G.
Russian Osteopathic Journal, 2022/12
151

Исследование возможности включения остеопатической коррекции в состав комплексной терапии синдрома тазовой боли у женщин в позднем послеродовом периоде
(Study of the possibility of osteopathic correction inclusion in the complex therapy of pelvic pain syndrome in women at the late postpartum period)
Chumakova, I. B., Nasibullina, R. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/12
152

Эффекты остеопатической коррекции и возможности их исследования
(Effects of osteopathic correction and the possibility of their study)
Potekhina, Y. P., Tregubova, E. S., Mokhov, D. E.
Russian Osteopathic Journal, 2022/12
153

Variations of the Cystohepatic Blood Supply in American Midwestern Donor Cadavers
Memar, S. A., VanSickle, C., Funk, S., Houser, J. J., Markand, S.
Cureus, 2022/12
Free full text
154

Quality of Care: An Assessment of the Contributions of Osteopathic Medicine
Chila, A. G.
The AAO Journal, 2022/12
Free full text
155

The Touch Taboo: Origins for the Prohibition of Touch in Psychiatry and a Rational Osteopathic Approach
Huzij, T.
The AAO Journal, 2022/12
Free full text
156

Thomas L. Northup Lecture: Integrating Osteopathic Principles into Patient Care: An Approach for All Specialties
Snider, K.
The AAO Journal, 2022/12
Free full text
157

Five challenges for manual therapies trials with placebo controls: A proposal
D'Alessandro, G., Ruffini, N., Iacopini, A., Annoni, M., Kossowsky, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/12
158

Le toucher en ostéopathie, une ouverture au dialogue et à la relation.
(Touch in osteopathy, an opening to dialogue and relationship)
Beaulieu, A.
Soins Pédiatrie/Puériculture, 2022/11
159

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11
160

Dynamic touch induces autonomic changes in preterm infants as measured by changes in heart rate variability
Manzotti, A., Cerritelli, F., Monzani, E., Savioli, L., Esteves, J. E., Lista, G., Lombardi, E., Rocca, S. L., Biasi, P., Galli, M., Chiera, M., McGlone, F. P.
Brain Research, 2022/11
161

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text
162

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/10
163

At-home ECG monitoring with a real-time outpatient cardiac telemetry system during the COVID-19 pandemic
Jaramillo, N., Malkov, D., Nikakis, J., Arora, U. S., Cohen, T. J.
Journal of Osteopathic Medicine, 2022/10
Free full text
164

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
165

Traumasensible Vorgehensweise in der osteopathischen Praxis
(Trauma-sensitive approach in osteopathic practice)
Heuer, I., Tann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
166

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie – Teil 2
(Positional plagiocephaly: The role of brainstem sensitization in the pathophysiology of positional plagiocephaly - Part 2)
Zweedijk, R.
Osteopathische Medizin, 2022/09
167

Andrew Taylor Still lebt: Ent-wicklungslinien der osteopathischen Forschung und Lehre
(Andrew Taylor Still is alive: Lines of development of osteopathic research and teaching)
Levin, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
168

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text
169

Zirkumventrikuläre Organe und phänodynamische Osteopathie
(Circumventricular organs and phenodynamic osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
170

Синдром грушевидной мышцы
(Piriformis syndrome)
Belash, V. O., Petrova, E. A.
Russian Osteopathic Journal, 2022/09
171

Interaktion zwischen Gehirn und Herz: Modifikation der Interaktion zwischen Gehirn und Herz bei chronischen Schmerzen durch osteopathische Behandlung
(Interaction between brain and heart: modification of brain-heart interaction in chronic pain by osteopathic treatment)
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Osteopathische Medizin, 2022/09
172

OSTLIB – Die osteopathische Datenbank
(OSTLIB - The osteopathic database)
Franke, H.
Osteopathische Medizin, 2022/09
173

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09
174

Osteopathische Geriatrie: Teil 1: Grundlagen, Ziele
Osteopathic geriatrics - Part 1: Basics, goals
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/09
175

Osteopathische Medizin – Wo bleibt der Beweis?
(Osteopathic medicine - Where is the evidence?)
Schleusener, R.
Osteopathische Medizin, 2022/09
176

Osteopathische Behandlung von Frauen mit Beckengürtelschmerz post partum (PPGP). Randomisierte kontrollierte Studie
(To evaluate the effectiveness of custom tailored osteopathic treatment in women suffering from pelvic girdle pain after childbirth.)
Richterink, J., Bruns, A.
Unpublished D.O. thesis, 2022/09
177

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text
178

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08
179

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08
180

Das zerebrospinale venöse System
(The cerebrospinal venous system)
Flenker, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
181

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07
182

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text
183

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text
184

Addressing disparities in medicine through medical curriculum change: a student perspective
Kureshi, A., Landman, S., Ahmed, M., Savinova, O. V., Becker, D.
Journal of Osteopathic Medicine, 2022/07
Free full text
185

Overcoming reward deficiency syndrome by the induction of “dopamine homeostasis” instead of opioids for addiction: illusion or reality?
Blum, K., Soni, D., Badgaiyan, R. D., Baron, D.
Journal of Osteopathic Medicine, 2022/07
Free full text
186

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07
187

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07
188

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07
189

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07
190

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/07
191

Holistic osteopathic approach to the care of veterans with post-traumatic stress disorder: Case report
Lovy, A., Berkowitz, M. R.
The AAO Journal, 2022/06
Free full text
192

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie –Teil 1
(Positional plagiocephaly: the role of brainstem sensitization in the pathophysiology of positional plagiocephaly -Part 1)
Zweedijk, R.
Osteopathische Medizin, 2022/06
193

Pediatric unilateral knee swelling: a case report of a complicated differential diagnosis and often overlooked cause
Guardado, K. E., Sergent, S.
Journal of Osteopathic Medicine, 2022/06
Free full text
194

An Enactive-Ecological Model to Guide Patient-Centered Osteopathic Care
Cerritelli, F., Esteves, J. E.
Healthcare, 2022/06
Free full text
195

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text
196

Deutschsprachige Osteopathieliteratur: Eine Übersicht von der Entdeckung der Osteopathie bis zum Jahr 2000
(German-language osteopathic literature: a survey from the discovery of osteopathy to the year 2000)
Engel, M.
Osteopathische Medizin, 2022/06
197

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06
198

Durch dissipative Strukturierung zu Kohärenzgefühl und Gesundsein?
(Through dissipative structuring to a sense of coherence and being healthy?)
Pelz, H.
Osteopathische Medizin, 2022/06
199

Die vier vegetativen Nervensysteme
(The four autonomic nervous systems)
Plathner, M.
Osteopathische Medizin, 2022/06
200

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/06
201

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text
202

Reconceptualizing the therapeutic alliance in osteopathic practice: Integrating insights from phenomenology, psychology and enactive inference
Shaw, R., Abbey, H., Casals-Gutiérrez, S., Maretic, S.
International Journal of Osteopathic Medicine, 2022/06
203

Where do people acquire their beliefs about low back pain?
Suhail, A., Poulter, D. C.
International Journal of Osteopathic Medicine, 2022/06
204

An Osteopathic Manipulative Treatment (OMT) Evaluation and Treatment Protocol to Improve Gastrointestinal Function
Heineman, K.
The AAO Journal, 2022/06
Free full text
205

An Osteopathic Paradigm of Ideal Muscle Function: The Posterior Body Lifts the Skeleton into Gravity
Lewis, J. L.
The AAO Journal, 2022/06
Free full text
206

Transverse colon adenocarcinoma with direct cutaneous extension: complex multidisciplinary surgical management
Snow, Z. A., Marshall, B. N., Dreher, P., Parikh, S. N., Walchak, A., Cahn, D. B.
Journal of Osteopathic Medicine, 2022/06
Free full text
207

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
208

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/05
209

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text
210

Das Karpaltunnelsyndrom in der Schwangerschaft aus osteopathischer Sicht
(Carpal tunnel syndrome in pregnancy from an osteopathic point of view)
Schneider-Milo, U.
Akupunktur Praxis, 2022/05
211

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text
212

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text
213

The Importance of Pelvic and Leg Length Assessment in the Setting of Postpartum Lower Back Pain
Tafler, L., Wilson, D., Tafler, P.
Cureus, 2022/05
214

Os trigonum identified after trauma to heel
Pargeon, M. E., Tjiattas-Saleski, L. R.
Journal of Osteopathic Medicine, 2022/05
Free full text
215

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text
216

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text
217

Clinical evaluation and management of calcific tendinopathy: an evidence-based review
Catapano, M., Robinson, D. M., Schowalter, S., McInnis, K. C.
Journal of Osteopathic Medicine, 2022/04
Free full text
218

Bleeding gums due to immune thrombocytopenic purpura
Trydal, L., Liu, T.
Journal of Osteopathic Medicine, 2022/04
Free full text
219

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text
220

Отдаленные результаты совместного применения логопедической и остеопатической коррекции у детей 5–6 лет с дизартрией
(Long-term results of combined use of speech therapy and osteopathic correction in 5–6 year old children with dysarthria)
Bychkova, E. Y., Sandakov, A. V., Kuzmina, Y. O.
Russian Osteopathic Journal, 2022/03
Free full text
221

Инструментальные методы и технические средства для оценки результатов остеопатической коррекции у пациентов после ампутации нижних конечностей
(Instrumental methods and technical means for assessing the results of osteopathic correction in patients after lower limb amputation)
Kolyshnitsyn, N. Y., Mokhov, D. E.
Russian Osteopathic Journal, 2022/03
Free full text
222

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text
223

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text
224

Impressionen von A.T. Stills Osteopathie
(Impressions of A.T. Stills osteopathy)
Stecker, D.
Osteopathische Medizin, 2022/03
225

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
226

A.T. Still’s Biogen
Masiello, D. J.
The AAO Journal, 2022/03
Free full text
227

Osteopathic Approach to Treatment of Radial Head Dysfunction: The Radial Head Range of Motion Technique
Ellis, M. M., Lewis, D. D.
The AAO Journal, 2022/03
Free full text
228

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text
229

Should person-centredness care be an affordable goal in French osteopathic education?
Salmon, M., Cretal, A., Gonzales-Bandres, M.
International Journal of Osteopathic Medicine, 2022/03
Free full text
230

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
231

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
232

Rechtliches rund um die osteopathische Praxis – Praxisnachfolge
(Legal issues concerning osteopathic practice ... practice succession)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
233

Weibliche Anatomie: Die Harnblase
Female Anatomy: The Urinary Bladder
Bazin, O., Naudin, M.
Osteopathische Medizin, 2022/03
234

Poster Award des Osteopathic Research Institute (ORI)
Poster award of the Osteopathic Research Institute (ORI)
Bohlen, L.
Osteopathische Medizin, 2022/03
235

Vom Selbsterleben osteopathischer Praxis im Wirk-Bündnis der Tastwelt: Phänomenologisch-anthropologischer Bericht einer tastenden Praxis
(From the self-perception of osteopathic practice in the active alliance of the world of touch: Phenomenological-anthropological report of a practice of touching)
Kaiser, A. K.
Osteopathische Medizin, 2022/03
236

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03
237

Sticky Floor, Broken Ladder, and Glass Ceiling in Academic Obstetrics and Gynecology in the United States and Canada
Kim, K. Y., Kearsley, E. L., Yang, H. Y., Walsh, J. P., Jain, M., Hopkins, L., Wazzan, A. B., Khosa, F.
Cureus, 2022/02
Free full text
238

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text
239

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02
240

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text
241

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text
242

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02
243

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text
244

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text
245

Effects of Adding Respiratory Training to Osteopathic Manipulative Treatment on Exhaled Nitric Oxide Level and Cardiopulmonary Function in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
The American Journal of Cardiology, 2022/01
246

Inhibiting the Musculoskeletal Pathological Processes in Post-knee Replacement Surgery With Osteopathic Manipulative Treatment: A Systematic Review
Zhou, Y., Chin, J., Evangelista, A., Podger, B., Wan, P. J., Lomiguen, C. M.
Cureus, 2022/01
247

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
248

Teilleistungsstörung bei visueller Wahrnehmungsstörung
(Partial performance disorder in visual perception disorder)
Engemann, K., Preiss-Leger, B.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
249

Differenzialdiagnostik von Hüft- und Leistenschmerzen
(Differential diagnosis of hip and groin pain)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
250

Temporomandibulargelenk: Diskusverlagerung nach anterior
(Temporomandibular joint: disc displacement anteriorly)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
251

Im Zwischen – eine am Leib orientierte osteopathische Besprechung
(In between - An osteopathic discussion oriented toward the body)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
252

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/01
253

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05
254

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text
255

Die Lungen als Hohlorgan zwischen Luftbewegung und Gasaustausch: Ist eine osteopathische Behandlung des Lungengewebes möglich?
(The lungs as hollow organ between air movement and gas exchange: Is an osteopathic treatment of lung tissue possible?)
Levin, P.
Osteopathische Medizin, 2021/12
256

Vagusaktivierung und Stressreaktion aus Sicht der Osteopathie
(Vagus activation and stress reactions from the point of view of osteopathy)
Liem, T.
Osteopathische Medizin, 2021/12
257

Burnout und Stress – Korrelation mit viszeralem und kraniosakralem System
(Burnout and stress - Correlation with the visceral and craniosacral system)
Rössler, M., Kronstorfer, D.
Osteopathische Medizin, 2021/12
258

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12
259

Роль эластичных лент (кинезиотейпов) в комплексной терапии больных с остеоартрозом височно-нижнечелюстного сустава
(The role of elastic bands (kinesiotapes) in complex therapy of patients with temporomandibular joint osteoarthrosis)
Bulycheva, E. A., Postnikov, M. A., Bulycheva, D. S.
Russian Osteopathic Journal, 2021/12
260

Физические параметры нейтральности в работе врача-остеопата
(Physical parameters of neutrality in the work of an osteopathic physician)
Gurichev, A. A.
Russian Osteopathic Journal, 2021/12
261

Распространенность эндокринной патологии в детском и подростковом возрасте
(Prevalence of endocrine pathology in childhood and adolescence)
Nenashkina, E. N.
Russian Osteopathic Journal, 2021/12
262

Гистологическое исследование синхондрозов черепа, функционально значимых в краниальной остеопатической концепции
(Histological examination of cranial synchondroses as functionally significant elements in the cranial osteopathic concept)
Osipov, V. A., Pastukhov, A. N., Kurbatov, O. I., Potekhina, Y. P.
Russian Osteopathic Journal, 2021/12
263

Osteopathic ableism: A critical disability view of traditional osteopathic theory in modern practice
MacMillan, A.
International Journal of Osteopathic Medicine, 2021/12
264

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text
265

A Network Meta-Analysis of Randomized Controlled Trials Directed at Treating Lateral Epicondylalgia
Price, J. W.
The AAO Journal, 2021/12
Free full text
266

Die Auswirkungen einer allgemein osteopathischen Behandlung bei Patientinnen/Patienten mit rheumatoider Arthritis
(The effects of general osteopathic treatment on patients with rheumatoid arthritis)
Sommeregger, B. M.
Unpublished MSc thesis, 2021/11
267

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11
268

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11
269

Les bienfaits de l’ostéopathie sur la constipation
(The benefits of osteopathy on constipation)
Pitel, C., Rojot, A.
Pratiques en Nutrition, 2021/11
270

Effekt sakraler Mobilisationen auf die Herzratenvariabilität bei Patienten mit einem milden bis hohen Stressempfinden. Eine randomisierte, kontrollierte Einzelblindstudie
(Effect of sacrum mobilizations on the heart rate variability in patients with a moderate to high perceived stress score. A single blind randomized controlled study)
Chaumont, Y.
Unpublished MSc thesis, 2021/11
271

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text
272

Применение шкал, тестов и опросников в практике врача-остеопата
(Application of scales, tests and questionnaires in the practice of an osteopathic physician)
Belyaev, A. F.
Russian Osteopathic Journal, 2021/10
Free full text
273

Синдром последствий интенсивной терапии (ПИТ-синдром) у детей
(Post-intensive care syndrome (PICS) in children)
Karimova, L. K., Belash, V. O.
Russian Osteopathic Journal, 2021/10
Free full text
274

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10
275

Palpation of the Respiratory System in Osteopathic Manual Medicine: From the Trachea to the Lungs
Bordoni, B., Escher, A. R.
Cureus, 2021/09
Free full text
276

Geist-Körper-Interdependenz in der osteopathischen Behandlung
(Mind-body interdependence in osteopathic treatment)
Liem, T., Van Den Heede, P.
Osteopathische Medizin, 2021/09
277

Osteopathische Überlegungen zur Begleitung der Therapie des Mammakarzinoms
(Osteopathic considerations to support the therapy of breast carcinoma)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
278

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
279

Behandlung bei posttraumatischer Belastungsstörung
(Treatment for post-traumatic stress disorder)
Treu, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
280

Klassische Osteopathie – ein ganzheitlicher Ansatz
(Classical osteopathy - a holistic approach)
Williams, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
281

General Osteopathic Treatment (GOT) – ein Überblick
(General Osteopathic Treatment (GOT) - an overview)
Schiller, B.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
282

Das Platysma – Anatomie, Entwicklung und Funktion
(The platysma - anatomy, development and function)
Schumann, S.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
283

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, Dr C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09
284

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text
285

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09
286

Gait Analysis in Anterior Cruciate Ligament Reconstruction & Controls Across Different Levels of Visual Feedback
Bennison, J. C.
Unpublished MSc thesis, 2021/09
Free full text
287

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09
288

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09
289

Kognitive Fähigkeiten und Berufsrollen von Osteopath*innen nach A.T. Still: Teil 1: Philosophisch-ethischer Hintergrund
(Cognitive skills and professional roles of osteopaths according to A.T. Still - Part 1: Philosophical-ethical background)
Engel, M., Krause, K. C.
Osteopathische Medizin, 2021/09
290

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09
291

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08
292

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text
293

Osteopathie bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom
(Osteopathy for chronic prostatitis/chronic pelvic pain syndrome)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
294

Ungleichgewicht von Produktion und Resorption des LCS
(Imbalance of production and absorption of the LCS.)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
295

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
296

Der Mensch und seine Mikroben
(Man and its microbes)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
297

Können osteopathische Behandlungen Einfluss auf die Neurogenese nehmen?
(Can osteopathic treatments influence neurogenesis?)
Funke, P., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
298

Osteopathic Principles and Practice: Essential Training for the Primary Care Physician of Today and Tomorrow
Misra, S.
Family medicine, 2021/07
Free full text
299

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text
300

Остеопатия и Международная классификация функционирования, ограничений жизнедеятельности и здоровья (часть 2)
(Osteopathy and International classification of functioning, disability and health (part 2))
Belyaev, A. F.
Russian Osteopathic Journal, 2021/07
Free full text
301

Симуляционные технологии в современной парадигме медицинского образования: от общих принципов к использованию в преподавании остеопатии
(Simulation technologies in the modern paradigm of medical education: from general principles to use in teaching osteopathy)
Makhonin, D. A., Lopatin, Z. V., Tregubova, E. S.
Russian Osteopathic Journal, 2021/07
Free full text
302

Adverse childhood experiences and trauma informed care: treating the whole patient with a more complete osteopathic approach
Marcoux, T. B.
Journal of Osteopathic Medicine, 2021/07
Free full text
303

Возможность применения остеопатических методов коррекции в терапии симфизиопатии у беременных
(Possibility of using of osteopathic methods of correction in the therapy of symphysiopathy in pregnant women)
Nenashkina, E. N., Belash, V. O.
Russian Osteopathic Journal, 2021/07
Free full text
304

Терминология повреждений в остеопатии и в других медицинских дисциплинах
(Terminology of injuries in osteopathy and other medical disciplines)
Potekhina, Y. P., Gurichev, A. A.
Russian Osteopathic Journal, 2021/07
Free full text
305

Validity of retrospective patient reported assessment of pre-surgical hip pain and disability following hip arthroscopy
Wain, M. J. T.
Unpublished MSc thesis, 2021/07
Free full text
306

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07
307

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07
308

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text
309

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06
310

Osteopathy: Italian professional profile. A professional commentary by a group of experts of the European community of practice
Cerritelli, F., Lunghi, C., Esteves, J. E., Vaucher, P., van Dun, P. L. S., Alvarez, G., Biberschick, M., Wagner, A., Merdy, O., Menard, M., Tavernier, P., Clouzeau, C., Risch, A., Ruffini, Nuria, Nunes, A., Santiago, R., Marett, P., Grech, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06
311

Gefäßmanipulation: A. und V. vertebralis
(Vascular manipulation of the vertebral artery and vein)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2021/06
312

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 2: Diagnostik und Therapie
(Positional plagiocephaly and its osteopathic intervention. Part 2: Diagnostics and therapy)
Engel, M.
Osteopathische Medizin, 2021/06
313

Spinale Chiropraktische Manipulation (spinale HVLAM): Ein integrativer osteopathischer Ansatz
Spinal chiropractic manipulation (spinal HVLAM): An integrative osteopathic approach
Muntinga, E.
Osteopathische Medizin, 2021/06
314

The Pediatric Workforce: Recent Data Trends, Questions, and Challenges for the Future
Vinci, R. J.
Pediatrics, 2021/06
315

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text
316

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text
317

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05
318

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
319

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05
320

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text
321

Die Phänomenologie als wissenschaftliche Grundlage der Osteopathie
(Phenomenology as the scientific basis of osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/04
322

Osteopathic manual therapy in heart failure patients: A randomized clinical trial
Thomaz, S. R., Teixeira, F. A., de Lima, Acgb, Cipriano Junior, G., Formiga, M. F., Cahalin, L. P.
Journal of Bodywork and Movement Therapies, 2021/04
323

Остеопатия и Международная классификация функционирования, ограничений жизнедеятельности и здоровья (часть 1)
(Osteopathy and International classification of functionning, disability and health (part 1))
Belyaev, A. F.
Russian Osteopathic Journal, 2021/04
Free full text
324

Становление и развитие остеопатии как научной дисциплины
(Formation and development of osteopathy as a scientific discipline)
Novikov, Y. O., Mokhov, D. E., Tregubova, E. S.
Russian Osteopathic Journal, 2021/04
Free full text
325

Динамический туннельный синдром запястного канала: патофизиология, особенности остеопатической диагностики и лечения
(Dynamic carpal tunnel syndrome: pathophysiology, features of osteopathic diagnosis and treatment)
Stefanidi, A. V., Balabanova, N. V.
Russian Osteopathic Journal, 2021/04
Free full text
326

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text
327

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04
328

Auswirkungen eines auf dem Fasziendistorsionsmodell basierenden osteopathischen Interventionsprogramms auf die Hüftmobilität und subjektiv empfundene Lebensqualität von Coxarthrosepatienten im Vergleich zur physiotherapeutischen Standardbehandlung Eine randomisiert kontrollierte Studie
(A randomized controlled trial on the effects of an osteopathic treatment method according to the Fascial Distortion Model on the hip mobility and subjectively perceived quality of life of coxarthrosis patients)
Holzer-Jüttner, S.
Unpublished MSc thesis, 2021/04
329

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text
330

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text
331

Das benigne Prostatasyndrom im Kontext der Osteopathie
(Benign prostate syndrome in the context of osteopathy)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
332

Der Knochen aus osteopathischer Sicht
(The bone from an osteopathic point of view)
Junge, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
333

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 1: Die Grundlagen
(Positional plagiocephaly and its osteopathic intervention. Part 1: Basics)
Engel, M.
Osteopathische Medizin, 2021/03
334

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
335

Randomisierte kontrollierte Studien zur osteopathischen Behandlung des Ganglion pterygopalatinum
(Randomized controlled trials for osteopathic treatment of the pterygopalatine ganglion.)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
336

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
337

Knochen und Immunität: Die leitende Funktion des Knochens in der generellen Immunität des Organismus aus osteopathischer Sicht
(Bone and immunity: The central function of the bone in the general immunity of the organism from osteopathic point of view)
Buekens, Jo
Osteopathische Medizin, 2021/03
338

Osteopathische Prophylaxe und Behandlung bei Infekten im Kindesalter: Möglichkeiten und Grenzen
(Osteopathic prophylaxis and treatment at infections in childhood: possibilities and limits)
Kaiser, F.
Osteopathische Medizin, 2021/03
339

Misshandelt oder unglücklich gestürzt?: Deutscher Kinderverein zeigt die Unterschiede der Verletzungen
(Abused or unfortunate fall?: German Children's Association shows the differences of the injuries)
Rettinger, R.
Osteopathische Medizin, 2021/03
340

Joining forces to administer COVID-19 vaccines
Johnson, K. H.
Journal of Osteopathic Medicine, 2021/03
Free full text
341

The Impact of the ACGME/AOA Single Accreditation System on Osteopathic Surgical Specialties, Residents, and DO Students
Cummings, M.
Journal of Surgical Education, 2021/03
342

Der tiefsitzende Beckenschmerz: Ein osteopathischer Behandlungsalgorithmus in sieben Schritten
(The chronic pelvic pain: An osteopathic treatment algorithm in seven steps)
Liedtke, H.
Osteopathische Medizin, 2021/03
343

Abwehrreaktionen aus Sicht der viszeralen Osteopathie – Teil 2: Diskussion und Implikationen für die viszerale Osteopathie
(Defense reactions from the perspective of visceral osteopathy - Part 2: Discussion and implications for visceral osteopathy)
Wyvekens, J., Wyvekens, M., Hirth, T.
Osteopathische Medizin, 2021/03
344

Effect of Autonomic Nervous System Recovery from Sympathetic Challenge Using Osteopathic Cranial Manipulative Medicine – A Pilot Study
Blumer, J. U.
The AAO Journal, 2021/03
Free full text
345

Proprioceptive Coherence: An Expanded View of the Mechanics Behind the Indirect Method and the Introduction of an Innovative Variation
Lockwood, M. D.
The AAO Journal, 2021/03
Free full text
346

Mindfulness: Principles and Application to Decrease Opiate Use in Primary Care With an Osteopathic Component
Frasca, D. J.
Osteopathic Family Physician, 2021/02
Free full text
347

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text
348

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
349

Palpation, Interraterreliabilität und Soft Skills
(Palpation, interrater reliability and soft skills)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
350

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
351

Ist kraniale Osteopathie zuverlässig und wirksam?
(Is cranial osteopathy reliable and effective?)
Reißmann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
352

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01
353

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text
354

A Class By Themselves: Texas' Newest Med Schools Adjust to COVID-19
Price, S.
Texas Medicine, 2021/01
355

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text
356

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text
357

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text
358

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text
359

Embryologische Wellenreiter
(Embryological surfers)
Keown, D.
Osteopathische Medizin, 2020/12
360

Das osteopathische Labor: Erfahrung ermöglichen
(The osteopathic laboratory: Enabling experience)
Levin, P., Strebel, W.
Osteopathische Medizin, 2020/12
361

Psychosomatische Osteopathie bei Trauma am Beispiel der bifokalen Integration
(Psychosomatic osteopathy in trauma using the example of bifocal integration)
Liem, T., Neuhuber, W.
Osteopathische Medizin, 2020/12
362

Readmission Risk Factors and Heart Failure With Preserved Ejection Fraction
Harmon, D., Rathousky, J., Choudhry, F., Grover, H., Patel, I., Jacobson, T., Boura, J., Crawford, J., Arnautovic, J.
The Journal of the American Osteopathic Association, 2020/12
Free full text
363

Wissenschaftlich fundiert oder fragwürdiger Mythos?: Osteopathische Behandlungserfolge im Vergleich zur Schulmedizin während der Spanischen Grippe in den USA
(Scientifically substantiated or questionable myth?: Comparison between osteopathic treatment successes and conventional medicine during the Spanish flu in the USA)
Schwerla, F., Franke, H.
Osteopathische Medizin, 2020/12
364

Der Milchglasblick oder das Lächeln der Mona Lisa
(The frosted glass look or the smile of Mona Lisa)
Sibbing, D.
Osteopathische Medizin, 2020/12
365

Abwehrreaktionen aus Sicht der viszeralen Osteopathie – Teil 1: Die sechs Abwehrreaktionen Freeze, Flight, Fight, Fright, Flag und Faint
(Defense reactions from the point of view of visceral osteopathy - Part 1. The six defensive reactions: Freeze, Flight, Fight, Fright, Flag and Faint)
Wyvekens, J., Wyvekens, M., Hirth, T.
Osteopathische Medizin, 2020/12
366

Рефлексотерапия в лечении пациентов с дорсопатией
(Reflexology in the treatment of patients with dorsopathy)
Belash, V. O., Agasarov, L. G.
Russian Osteopathic Journal, 2020/12
Free full text
367

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
368

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
369

Возможности и организационные проблемы диагностики и лечения пациентов с синдромом болевой дисфункции височно-нижнечелюстного сустава
(Possibilities and organizational problems of diagnostics and treatment of patients with the syndrome of temporomandibular joint pain dysfunction)
Milutka, Y. A., Fortin, A. E.
Russian Osteopathic Journal, 2020/12
Free full text
370

Патогенез постинсультной периартропатии плечевого сустава с позиции развития соматических дисфункций
(Pathogenesis of post-stroke periarthropathy of the shoulder joint from the perspective of somatic dysfunctions)
Tregubova, E. S., Kozlova, N. S.
Russian Osteopathic Journal, 2020/12
Free full text
371

Die Brustdrüse aus osteopathischer Sicht: Teil 2: Praktische Anwendung
(The mammary gland from an osteopathic point of view - Part 2: Practical application)
Frühwein, J.
Osteopathische Medizin, 2020/12
372

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
373

The Battle Between Politics and Science Is Costing Us a Timely Victory Over the COVID-19 Pandemic
Hahn, M. B.
The Journal of the American Osteopathic Association, 2020/11
Free full text
374

Neurophysiologische Aspekte der osteopathischen Palpation gemessen mit der Herzratenvariabilitätsmessung
(Neurophysiological aspects of osteopathic palpation measured with the heart rate variability measurement)
Strohmaier, B.
Unpublished MSc thesis, 2020/11
Free full text
375

Osteopathic manipulative treatment in a general pediatric setting: An account of reflective practice
Mills, M. V.
Complementary Therapies in Clinical Practice, 2020/11
376

Die Sicherheit von Osteopathie bei Schwangeren anhand der Auswirkung auf das mögliche Risiko von Komplikationen vor, während und nach der Geburt
(The safety of osteopathy in pregnant women based on its impact on the risk of complications before, during, and after childbirth)
Kleindessner, A.
Unpublished MSc thesis, 2020/11
Free full text
377

Postoperative peritoneale Adhäsionen
(Postoperative peritoneal adhäsionen)
Liedler, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
378

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text
379

Gonococcal Arthritis
Mills, K., Jadav, P.
The Journal of the American Osteopathic Association, 2020/10
Free full text
380

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text
381

Osteopathie bei umschriebenen Entwicklungsstörungen
(Osteopathy for specific developmental disorder)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
382

Das Fasziensystem von Beckenboden, Bauch und Rücken
(The fascial system of the pelvic floor, abdomen and back)
Halasz, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
383

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht Teil 2: Was wirkt im Wirk-Bündnis der Osteopathie?
(Who and what constitutes connection within osteopathic treatment? A medical-philosophical contribution from the osteopathic point of view. Part 2: What works in the active alliance of osteopathy?)
Kaiser, A. K.
Osteopathische Medizin, 2020/09
384

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text
385

Osteopathische Behandlung des Larynx
(Osteopathic treatment of the larynx)
Liem, T.
Osteopathische Medizin, 2020/09
386

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09
387

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Experteninterviews – Teil 1: Theorie und Forschungsstand
(The osteopathic treatment of interosseous lesions. A qualitative content analysis of experts' opinion - Part 1: Theory and state of research)
Stecker, D.
Osteopathische Medizin, 2020/09
388

Erweiterung des biopsychosozialen Modells für die muskuloskelettale Praxis: Teil 2: Klinische Bedeutung für die muskuloskelettale Behandlung (German translation)
(Extension of the biopsychosocial model for musculoskeletal practice. Part 2: Clinical significance for musculoskeletal treatment)
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
Osteopathische Medizin, 2020/09
389

Spinal Manipulation and Select Manual Therapies: Current Perspectives
Hinkeldey, N., Okamoto, C., Khan, J.
Physical medicine and rehabilitation clinics of North America, 2020/09
390

“Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research”
Lunghi, C., Liem, T.
International Journal of Osteopathic Medicine, 2020/09
391

Модель фасциальных дисторсий (FDM-терапия). Принципы диагностики и лечения (обзор литературы)
(Fascial distortion model (FDM-therapy). Principles of diagnosis and treatment (literature review))
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. I.
Russian Osteopathic Journal, 2020/09
Free full text
392

„Der Dampf des Lebens“: Das Blut im Kontext der (klassischen) Osteopathie
“The steam of life“: The blood in the context of (classical) osteopathy
Engel, M.
Osteopathische Medizin, 2020/09
393

Применение физио- и бальнеотерапии у пациентов с неспецифической болью в нижней части спины (обзор литературы)
(The application of physical therapy and balneology of the patients with non-specific low back pain (literature review))
Novikov, A. Y., Shaiakhmetov, A. R., Novikov, Y. O.
Russian Osteopathic Journal, 2020/09
Free full text
394

Die Brustdrüse aus osteopathischer Sicht: Teil 1: Grundlagen
(The mammary gland from an osteopathic point of view. Part 1: Fundamentals)
Frühwein, J.
Osteopathische Medizin, 2020/09
395

Opioid Use in the Postpartum Period: Are We Prescribing Too Much?
Prentice, D., Berry, A., Stewart, L., Wilkins, H., Ural, S., Deiter, R.
The Journal of the American Osteopathic Association, 2020/08
Free full text
396

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
397

48-Hour Hospice Home Immersion Encourages Osteopathic Medical Students to Broaden Their Views on Dying and Death
Gugliucci, M. R., Padmanabhan, D. L., Silberstein, E. B.
The Journal of the American Osteopathic Association, 2020/08
Free full text
398

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text
399

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text
400

Musculoskeletal Therapies: Osteopathic Manipulative Treatment
Jonas, C.
FP Essentials, 2020/07
401

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07
402

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text
403

Osteopathic Treatment leads to significantly greater reductions in chronic thoracic pain after CABG surgery: a randomised controlled trial
Roncada, Gert
Journal of Bodywork and Movement Therapies, 2020/07
404

Novel Dual-Fluorescent Mitophagy Reporter Reveals a Reduced Mitophagy Flux in Type 1 Diabetic Mouse Heart
Kobayashi, S., Patel, J., Zhao, F., Huang, Y., Kobayashi, T., Liang, Q.
The Journal of the American Osteopathic Association, 2020/07
Free full text
405

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text
406

Regulationsstörung bei Säuglingen: neue An- und Aussichten
(Regulation disorder in infants: new approaches and prospects)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
407

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
408

(Corporeality of the heart)
Kozljanič, R. J., Scheuchl, F., Rösing, S.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
409

Die visuelle Vorstellung in der osteopathischen Palpation
(Visual Imagination in Osteopathic Palpation)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
410

A guide to writing a case report of an osteopathic patient
Vaughan, B., Fleischmann, M.
International Journal of Osteopathic Medicine, 2020/06
411

Neuro-Ocular Release: A New Osteopathic Technique For Resolving Somatic Dysfunction
Feely, R. A., Smith, J. A.
The AAO Journal, 2020/06
Free full text
412

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
413

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text
414

OMT bei der Behandlung von Infektionskrankheiten zu Beginn des 20. Jahrhunderts: Mit Anmerkungen aus aktuellen Forschungen und Behandlungsmodalitäten
(OMT in the treatment of infectious diseases at the beginning of the 20th century: With comments from current research and treatment modalities)
Liem, T.
Osteopathische Medizin, 2020/06
415

Test der Faszienkompartimente
(Test for fascia compartments)
Lunghi, C.
Osteopathische Medizin, 2020/06
416

Das Konzept „Hotelzimmer Uterus” möchte als anschauliche Allegorie dem Osteopathen und der (werdenden) Mutter aufzeigen, dass potenzielle Schockenergien, insbesondere in den Uteruswänden, einen negativen Effekt auf ein Ungeborenes haben oder sogar eine erfolgreiche Schwangerschaft verhindern kann. Es werden insbesondere Themen wie Kindsverlust und sexuelle Übergriffe angesprochen, da sie erfahrungsgemäß am ehesten gespeicherte (potenzielle) Schockenergien im gynäkologischen System hinterlassen. Das Phänomen Schockenergie wie auch die therapeutischen Ansätze zu deren Ausleitung werden kurz erläutert, insbesondere auch eventuelle Risiken bei der Behandlung in der Schwangerschaft.
(Shock in the uterus: The “hotel room“ phenomenon)
Muntinga, E.
Osteopathische Medizin, 2020/06
417

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text
418

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06
419

Kleine Geburten – und wie wir sie begleiten können
(Miscarriages - and how we can attend to them)
Wikus, P., Ossberger, C.
Osteopathische Medizin, 2020/06
420

Erweiterung des biopsychosozialen Modells für die muskuloskelettale Praxis: Teil 1: Einführung religiöser und spiritueller Dimensionen in das biopsychosoziale Modell
(Extension of the biopsychosocial model for the musculoskeletal practice. Part 1: Introduction of religious and spiritual dimensions into the biopsychosocial model)
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
Osteopathische Medizin, 2020/06
421

Skoliose und Osteopathie: Teil 2: Osteopathische Behandlung
(Scoliosis and osteopathy. Part 2: Osteopathic treatment)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/06
422

Osteopathic medicine: A judicial section for one specific profession
Beaume, S.
Medecine et Droit, 2020/06
423

Возможность применения остеопатической коррекции в комплексной терапии пациентов после стернотомии, выполненной в связи с хирургическим лечением приобретенного порока сердца
(Possibility of osteopathic correction in the complex therapy of patients after sternotomy performed in connection with the surgical treatment of acquired heart defects)
Glushkov, A. A., Salakhov, R. G., Yunusova, A. D., Lebedev, D. A.
Russian Osteopathic Journal, 2020/06
Free full text
424

Внутрижелудочковое кровоизлияние — современные представления о патогенезе, факторах риска, диагностике и лечении (обзор литературы)
(Intraventricular hemorrhage — modern concepts of pathogenesis, risk factors, diagnostics and treatment (literature review))
Karimova, L. K.
Russian Osteopathic Journal, 2020/06
Free full text
425

Обоснование совместного применения остеопатической коррекции и метода кинезиотейпирования при лечении синдрома плечелопаточного периартроза (плечелопаточной периартропатии)
(The rationale for the joint use of osteopathic correction and kinesiotherapy in the humeroscapular periarthrosis syndrome (humeroscapular periarthropathy) treatment)
Lebedev, E. B., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/06
Free full text
426

Синдром Зудека — современные представления о патогенезе, факторах риска, диагностике и лечении (обзор литературы)
(Sudeck syndrome — current understanding of pathogenesis, risk factors, diagnosis and treatment (literature review))
Mikhnov, G. I., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/06
Free full text
427

Постуральная роль стопы и ее нарушение при плоскостопии (обзор литературы)
(Postural role of the foot and its disturbance in case of flat feet (literature review))
Mironov, A. A., Khalili, V. D., Potekhina, Y. P., Pervushkin, E. S.
Russian Osteopathic Journal, 2020/06
Free full text
428

Graves Orbitopathy
Natali, S., Shogan, P.
The Journal of the American Osteopathic Association, 2020/06
Free full text
429

Partnering With Patients to Reduce Firearm-Related Death and Injury
Ozuna, L., Champion, C., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/06
Free full text
430

Manualtherapeutische Behandlung des Zwerchfells bei Asthma bronchiale: Studien geben Hoffnung
(Manual therapy treatment of the diaphragm in bronchial asthma: studies give hope)
Funke, P., Grasmück, J., Merkt, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
431

Behandlung einer stauungsbedingten Trigeminusneuralgie
(Treatment of trigeminal neuralgia as a result of congestion)
Hartmann, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
432

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
433

Antithrombotic Therapy for Patients With Atrial Fibrillation and Acute Coronary Syndrome or Percutaneous Coronary Intervention
Tseng, A. S., Shamoun, F. E., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/05
Free full text
434

Does the Halo Effect for Level 1 Trauma Centers Apply to High-Acuity Nonsurgical Admissions?
Hwalek, A. E., Kothari, A. N., Wood, E. H., Blanco, B. A., Brown, M., Plackett, T. P., Kuo, P. C., Posluszny, J.
The Journal of the American Osteopathic Association, 2020/05
Free full text
435

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05
436

Dermatofibrosarcoma Protuberans
Natali, S., Borelli, C., Shogan, P.
The Journal of the American Osteopathic Association, 2020/05
Free full text
437

Medizinischer Notfall in der Praxis: Ich packe meinen Koffer …
(Medical emergency in the practice: I pack my suitcase ...)
Merkt, P., Grasmück, J., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
438

Bindungsunterstützung bei Regulationsstörungen auf Grundlage der Polyvagaltheorie
(Support of human connection in regulation disorders based on the polyvagal theory)
Metcalfe-Wiegand, D.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
439

Der Subarachnoidalraum – ein Zwischenraum mit unterschätzter Bedeutung
(The subarachnoid space - an interspace with underestimated importance)
Muntinga, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
440

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
441

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04
442

Academic Advising Using Theoretical Approaches for Medical Students Who Are Struggling in Preclinical Years
Tewary, S., Jordan, J. A., Rana, A. M., Mayi, B.
The Journal of the American Osteopathic Association, 2020/04
Free full text
443

Approach To Joint Pain In The Elderly For Osteopathic Providers
Daudfar, S., Nakajima, N., Faiss, K., Tegeler, L., Kuo, J., Dreibelbis, R., Goering, E., Katsaros, E., Pham, J. T.
Osteopathic Family Physician, 2020/04
Free full text
444

Osteopathic Primary Care Treatment Options for Ulcerative Colitis
Fernandez, A., Januchowski, R.
Osteopathic Family Physician, 2020/04
Free full text
445

Urticaria: Diagnosis and Treatment with Osteopathic Considerations
Stacey, S.., Burke, D., Brininger, T.
Osteopathic Family Physician, 2020/04
Free full text
446

Gesundheit entsteht?: Die Bedeutung der sensomotorischen und psychischen Stabilität in der Entwicklung von Gesundheit
(Does health develop?: The importance of sensorimotor and psychological stability in the development of health)
Levin, Valbona A., Levin, P.
Osteopathische Medizin, 2020/03
447

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text
448

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text
449

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text
450

Skoliose und Osteopathie: Teil 1: Grundlagen
(Scoliosis and osteopathy. Part 1: Basics)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/03
451

Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research
Esteves, J. E., Zegarra-Parodi, R., van Dun, P., Cerritelli, F., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/03
452

The ICD-11 and opportunities for the osteopathy profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Orchard, D.
International Journal of Osteopathic Medicine, 2020/03
453

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text
454

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text
455

Kinderfußfunktion und spätere Haltungsgesundheit des Erwachsenen: Ursache und Wirkung – zwei Seiten einer Medaille
(Children's foot function and subsequent adult's postural health: Cause and effect - Two sides of a single coin)
Bäumer, C. J.
Osteopathische Medizin, 2020/03
456

Osteopathie zur Therapie bei unspezifischen Rückenschmerzen: Kritische Anmerkungen zu den Ergebnissen des IGeL-Monitors
(Osteopathy for the treatment of non-specific back pain: Critical comments on the results of the IGeL-Monitor)
Franke, H.
Osteopathische Medizin, 2020/03
Free full text
457

Antidepressant Discontinuation Syndrome: A Common but Underappreciated Clinical Problem
Rizkalla, M., Kowalkowski, B., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2020/02
Free full text
458

A Stepwise Approach to the Management of Heart Failure and its Comorbidities
Rogers, F. J., Saghir, Z.
The Journal of the American Osteopathic Association, 2020/02
Free full text
459

Funktionsstörungen der Kopfgelenke – ein wenig bekanntes Untersuchungs- und Behandlungskonzept
(Functional disorders of the craniovertebral joints—a little known examination and treatment concept)
Heidrich, Dr, Buchmann, Joachim
Manuelle Medizin, 2020/02
460

Shift Workers at Risk for Metabolic Syndrome
Kulkarni, K., Schow, M., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2020/02
Free full text
461

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text
462

Value of the Continuing Certification Modules and Challenging the Status Quo
Capoocia, A.
The Journal of the American Osteopathic Association, 2020/02
Free full text
463

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
464

Die akute Sprunggelenksverletzung in der osteopathischen Praxis
(The acute ankle injury in osteopathic practice)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
465

Kriterien zur Qualitätsbewertung von randomisierten kontrollierten Studien (RCTs)
(Criteria for the quality assessment of randomized controlled trials (RCTs))
Sumbauer, H.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
466

Das „Wo“ und „Wie“ der Wissensbeschaffung – die systematische Literaturrecherche
(The “where“ and “how“ of knowledge generation - the systematic literature search)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
467

The Many Facets of Hypermobile Ehlers-Danlos Syndrome
Riley, B.
The Journal of the American Osteopathic Association, 2020/01
Free full text
468

Food Sensitivity Testing and Elimination Diets in the Management of Irritable Bowel Syndrome
Smith, E., Foxx-Orenstein, A., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/01
Free full text
469

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text
470

High-Velocity, Low-Amplitude Management of Posterior Rib Somatic Dysfunction
Kasten, K. M., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/01
Free full text
471

Introducing national osteopathy practice-based research networks in Australia and New Zealand: an overview to inform future osteopathic research
Steel, A., Peng, W., Sibbritt, D., Adams, J.
Scientific Reports, 2020/01
Free full text
472

Preventing Premature Weaning: Management Options for Common Lactation Conditions, Including OMT
Sackett, D. R., Dajani, T., Shoup, D., Ikonne, U., Bombei, B.
Osteopathic Family Physician, 2020/01
473

Taxonomy of the Lateral Strain Patterns at the Sphenobasilar Synchondrosis for Osteopathic Cranial Manipulative Medicine
Capobianco, J. D., Shermon, S.
The Journal of the American Osteopathic Association, 2020/01
Free full text
474

Forschung und Osteopathie – ein Widerspruch? Ein Versuch der Auflösung am Beispiel des DO-Touch.Net
(Research and Osteopathy - a contradiction? An approach to solution using the example of DO-Touch.Net)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
475

A Comparative Study of the Heart as a Fulcrum in Relation to the Central Chain and the Ancient Wisdom of the Pervuvian Healers
Friesecke, D.
Unpublished D.O. thesis, 2019/5
Free full text
476

Osteopathic Cranial Manipulative Medicine: Frontal and Parietal Lift Techniques
Mardini, D., Peña, N., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/12
Free full text
477

Fluid Drive – angetrieben von äußerer Lebenskraft?
(Fluid Drive - Powered by an external life force?)
Muntinga, E.
Osteopathische Medizin, 2019/12
478

Eine überlebenswichtige Warnung … interessiert?
(A vital warning... interested?)
Schleusener, R.
Osteopathische Medizin, 2019/12
479

Корреляционные связи между некоторыми ритмами организма у пациентов врача-остеопата
(Correlation between certain rhythms of the body in osteopathic patients)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/12
Free full text
480

Роль опорно-двигательного аппарата в поддержании постурального баланса: обзор литературы
(The role of the musculoskeletal system in maintaining postural balance: literature review)
Kurnikova, A. A., Potekhina, Y. P., Filatov, A. A., Kalinina, E. A., Pervushkin, E. S.
Russian Osteopathic Journal, 2019/12
Free full text
481

Эпидемиологические и клинические аспекты хронического пиелонефрита у беременных и остеопатическое сопровождение беременных, страдающих хроническим пиелонефритом
(Epidemiological and clinical aspects of chronic pyelonephritis in pregnant women and osteopathic follow-up of pregnant women with chronic pyelonephritis)
Nenashkina, E. N., Tregubova, E. S., Belash, V. O.
Russian Osteopathic Journal, 2019/12
Free full text
482

Osteopathische Behandlung der Nebennieren
(Osteopathic treatment of the adrenal glands)
Barral, J-P.
Osteopathische Medizin, 2019/12
483

Современные представления об этиологии и патогенезе шейного болевого синдрома: обзор литературы
(Modern views on etiology and pathogenesis of cervical pain syndromes: literature rewiew)
Novikov, Y. O., Belash, V. O., Novikov, A. Y.
Russian Osteopathic Journal, 2019/12
Free full text
484

Частота дегенеративно-дистрофических поражений суставов позвоночника у пациентов молодого и среднего возраста с дорсопатией
(The frequency of degenerative-dystrophic lesions of the joints of the spine in young and middle-aged patients with dorsopathy)
Orel, A. M., Semenova, O. K.
Russian Osteopathic Journal, 2019/12
Free full text
485

Role of Opioid Involved Drug Interactions in Chronic Pain Management
Bain, K. T., Knowlton, C. H.
The Journal of the American Osteopathic Association, 2019/12
Free full text
486

Review of Opioid Prescribing in the Osteopathic and Ambulatory Setting
Hussein, A. I., Bekampis, C. F., Jermyn, R. T.
The Journal of the American Osteopathic Association, 2019/12
Free full text
487

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text
488

An Osteopathic Physician's Approach to the Esports Athlete
Zwibel, H., DiFrancisco-Donoghue, J., DeFeo, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/11
489

The Benefits and Limitations of Evidence-based Practice in Osteopathy
Bordoni, B.
Cureus, 2019/11
Free full text
490

Einfluss von Osteopathie auf die gesundheitsbezogene Lebensqualität von Frauen nach Sectio caesarea
(Influence of osteopathy on the health-related quality of life of women after caesarean section)
Rehak, M.
Unpublished MSc thesis, 2019/10
491

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text
492

Herzratenvariabilitätsanalyse in der Osteopathie und Manualmedizin
(Heart rate variability in manual medicine)
Klumpp, M.
Unpublished MSc thesis, 2019/10
Free full text
493

Visceral osteopathic manipulative treatment reduces patient reported digestive toxicities induced by adjuvant chemotherapy in breast cancer: A randomized controlled clinical study
Lagrange, A., Decoux, D., Briot, N., Hennequin, A., Coudert, B., Desmoulins, I., Bertaut, A.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2019/10
494

A.T. Still und der Methodismus. Einfluss des Methodismus auf A.T. Stills Entwicklung der osteopathischen Lehre und Praxis im Amerika des 19. Jahrhunderts
(A.T. Still and the Methodism)
Liem, T.
Osteopathische Medizin, 2019/10
495

Commentary: Statistical significance and clinical significance - A call to consider patient reported outcome measures, effect size, confidence interval and minimal clinically important difference (MCID)
Fleischmann, M., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2019/10
496

Awareness of axial spondyloarthritis among chiropractors and osteopaths: findings from a UK Web-based survey
Yong, C. Y., Hamilton, J., Benepal, J., Griffiths, K., Clark, Z. E., Rush, A., Sengupta, R., Martindale, J., Gaffney, K.
Rheumatology Advances in Practice, 2019/10
Free full text
497

Einfluss der osteopathischen Behandlung im Rahmen der stationären Anschlussheilbehandlung bei Patienten mit Zustand nach Hüft-TEP-Implantation. Randomisierte kontrollierte Studie.
(Influence of osteopathic treatment during post-hospital curative treatment in patients after total hip arthroplasty. A randomized controlled trial)
Behm, B., Mattern, E. R.
Unpublished D.O. thesis, 2019/10
498

Rezidivierende Harnwegsinfekte und Reizblase
(Recurrent urinary tract infections and irritable bladder)
Kilian-von Hofe, K.
Osteopathische Medizin, 2019/09
499

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text
500

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text
501

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09
502

Osteopathic approach with a patient undergoing cardiac transplantation: the five diaphragms
Bordoni, B., Morabito, B., Simonelli, M., Nicoletti, L., Rinaldi, R., Tobbi, F., Caiazzo, P.
International medical case reports journal, 2019/09
Free full text
503

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
504

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
505

Welches Gesundheitsmodell hat die Osteopathische Medizin? Teil 2: Eine osteopathische Sichtweise zur Gesundheit und zum Gesundsein
(What health model does osteopathic medicine have? Part 2)
Mayer, J.
Osteopathische Medizin, 2019/09
506

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
507

Entwicklung der unteren Extremität beim Kind aus osteopathischer Sicht
(Development of the lower extremity in the child from an osteopathic point of view)
Möckel, E.
Osteopathische Medizin, 2019/09
508

Balancierte Impakt-Tension – eine erweiterte osteopathische Technik
(Balanced Impact Tension - An advanced osteopathic technique)
Muntinga, E.
Osteopathische Medizin, 2019/09
509

Die Schilddrüse
(The thyroid)
Stöckl, D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
510

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatric, 2019/09
511

Fascial Nomenclature: An Update
Bordoni, B., Walkowski, S., Morabito, B., Varacallo, M. A.
Cureus, 2019/09
Free full text
512

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
513

Dynamic touch reduces physiological arousal in preterm infants: A role for c-tactile afferents?
Manzotti, A., Cerritelli, F., Esteves, J. E., Lista, G., Lombardi, E., La Rocca, S., Gallace, A., McGlone, F. P., Walker, S. C.
Developmental Cognitive Neuroscience, 2019/08
Free full text
514

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text
515

Kindlicher Kopfschmerz
(Child headache)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
516

Körperarbeit als Zugang zum ganzen Menschen
(Bodywork as access to the whole person)
Petzold, T. D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
517

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
518

Влияние остеопатической коррекции на частоту различных ритмов организма
(The influence of osteopathic correction on the rate of various rhythms of the body)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
519

Формирование здоровьесберегающего поведения у пациентов врача-остеопата
(Formation of health saving behavior in patients of osteopathic physicians)
Ivanov, A. A., Yanushanets, O. I.
Russian Osteopathic Journal, 2019/07
520

Verbesserte Neudefinition des Fasziensystems.
Improving the New Definition of Fascial System
Bordoni, B.
Complementary Medicine Research, 2019/07
521

Нормы труда врача остеопата в учетом кодирования заболеваемости
(The labor standards of osteopath with regard to morbidity coding)
Shipova, V. M., Berseneva, E. A., Mikhailov, D. Y.
Problemy sotsial'noi gigieny, zdravookhraneniia i istorii meditsiny, 2019/07
522

Зависимость конфигурации сустава от фулькрума динамичной неподвижности
(Dependence of the joint configuration on the dynamic immobility fulcrum)
Kozlov, A. D., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
523

Эффективность дополнительных методов лечения постинсультной периартропатии плечевого сустава
(The effectiveness of additional treatment methods for post-stroke periarthropathy of the shoulder joint)
Kozlova, N. S., Amelin, A. V.
Russian Osteopathic Journal, 2019/07
524

Le concept de la biotenségrité et son utilisation en ostéopathie
(The concept of biotensegrity and its use in osteopathy)
Tarento, M.
Russian Osteopathic Journal, 2019/07
525

Specific Adjusting Technique
(Specific Adjusting Technique)
Lamb, Gez, Schabel, Kai
Osteopathische Medizin, 2019/06
526

Osteopathic Cranial Manipulative Medicine and the Blood Brain Barrier: A Mechanistic Approach to Alzheimer Prevention
McAree, M., Dunn, A., Furtado, J., Timmerman, C., Winchell, Z., Rani, R., Farah, J., Crispino, L. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
527

Pilot randomized single-blind clinical trial, craniosacral therapy vs control on physiological reaction to math task in male athletes
Wójcik, M., Dziembowska, I., Izdebski, P., Żekanowska, E.
International Journal of Osteopathic Medicine, 2019/06
528

Refining the biopsychosocial model for musculoskeletal practice by introducing religion and spirituality dimensions into the clinical scenario
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/06
529

Welches Gesundheitsmodell hat die Osteopathische Medizin?
(What health model does osteopathic medicine have? Part 1: The topic of disease in the biomedical model of standard care)
Mayer, J.
Osteopathische Medizin, 2019/06
530

Osteopathische Medizin: Versuch einer zeitgemäßen Definition
(Osteopathic medicine: Attempt at a contemporary definition)
Mayer, J., Pelz, H., Riedel, M.
Osteopathische Medizin, 2019/06
531

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
532

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text
533

Integrating Osteopathic Philosophy in Cancer Care
Brown, Z. J., Martin, S. P., Carman, R.
The Journal of the American Osteopathic Association, 2019/06
Free full text
534

A Comparative study on the Effectiveness of Muscle Energy Techniques and Maitland Mobilization Coupled with Ultrasound in Patients with Periarthritis of the Shoulder Joint
Devendran, M.
Unpublished MSc thesis, 2019/05
Free full text
535

Cranial Osteopathy: Obscurantism and Enlightenment
Bordoni, B., Morabito, B., Simonelli, M.
Cureus, 2019/05
536

The Other Side of the Fascia: Visceral Fascia, Part 2
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
537

The Other Side of the Fascia: The Smooth Muscle Part 1
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
Free full text
538

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05
539

Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative pilot study of osteopathy and electrostimulation /biofeedback for pelvic floor
Bogner, D.
European Journal of Osteopathic Research, 2019/04
Free full text
540

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text
541

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text
542

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text
543

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04
544

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text
545

Von der Biomechanik zur Bioinformatik
(From Biomechanic to Bioinformatics)
Eckardt, P.
Osteopathische Medizin, 2019/04
546

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text
547

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text
548

Körperbasierte Empathie in der personzentrierten Psychotherapie
(Body-based empathy in person-centered psychotherapy)
Kern, E.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
549

The River of Life: Flüssigkeiten in der Osteopathie
(The river of life: fluids in osteopathy)
Mayer-Fally, E., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
550

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
551

Osteopathische Aspekte von Interozeption und Emotion
(Osteopathic aspects of interoception and emotion)
Stöckl, D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
552

Ist Asymmetrie Dysfunktion?
(Is asymmetry dysfunction?)
Robert, V.
Osteopathische Medizin, 2019/03
553

Biodynamische Osteopathie – Life
(Biodynamic osteopathy - life: A before - an afterwards - between them a stillpoint)
Schöndorfer, S.
Osteopathische Medizin, 2019/03
554

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03
555

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text
556

Manipulative Therapies: What Works
Smith, M. S., Olives, J., Smith, K.
American Family Physician, 2019/02
Free full text
557

The sacro-iliac joint: A potentially painful enigma. Update on the diagnosis and treatment of pain from micro-trauma
Le Huec, J. C., Tsoupras, A., Leglise, A., Heraudet, P., Celarier, G., Sturresson, B.
Orthopaedics & Traumatology: Surgery & Research, 2019/02
558

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text
559

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text
560

Der zervikothorakale Übergang
(The cervicothoracic junction)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
561

Welche Elemente charakterisieren die Osteopathie?
(Which elements characterize osteopathy?)
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
562

Back to the Roots: Palpation
(Back to the Roots: Palpation)
Eulenberg, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
563

Die Arbeit mit Diaphragmen im Zapchen
(Working with diaphragms through the Zapchen)
Weiß, B.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
564

Ein bisschen Lernen ist eine gefährliche Sache – Selbstüberschätzung bei Berufsanfängern
(A little learning is a dangerous thing - overconfidence among beginners)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
565

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text
566

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text
567

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text
568

Die Zukunft der Osteopathie liegt in der Aktivität
(The future of osteopathy belongs to activity)
Levin, P.
Osteopathische Medizin, 2018/12
569

Der suprachiasmatische Nukleus und seine klinische Bedeutung
(The suprachiasmatic nucleus and its clinical significance)
Liem, T., Havel, M.
Osteopathische Medizin, 2018/12
570

Therapieblockaden durch Zahn- und Kieferstörfelder: Umgang mit Störfeldern aus Sicht der täglichen osteopathischen Praxis
(Therapy blockades due to interference fields of teeth and jawbone: Dealing with interference fields from the point of view of daily osteopathic practice)
Von Gimborn, G.
Osteopathische Medizin, 2018/12
571

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text
572

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text
573

Osteopaticheskaia korrektsiia v kompleksnoi terapii i reabilitatsii patsientov s sindromom pozvonochnoi arterii.
[The use of the osteopathic correction for the combined treatment and rehabilitation of the patients presenting with the vertebral artery syndrome]
Belash, V. O., Mokhov, D. E., Tregubova, E. S.
Voprosy Kurortologii, Fizioterapii, i Lechebnoi Fizicheskoi Kultury, 2018/12
574

Funktionelle Therapie beim Morbus Sudeck („Complex Regional Pain Syndrome”, CRPS)
Functional therapy in Sudeck's disease (“Complex Regional Pain Syndrome“, CRPS)
Böger, A.
Osteopathische Medizin, 2018/12
575

Die Identität der Osteopathie in Deutschland – Spurensuche nach einem beruflichen Selbstverständnis
(The identity of osteopathy in Germany - Search for traces of a professional self-conception)
Ehmke, B.
Osteopathische Medizin, 2018/12
576

Effektstärke: Ein Parameter für osteopathische Studien?
Effect size: A parameter for osteopathic studies?
Hartwig, B. J., Bock, I. S.
Osteopathische Medizin, 2018/12
577

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text
578

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text
579

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text
580

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text
581

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10
582

Changes on cervical range of motion in migraine patients after a strain counterstrain treatment
Giustino, V., Contrò, V., Brusa, J., Proia, P., Messina, G., Brighina, F.
The Journal of Headache and Pain, 2018/10
583

Die Kunst des Briefschreibens und der Korrespondenz
(The art of letter writing and correspondence)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
Free full text
584

The One Health Initiative as a Basis for Research Development in the Department of Pharmacology at Midwestern University
Prozialeck, W. C., Edwards, J. R.
The Journal of the American Osteopathic Association, 2018/09
Free full text
585

Hebammenarbeit und Osteopathie – Berührungspunkte
(Midwifery and osteopathy - points of contact)
Göggerle-Locher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
586

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text
587

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
588

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
589

Datenschutzgrundverordnung (DSGVO) – Schreckgespenst oder echte Bedrohung?
(General Data Protection Regulation (GDPR) - spectre or real threat?)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
590

Anatomie am Lebenden
(Anatomy on the living object)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
591

Von A.T. Stills Theorie der osteopathischen Läsion zur somatischen Dysfunktion
(From A.T. Still's theory of the osteopathic lesion based on somatic dysfunction: Historical development and evidence-based models that support the current concept of somatic dysfunction)
Liem, T.
Osteopathische Medizin, 2018/09
592

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09
593

The Immediate Effect of Therapeutic Touch and Deep Touch Pressure on Range of Motion, Interoceptive Accuracy and Heart Rate Variability: A Randomized Controlled Trial With Moderation Analysis
Edwards, D. J., Young, H., Johnston, R.
Frontiers in Integrative Neuroscience, 2018/09
Free full text
594

Subokzipitalregion: neurologische und vaskuläre Anatomie und Varianten
(Suboccipital region: neurological and vascular anatomy and variants)
Reinhardt, R.
Osteopathische Medizin, 2018/09
595

Effect of gong’s mobilisation versus muscle energy technique on pain and functional ability of shoulder in phase II adhesive capsulitis
Gopinath, Y., Seenivasan, S. K., Veeraraghavan, S. N. C., Viswanathan, R., Govindaraj, M. K.
Journal of Clinical and Diagnostic Research, 2018/09
596

Was ist Schmerzpsychotherapie?
(What is pain psychotherapy?)
Butz, M., Braun, C., Böger, A.
Osteopathische Medizin, 2018/09
597

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text
598

Umgangsformen: Respektvolles und offenes Miteinander
(Manners: Respectful and open interaction)
Brandes, M., Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
599

Der Osteopath – lebenslanges Lernen und Entwicklung
(The osteopath - lifelong learning and development)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
600

Östeopathie – ein Bericht aus dem südlichen Nachbarland
(Osteopathy - a report from the southern neighbors)
Engel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
601

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text
602

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text
603

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text
604

Ich kann heilen, glaubt der Mensch – ein kritischer Denkanstoß
(I can heal, man believes - something to think about critically)
Fenske, M.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
605

Mut zur Muße
(Dare to laze)
Lamersdorf, P. J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
606

Die Kunst des Heilens: Wie man „Gesundheit findet“
(The art of healing: How to 'find health')
Lever, R.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
607

Still und das Geheimnis von Gesundheit
(Still and the secret of health)
Lewis, J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
608

Welchen Stellenwert hat Gesundheit in der Schulmedizin?
(What is the significance of health in conventional medicine?)
Wöstmann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
609

The Rule of the Artery Is Supreme. Or, Is It?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2018/07
Free full text
610

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text
611

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07
612

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07
613

Effect of HVLA on Chronic Neck Pain and Dysfunction
Cabahug, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text
614

Die Gesundheit in der Osteopathieausbildung
(Health in osteopathic education)
Bock, N.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
615

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text
616

National Institutes of Health and Osteopathic Medicine: Another call for action and equality in a legal struggle won long ago
Peppers, B. P., Blumer, J. U., Hostofer, R. W., Rowane, M. P., Thomas, K. A., Byrnes, T. R.
The AAO Journal, 2018/06
Free full text
617

The challenges and opportunities of using patient reported outcome measures (PROMs) in clinical practice
Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2018/06
618

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text
619

Palpation - Eine Fähigkeit des Gehirns?
(Palpation: An ability of the brain?)
Krause, R.
Osteopathische Medizin, 2018/05
620

Leistenschmerzen aus Sicht des Hernienchirurgen
(Inguinal pain from the point of view of the hernia surgeon)
Kuthe, A.
Osteopathische Medizin, 2018/05
621

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05
622

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
623

Lokale klinische Diagnostik bei Leistenschmerzen
(Local clinical diagnosis of inguinal pain)
Dobler, T. K.
Osteopathische Medizin, 2018/05
624

Knieschmerz und fazilitierte Positionierung in Anlehnung an L.H. Jones
(Knee pain and facilitated positioning in the style of L.H. Jones)
Heidrich, M., Buchmann, J., Röper-Krejza, B.
Osteopathische Medizin, 2018/05
625

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04
626

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text
627

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
628

Behandlung der kranialen Abflüsse bei HWS-Problematik
(Treatment of cranial drains in cervical spine problems)
Hanke, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
629

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
630

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03
631

Rethinking Superior and Inferior Sacroiliac Shear: A New Approach to Diagnosis and Treatment
Goldman, S. I., van Buskirk, R. L.
The AAO Journal, 2018/03
Free full text
632

Wann braucht ein Kind Physiotherapie und wann Osteopathie?
(When does a child need physiotherapy and when do they need osteopathy?)
Schwahn, N., Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
633

Die Zusammenarbeit von Hebamme und Osteopath
(The collaboration of midwife and osteopath)
Steinfurth, G., Böhringer, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
634

Interdisziplinäre Zusammenarbeit
(Interdisciplinary collaboration)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
635

Resonanz und Dialog: Zur Methodik eines neuroregulativen Behandlungsmodells
(Resonance and dialogue: On the methodology of a neuroregulative treatment model)
Metcalfe-Wiegand, D.
Osteopathische Medizin, 2018/03
636

Osteopathie im biodynamischen Bereich und Psychotherapie
(Osteopathy in the biodynamic field and psychotherapy)
Pelz, H.
Osteopathische Medizin, 2018/03
637

Clinical versus radiological findings: A paradox in diagnosing minor hamstring injuries
Arumugam, A.
International Journal of Osteopathic Medicine, 2018/03
638

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text
639

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03
640

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text
641

Clinical reasoning for complex cervical spine conditions
Reid, D., Rebbeck, T., McCarthy, C.
International Journal of Osteopathic Medicine, 2018/03
642

Osteopathie bei Rücken- und Beckengürtelschmerzen während und nach der Schwangerschaft
(Osteopathy in low back pain and pelvic girdle pain during and after pregnancy: Systematic review and meta-analysis)
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Osteopathische Medizin, 2018/03
643

Mechanical Link – Protokoll für eine individuelle Diagnostik und Therapie
(Mechanical link - Protocol for an individual diagnostics and therapy)
Hafen-Bardella, C.
Osteopathische Medizin, 2018/03
644

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text
645

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text
646

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text
647

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text
648

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text
649

Charlotte Weaver: Forschung zur Schädelwirbeltheorie
(Charlotte Weaver: Research on the cranial vertebra theory)
Engemann, K., Biermann, H.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
650

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
651

Beryl Arbuckle und die kraniale Osteopathie
(Beryl Arbuckle and cranial osteopathy)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
652

„Palpation“ bei A. T. Still, W. G. Sutherland und R. Becker
('Palpation' in A. T. Still, W. G. Sutherland, and R. Becker)
Sibbing, D.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
653

Osteopathische intrauterine Behandlung einer kongenitalen Lungenzyste
(Osteopathic intrauterine treatment of a congenital lung cyst)
Urbanek, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
654

Frauen in der osteopathischen Praxis
(Women in osteopathic practice)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
655

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text
656

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text
657

Anne Wales (1904 – 2005)
Dove, C.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
658

Wer war eigentlich Edna M. Lay?
(Who was Edna M. Lay?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
659

Tools zum Erlernen der Palpation
(Tools for learning palpation)
Krause, R.
Osteopathische Medizin, 2017/12
660

Osteopathische Läsion – Teil 2: Definitionen und Terminologien
(Osteopathic lesion - Part 2: Definitions and terminologies)
Liem, T.
Osteopathische Medizin, 2017/12
661

Advancing the Understanding and Treatment of the Thoracic Inlet and Incorporation of a New Still Technique—Part 1
Lewis, D. D.
The AAO Journal, 2017/12
Free full text
662

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12
663

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text
664

What are the risks of manual treatment of the spine? A scoping review for clinicians
Swait, G., Finch, R.
Chiropractic & Manual Therapies, 2017/12
Free full text
665

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text
666

Median Arcuate Ligament Syndrome (MALS): Fallserie über die osteopathische Behandlung von sieben Patienten: Evidenzlevel IV gemäß CARE-Guideline
(Median arcuate ligament syndrome (MALS): Case series on the osteopathic treatment of seven patients. Evidence level IV according to CARE guidelines)
Beck, M.
Osteopathische Medizin, 2017/12
667

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text
668

Lymphatic Pump Treatment of Inflammation in Rat Adjuvant-Induced Arthritis
Volin, M., McAuliffe, R., Zanotti, B.
Journal of Osteopathic Medicine, 2017/11
669

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text
670

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text
671

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
672

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text
673

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text
674

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10
675

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text
676

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10
677

Kann die osteopathische Behandlung die Krankheitsaktivität bei Patienten mit rheumatoider Arthritis (RA) beeinflussen? Randomisierte kontrollierte Studie.
(The influence of osteopathic treatment in addition to the standard therapy on disease activity in patients with rheumatoid arthritis (RA). A randomized controlled trial)
Franzen, K., Ramscheidt, B.
Unpublished D.O. thesis, 2017/10
678

Postpartale Beschwerden von Müttern nach einem Kaiserschnitt
(Postpartal complaints of mothers after Caesarean section)
Weiss, A.
Unpublished MSc thesis, 2017/10
679

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text
680

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text
681

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09
682

Prozessorientierung in der Osteopathie: ein Ansatz jenseits des Strukturmodells
(Process orientation in osteopathy: An approach beyond the structural model)
Lederman, E.
Osteopathische Medizin, 2017/09
683

Chronologie von Krankheitsgeschehen, Therapie und Forschung in der Osteopathie
(Chronology of pathophysiology, therapy and research in osteopathy)
Levin, P.
Osteopathische Medizin, 2017/09
684

Update zur Drainage des Gehirns und osteopathische Behandlungsansätze
Update on brain drainage and osteopathic treatment approaches
Liem, T.
Osteopathische Medizin, 2017/09
685

Mundmotorik: Empfehlungen für Babys und Kleinkinder mit Störungen der oralen Funktion
(Oral motor function: Recommendations for babies and small children with oral functional disorders)
Limbrock, J.
Osteopathische Medizin, 2017/09
686

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
687

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
688

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
689

Entzündlicher Rückenschmerz – sind Warnsignallisten verlässlich?
(Inflammatory back pain - Are lists of warning signals reliable?)
Polivka, J. S.
Osteopathische Medizin, 2017/09
690

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
691

Patienteninfo: Loslassen, ruhig werden, Raum schaffen mit Yoga
(Patient information: Let go, calm down, create space through the use of yoga)
Storm, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
692

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text
693

Scheinselbstständigkeit in der osteopathischen Praxis
(False self-employment in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
Free full text
694

Das Nichts zwischen den Dingen – oder was ist Raum?
(The nothingness between things - or what is space?)
Wallbrecht, C., Nehlsen, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
695

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text
696

Osteopathische Behandlung bei Coxarthrose
(Osteopathic Treatment of Patients with Coxarthrosis: A Randomised Controlled Trial)
Vögele, T.
Unpublished MSc thesis, 2017/09
Free full text
697

Raum und Weite im Lernfeld Osteopathie
(Space and width in the learning field of osteopathy)
Brown, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
698

Aus welchen Gründen und mit welchen Beschwerden kommen Mütter innerhalb 18 Monate post partum zum/zur Osteopathen/in und welche somatischen Dysfunktionen weisen sie auf?
(What are the reasons and complaints of mothers who consult an osteopath within 18 months postpartum, and which somatic dysfunctions do they have?)
Woitzik, K.
Unpublished MSc thesis, 2017/09
Free full text
699

Fuß- und Beinachsenentwicklung vom Säugling bis zum Erwachsenen
(Development of the feet and leg axis from infant to adult)
Halasz, C.
Osteopathische Medizin, 2017/09
Free full text
700

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
701

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text
702

Functional Somatic Syndrome: Assessment and Management
Graver, C. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text
703

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text
704

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text
705

Meeting ACGME Standards Under a Unified Accreditation System: Challenges for Osteopathic Graduate Medical Education Programs
Cummings, M.
Academic Medicine, 2017/07
Free full text
706

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text
707

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
708

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
709

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text
710

Update zur Liquorforschung und Drainage des Gehirns
Update on cerebrospinal fluid research and cerebral drainage
Liem, T.
Osteopathische Medizin, 2017/06
711

Osteopathie als aktuelle Satzungsleistung gesetzlicher Krankenkassen
(Osteopathy as current optional benefit of statutory health insurance companies)
Newiger, C.
Osteopathische Medizin, 2017/06
712

Balanced Fascial Tension (BFT) am Beispiel der faszialen Hüllen des Herzens
(Balanced Fascial Tension (BFT) using the fascial sheaths of the heart as an example)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
713

Mikrobiom: Worauf Sie bei Ihren Patienten achten sollten
(Microbiome: What you should pay particular attention to in your patients)
Zschocke, A. K.
Osteopathische Medizin, 2017/06
714

Reflexionen über Psyche und Geist in der Osteopathie
(Reflections on psyche and mind in osteopathy)
Turner, S., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text
715

Kraniozervikomandibulär bedingte Gleichgewichtsstörungen
(Vertigo caused by the cranio-cervico-mandibular complex)
Van Gorp, J., Stöcker, D.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
716

Das systemische Naturverständnis als Grundlage der Osteopathie
(The systemic understanding of nature as a foundation of osteopathy)
Wühr, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
717

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06
718

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text
719

Patienteninfo: Schwindel
(Patient information: Vertigo)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
720

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text
721

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06
722

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text
723

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
724

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text
725

An Osteopathic Approach to Chronic Pain Management
Jerome, J. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text
726

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text
727

Regulationsstörung
(Infantile colic)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
728

Autismus-Spektrum-Störung (ASS) und Osteopathie
(Autism spectrum disorder (ASD) and osteopathy)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
729

Ein Leben mit Arthrogryposis multiplex congenita (ACM)
(Living with arthrogryposis multiplex congenita (AMC))
Seger, G.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
730

Behandlungsvertrag nach dem Patientenrechtegesetz
(Treatment contract in accordance with the Patient's Rights Law)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
731

Persistierende frühkindliche Reflexe
(Persistent early childhood reflexes)
Watrin, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
732

Begleitung von Familien mit besonderen Kindern
(Support of families with special needs children)
Beuge, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
733

Eine osteopathische Herangehensweise an reflexives Schreiben
(An osteopathic approach to reflective writing)
Brown, A., Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
734

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text
735

Patienteninfo: Handling und Lagerung von Säuglingen
(Patient information: Handling and positioning of infants)
Fischer, S. J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
736

Das chronische Beckenschmerzsyndrom : Hilfe durch Osteopathie.
(Chronic pelvic pain syndrome : Treatment options using osteopathy)
Marx, S.
Der Urologe, 2017/04
737

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text
738

The importance of pilot studies, how to write them and what they mean
Vogel, S., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2017/03
739

A process approach in osteopathy: beyond the structural model
Lederman, E.
International Journal of Osteopathic Medicine, 2017/03
740

J Martin Littlejohn (1865–1947) and James Buchan Littlejohn (1868–1947): Two distinct directions – Osteopathy and the birth of osteopathic medicine
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2017/03
741

Innovation in graduate medical education – using a competency based medical education curriculum
Riley, B. A., Riley, G.
International Journal of Osteopathic Medicine, 2017/03
742

Burnout: Worauf Sie bei Ihren Patienten achten sollten
(Burnout: What you should pay attention to in your patients)
Krautz, B.
Osteopathische Medizin, 2017/02
743

Osteopathische Läsion – Teil 1: Begriffsentstehung und Konzept
(Osteopathic lesion - Part 1: Emergence of the idea and concept)
Liem, T.
Osteopathische Medizin, 2017/02
744

Vom Aufhängeband zum Organ: neue Forschungsergebnisse zum Mesenterium
From the suspensory ligament to the organ: New findings on the mesentery
Plathner, M.
Osteopathische Medizin, 2017/02
745

Motorische Entwicklung eines Säuglings: Idealbild und Abweichungen
(Motor development of an infant: Ideal and deviations)
Strunk, A.
Osteopathische Medizin, 2017/02
746

Intuition und Bewusstsein in der osteopathischen Praxis
(Intuition and awareness in osteopathic practice)
Von Gimborn, G.
Osteopathische Medizin, 2017/02
747

Pectus Excavatum: A Review of Diagnosis and Current Treatment Options
Abid, I., Ewais, M. M., Marranca, J., Jaroszewski, D. E.
The Journal of the American Osteopathic Association, 2017/02
Free full text
748

Auswirkungen einer cranialen Technik auf die Herzratenvariabilität
(Effects of a cranial technique on the heart rate variability)
Hauser, B. D.
Unpublished MSc thesis, 2017/02
Free full text
749

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/
750

Viola Frymanns Erbe – ein Überblick über ihre Forschungsarbeiten
(Viola Frymann's legacy - an overview of her research work)
King, H. H., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
751

Smartphones, Tablets und Co – Tipps zur Reduzierung der Strahlenbelastung
(Smartphones, tablets and the like - tips for reducing radiation exposure)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
752

Die venöse Sinustechnik – Drainage der venösen Blutleiter
(The venous sinus technique - drainage of venous blood vessels)
Percival, H., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
753

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text
754

Die Architektur der extrazellulären Matrix
(The architecture of the extracellular matrix)
Armstrong, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
755

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text
756

Osteopathie, Krankheit und Gesundheit
(Osteopathy, disease and health)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
757

Die therapeutische Potency
(Therapeutic potency)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
758

Der osteopathische Ansatz beim allergischen Patienten
(The osteopathic approach to allergic patients)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
759

Über das Konzept der Stille, den Stillpoint, das Fulkrum und die Potency
(About the concept of stillness, the still point, the fulcrum and the potency)
Frymann, V., Deora, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
760

John Martin Littlejohn: Leben und Werk
(John Martin Littlejohn: life and work)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
761

(Thinking, feeling and wanting as component of a treatment)
Krause, R.
Osteopathische Medizin, 2016/12
762

Utilizing Muscle Energy Technique of the Shoulder Girdle to Correct Somatic Dysfunction of the Thoracic Inlet
Figueroa, J., Summers, G. K.
The AAO Journal, 2016/12
763

A Review of Hypertension and Its Management by Osteopathic Manipulative Therapy
Miller, A. D.
The AAO Journal, 2016/12
764

Schilddrüse und Nebenschilddrüsen: Worauf Sie bei Ihren Patienten achten sollten
(Thyroid gland and parathyroid glands: To what you should pay particular attention in your patients)
Wicke, C., Trupka, A.
Osteopathische Medizin, 2016/12
765

Verbindung von Gehirn und Lymphsystem: neue Erkenntnisse und ihre Bedeutung für die Therapie
(Connection of brain and lymphatic system: New findings and their importance for therapy)
Chikly, B., Chikly, A.
Osteopathische Medizin, 2016/12
766

Entwicklungstests für Säuglinge und Kleinkinder: Hintergründe und praktische Empfehlungen
(Developmental tests for infants and toddlers: Backgrounds and practical recommendations)
Hohendahl, J.
Osteopathische Medizin, 2016/12
767

Alternative Scheduling Models: Improving Continuity of Care, Medical Outcomes, and Graduate Medical Education in Resident Ambulatory Training
Hussain, A. J.
The Journal of the American Osteopathic Association, 2016/12
Free full text
768

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text
769

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text
770

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text
771

Effects of osteopathic treatment on pulmonary function and chronic thoracic pain after coronary artery bypass graft surgery (OstinCaRe): study protocol for a randomised controlled trial
Roncada, G.
BMC Complementary and Alternative Medicine, 2016/11
Free full text
772

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text
773

A model for radiating leg pain of endometriosis
Bove, G. M.
Journal of Bodywork and Movement Therapies, 2016/10
774

Requirements for Certification in Surgery: A Comparison of the American Board of Surgery and the American Osteopathic Board of Surgery
Termuhlen, P. M., AH, O. Yurvati, Stella, J. J.
The Journal of the American Osteopathic Association, 2016/10
Free full text
775

The biomechanical model in manual therapy: Is there an ongoing crisis or just the need to revise the underlying concept and application?
Lunghi, C., Tozzi, P., Fusco, G.
Journal of Bodywork and Movement Therapies, 2016/10
776

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text
777

Manual therapy and cervical artery dysfunction: Identification of potential risk factors in clinical encounters
Vaughan, B., Moran, R., Tehan, P., Fryer, G., Holmes, M., Vogel, S., Taylor, A.
International Journal of Osteopathic Medicine, 2016/09
778

Osteopathische Imagination – ein Weg zur osteopathischen Selbstbehandlung
(Osteopathic Imagination - A way to osteopathic self-treatment)
Liedtke, H.
Osteopathische Medizin, 2016/09
779

Die Regio inguinalis dextra aus osteopathischer Sicht
(The regio inguinalis dextra from an osteopathic point of view)
Kuschel, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
780

Patienteninfo: Leben ist Bewegung
(Patient information: Life is movement)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
781

Die viszeralen Behandlungen des Andrew Taylor Still
(The visceral treatments of Andrew Taylor Still)
Marx, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
782

Osteopathie in Österreich – rechtliche Grundlage und Ausblick
(Osteopathy in Austria - Legal basis and outlook)
Mitschka, M., Wikus, P.
Osteopathische Medizin, 2016/09
783

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
784

Integrative Behandlung der Nebennieren in der Osteopathie
(Integrative treatment of the adrenal glands in osteopathy)
Namer, V., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
785

Neurovaskuläre Mobilisation des Plexus hypogastricus inferior
(Neurovascular mobilization of the inferior hypogastric plexus)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2016/09
786

Mechanotransduktion: von der zellulären Ebene bis zum ganzen Körper
(Mechanotransduction: From the cellular level up to the entire body)
Schleip, R.
Osteopathische Medizin, 2016/09
787

(Skin cancer: What you should watch out for in your patients)
Schnopp, C., Mempel, M., Baumstark, J.
Osteopathische Medizin, 2016/09
788

Neue Ansätze für die Behandlung viszeraler Strukturen über den Schädel
(New approaches for the treatment of visceral structures via the skull)
Riedel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
789

Nuad Boran – die traditionelle thailändische Massage
(Nuad Boran - the traditional Thai massage)
Rouhani, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
790

Struktur und Funktion der Atlasregion aus Sicht von Humankybernetik und Tensegrity
(Structure and function of the atlas region from the point of view of human cybernetics and tensegrity)
Siemsen, C.H., Koerner, H.
Osteopathische Medizin, 2016/09
791

Haftungsfälle in der osteopathischen Praxis
(Cases of liability in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
792

Behandlung der viszeralen Gefäße aus osteopathischer Sicht
(Treatment of the visceral vessels from an osteopathic point of view)
Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
793

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
794

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text
795

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text
796

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text
797

Manual evaluation of the diaphragm muscle
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Journal of Chronic Obstructive Pulmonary Disease, 2016/08
Free full text
798

Psychoneuroimmunologie: eine osteopathische Annäherung
(Psychoneuroimmunology: an osteopathic approach)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
799

Naturheilkunde und Komplementarmedizin in medizinischen Leitlinien - konnen europaische Normen Leitlinien fur Naturheilkunde und Komplementarmedizin verdrangen?
(Naturopathy and Complementary Medicine in Medical Guidelines - Can European Standards Replace Guidelines for Naturopathy and Complementary Medicine?)
Jutte, R.
Forschende Komplementärmedizin, 2016/07
800

Patienteninfo: Verhaltensauffällige Kinder – ADHS aktuell
(Patient information: Children with behavioral problems - latest on ADHD)
Rudner, S., Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
801

Dynamik der Gedanken oder wenn das Denken den Rhythmus lähmt
(Dynamics of thinking or when thinking paralyzes rhythm)
Schöndorfer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
802

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text
803

Das Zwerchfell – Atemmuskel oder Sitz der Seele?
(The diaphragm - respiratory muscle or seat of the soul?)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
804

Psyche und Hormonsystem – Dirigenten unseres Lebens
(Psyche and endocrine system - conductors of our life)
Vogt, E. S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
805

Was macht die Psyche somatisch?
(What makes the psyche somatic?)
Vogt, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
806

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text
807

Rechtliches rund um die osteopathische Praxis: Umsatzsteuerpflicht des Osteopathen
(Value added tax liability of the osteopath)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
808

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text
809

Das limbische System aus osteopathischer Sicht
(The limbic system from an osteopathic perspective)
Evans, O.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
810

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06
811

(The polyvagal theory in osteopathy)
Porges, S. W., Liem, T.
Osteopathische Medizin, 2016/06
812

Behandlungsvertrag in der Osteopathie – Warum ist er wichtig?
(Treatment contract in osteopathy - Why is it important?)
Schröder, B.
Osteopathische Medizin, 2016/06
813

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06
814

Beliefs about back pain: The confluence of client, clinician and community
Darlow, B.
International Journal of Osteopathic Medicine, 2016/06
815

Time, space and form: Necessary for causation in health, disease and intervention?
Evans, D. W., Lucas, N., Kerry, R.
Medicine, Health Care and Philosophy, 2016/06
816

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text
817

Sensomotorische Entwicklung und pädiatrische Osteopathie
(Sensorimotor development and pediatric osteopathy)
Ava Levin, V., Levin, P.
Osteopathische Medizin, 2016/06
818

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text
819

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text
820

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text
821

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text
822

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
823

Somatic Dysfunction: A Principled Approach to Diagnosis and the Selection of OMT Modalities
Hruby, R. J.
The AAO Journal, 2016/03
824

Was ist eigentlich … Body-Mind-Centering®?
(What actually is Body-Mind-Centering®?)
Leinweber, D., Rustler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
825

Biologische Rhythmen und ihre Bedeutung für die Osteopathie
(Biological rhythms and their importance for osteopathy)
Liem, T., Moser, M.
Osteopathische Medizin, 2016/03
826

Osteopathie – eine kurze Einführung. Grundlagen und geschichtlicher Überblick
(Osteopathy - A short review. Principles and history)
Luthin, D.
Pädiatrische Praxis, 2016/03
827

Anmerkungen zu Blechschmidt
(Comments on Blechschmidt)
Mildenberger, F. G.
Osteopathische Medizin, 2016/03
828

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text
829

Patienteninfo: Schilddrüsenunterfunktion
(Patient information: Hypothyroidism)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
830

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
831

Groß- und Minderwuchs in der osteopathischen Praxis
(Large and small stature in osteopathic practice)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
832

The Glymphatic-Lymphatic Continuum: Opportunities for Osteopathic Manipulative Medicine
Hitscherich, K., Smith, K., Cuoco, J. A., Ruvolo, K. E., Mancini, J. D., Leheste, J. R., Torres, G.
The Journal of the American Osteopathic Association, 2016/03
Free full text
833

Auswirkungen einer osteopathischen Technik an der Membrana bronchopericardiaca auf die Lungenfunktion, die Herzfrequenz, die arterielle Sauerstoffsättigung und den arteriellen Blutdruck
(Effects of an osteopathic technique on the bronchopericardial membrane on pulmonary function, heart rate, arterial oxygen saturation, and arterial blood pressure)
Seiringer, S.
Unpublished MSc thesis, 2016/03
Free full text
834

Assessment of Australian osteopathic learners
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03
835

Auswirkungen von frühkindlichem Stress auf das neuroendokrine System und Immunsystem
(Effects of early childhood stress on the neuroendocrine system and immune system)
Carter, P. V.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
836

Faszien: Verbindungen zwischen Perikard und umgebenden Strukturen
(Fascia: Connections between pericardium and surrounding structures)
Bartmer-Leitl, E.
Osteopathische Medizin, 2016/03
837

Assessment of Australian osteopathic learners' clinical competence during workplace learning
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03
838

Patients' experiences of living with persistent back pain
van Griensven, Hubert
International Journal of Osteopathic Medicine, 2016/03
839

Die Polyvagal-Theorie
(The Polyvagal Theory)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
840

Research Into Osteopathic Manipulative Medicine: Steps on the Evidence Pyramid
Ching, L. M.
The Journal of the American Osteopathic Association, 2016/03
Free full text
841

Funktionelle Aspekte der Dura sacralis und des anokokzygealen „Verspannungsapparates”
(Funktionelle Aspekte der Dura sacralis und des anokokzygealen „Verspannungsapparates”)
Hörmann, R., Brenner, E., Künzel, K.H.
Osteopathische Medizin, 2016/03
842

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text
843

Single Accreditation System for Graduate Medical Education: An Opportunity for Lesbian, Gay, Bisexual, and Transgender Health Education Integration in Osteopathic Medicine
Lapinski, J., Diaz, K. M.
The Journal of the American Osteopathic Association, 2016/02
Free full text
844

As the Twig Is Bent, so Grows the Tree—Part 7: Severe Temporal Bone Restriction in Children Is Risk Factor for Acute Otitis Media
King, H. H.
The Journal of the American Osteopathic Association, 2016/01
Free full text
845

Modern Still Life
Pennekamp, A.
The Journal of the American Osteopathic Association, 2016/01
Free full text
846

Altersbedingte Veränderungen des Herz-Kreislauf-Systems
(Age-related changes in the cardiovascular system)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
847

Patienteninfo: Fünf Übungen für mehr Mobilität
(Patient information: Five exercises for more mobility)
Melcher, L.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
848

Osteopathic Students' Graduate Medical Education Aspirations Versus Realities: The Relationship of Osteopathic Medicine and Primary Care
Cummings, M.
Academic Medicine, 2016/01
Free full text
849

Die Faszien im Alter
(Fascia in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
850

Bluthochdruck im Alter
(Hypertension in old age)
Seidler, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
851

Philosophie der Unsterblichkeit
(Philosophy of immortality)
Still, A. T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
852

Rechtliches rund um die osteopathische Praxis: Heilpraktikergesetz und GKV-Erstattungspraxis
(Non-Medical Practitioners Act and GKV reimbursement practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
853

Der lange Weg bis ins hohe Alter
(The long walk to old age)
Chandler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
854

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
855

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text
856

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text
857

Osteopathie – eine kurze Einführung. Grundlagen und geschichtlicher Überblick
(Osteopathy - A short review. Principles and history)
Luthin, D.
Gynakologische Praxis, 2016
858

Rising to New Challenges: Problems and Proposed Solutions for Osteopathic Program Directors
Goldmann, S. I.
The AAO Journal, 2015/12
859

Das Urteil des Oberlandesgerichts Düsseldorf vom 8. September 2015
(The decision of the Higher Regional Court Düsseldorf dated September 8, 2015)
Newiger, C.
Osteopathische Medizin, 2015/12
860

The Educational Model of Private Colleges of Osteopathic Medicine: Revisited for 2003-2013
Cummings, M.
Academic Medicine, 2015/12
Free full text
861

Craniomandibuläre Dysfunktion: Bedeutung der Körperhaltung bei Okklusionstests
(Craniomandibular dysfunction: Importance of body position in occlusion tests)
Prodinger-Glöckl, D.
Osteopathische Medizin, 2015/12
862

Kindernöte verstehen – das Bewegungsverhalten von Babys und Kindern
(Understanding children's afflictions - The movement behavior of babies and children)
Ritter, K.
Osteopathische Medizin, 2015/12
863

Vascular Dynamics – ein osteopathischer Behandlungsansatz
(Vascular Dynamics - An osteopathic treatment approach)
Vogt, R.
Osteopathische Medizin, 2015/12
864

Safeguarding children in osteopathic practice part 2: Managing concerns about children
Feld, A., Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2015/12
865

Top 5 largest osteopathic medical schools. Ranked by total active enrollment for the 2014-15 school year
listed, No authors
Modern Healthcare, 2015/12
866

The anatomy, biological plausibility and efficacy of visceral mobilization in the treatment of pelvic floor dysfunction
Horton, R. C.
Journal of Pelvic, Obstetric Gynaecological Physiotherapy, 2015/12
Free full text
867

Scimitar syndrome: A rare explanation for a common symptom with an osteopathic approach
Rivera, N. T., Martin, R. B., Gordon, M.l B., Rajter, J.-J., Bray, N.
International Journal of Osteopathic Medicine, 2015/12
868

Geschichte der konservativen Wirbelsaulentherapie.
[History of conservative spinal therapy]
Kladny, B.
Der Unfallchirurg, 2015/12
869

Achilles Tendon Disorders
Saini, S. S., Reb, C. W., Chapter, M., Daniel, J. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text
870

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text
871

2015 Updated Method Guideline for Systematic Reviews in the Cochrane Back and Neck Group
Furlan, A. D., Malmivaara, A., Chou, R., Maher, C. G., Deyo, R. A., Schoene, M., Bronfort, G., van Tulder, M. W.
Spine (Phila Pa 1976), 2015/11
872

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text
873

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text
874

Systematische Übersichtsarbeit über die Bewegungen des Herzens in der Mobilität und in der Motilität. Systematischer Review
(Heart motion and motility. Systematic review)
Will, T.
Unpublished D.O. thesis, 2015/10
875

Stills Gedanken über Leben, Tod und Jenseits
(Still's thoughts on life, death and the afterlife)
Haxton, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
876

Embodied Clinical Decision-making in Osteopathic Manipulative Medicine
Esteves, J. E.
The AAO Journal, 2015/09
877

Osteopathische Universität – ein Entwurf
(Osteopathic University - a concept)
Levin, P.
Osteopathische Medizin, 2015/09
878

Osteopathie in Auroville
(Osteopathy in Auroville)
Kraus, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
879

Understanding Fibroblasts in Order to Comprehend the Osteopathic Treatment of the Fascia
Bordoni, B., Zanier, E.
Evidence-based Complementary and Alternative Medicine, 2015/09
Free full text
880

Das Rätsel der böhmischen Heiler in der Geschichte der manuellen Therapien
(The enigma of the Czech healers in the history of manual therapies)
Mildenberger, F. G.
Osteopathische Medizin, 2015/09
881

Implementing the Single Accreditation System for Graduate Medical Education: Seeking Osteopathic Recognition
Shannon, S. C.
The AAO Journal, 2015/09
882

Dysfunction in a Patient With Acute Knee Pain and Osteoarthritis: A Case Report
T., Snider. K.
The AAO Journal, 2015/09
883

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09
884

Inhärente Rhythmen – komplexe psychophysische Synergismen durch Synchronisation
(Inherent rhythms - Complex psychophysical synergisms through synchronization.)
Pelz, H.
Osteopathische Medizin, 2015/09
885

Kinesiologisches Taping in der Osteopathie
(Kinesiology taping in osteopathy)
Seifert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
Free full text
886

Rechtliches rund um die osteopathische Praxis: Abrechnung der Behandlung
(Billing of treatment)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
887

L'osteopathie a 1'epreuve de l'Evidence-Based Medicine.
[Osteopathy and Evidence-Based Medicine]
Dugailly, P. M.
Revue Medicale de Bruxelles, 2015/09
888

Die osteopathische Behandlung akuter Atemwegserkrankungen im Krankenhaus von Haifa
(The osteopathic treatment of acute respiratory diseases in a hospital in Haifa, Israel)
Waldman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
889

Patienteninfo: Anzeichen für einen Schlaganfall
(Patient information: Signs of a stroke)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
890

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
891

Im Westen was Neues
(News from the West)
Dick-Wallace, S. F.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
892

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09
893

Der Zehengang
(Toe walking)
Guerassimiouk, D., Goussel, W., Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
894

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text
895

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text
896

Modeled Osteopathic Manipulative Treatments: A Review of Their in Vitro Effects on Fibroblast Tissue Preparations
Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/08
Free full text
897

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text
898

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text
899

Das Schleimhaut-assoziierte lymphatische Gewebe (MALT)
(Mucosa Associated Lymphatic Tissue (MALT))
Höppner, J.P., Stark, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
900

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text
901

Osteopathische Behandlung bei Patienten mit essenzieller Hypertonie
(Osteopathic treatment in patients with essential hypertension)
Pfeifer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
902

Entzündungsreaktionen aus Sicht der Osteopathie
(Inflammatory reactions from an osteopathic point of view)
Sarzeaud, R., Thon, N., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
Free full text
903

Die Bedeutung der Flüssigkeitsdynamik innerhalb des primären Atemmechanismus
(The importance of fluid dynamics within the primary respiratory mechanism)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
904

A unifying neuro-fasciagenic model of somatic dysfunction – Underlying mechanisms and treatment – Part II
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2015/07
905

Patienteninfo: Gesundheit Schluck für Schluck
(Patient information: Getting healthy sip by sip)
Dürr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
906

Strömung
(Flow)
Geyer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
907

Das vaskuläre System als Hilfe für eine präzise anatomische Palpation
(The vascular system as an aid for precise anatomical palpation)
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
908

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
909

Zwischen Traditionalisten und Reformern: Littlejohns Konzept der Anpassung
(Between traditionalists and reformers: Little Johns concept of adaptation)
Liem, T.
Osteopathische Medizin, 2015/06/01/
910

Einfluss zirkadianer Rhythmik auf den Kurzzeiteffekt eines myofaszialen Release des Zwerchfells hinsichtlich vagaler Modulation der Herzratenvariabilität
(Influence of circadian rhythmicity on the short-term effect of a myofascial release of the diaphragm with respect to vagal modulation of heart rate variability)
Hofer, U.
Unpublished MSc thesis, 2015/06
Free full text
911

Didaktik: Palpation, Wahrnehmung und Persönlichkeitsentwicklung
(Didactics: Palpation, perception and personality development)
Krause, R.
Osteopathische Medizin, 2015/06
912

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text
913

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
914

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
915

Osteopathie aus Sicht der Patienten: „Die Blüte entfaltet sich”
(Osteopathy from the patients' point of view: “The blossom unfolds“)
Weber, K.H.
Osteopathische Medizin, 2015/06
916

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06
917

Neue Strategien zur persönlichen und beruflichen Weiterentwicklung für Osteopathen
(New strategies for the further personal and professional development of osteopaths)
Bradonic, B., Risch, A. J.
Osteopathische Medizin, 2015/06
918

Durchblick trotz Wolke: Verwaltung von osteopathischen Praxen per Software
(Perspective in spite of the cloud: Management of osteopathic practices per software)
Hartlep, M.
Osteopathische Medizin, 2015/06
919

High-velocity thrust to the atlantoaxial joint does not increase mechanical stress on the vertebral artery
Guevarra, C. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text
920

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text
921

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text
922

Wie können wir unsere Wahrnehmung verbessern?
(How can we improve our perception?)
Marris, T., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
923

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
924

Was nimmt mein Osteopath wahr?
(What does my osteopath perceive?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
925

Sutherland
Bordoni, B., Zanier, E.
Advances in Mind-Body Medicine, 2015/04
926

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text
927

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
928

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
929

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text
930

Wahrnehmung und ihre Bedeutung für das Patientengespräch
(Perception and its relevance for the patient interview)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
931

Wahrnehmungsstörungen bei Grundschulkindern durch Störungen des hochzervikalen Bereichs
(Perception disorders in elementary school children due to disorders of the high cervical area)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
932

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text
933

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text
934

Was ist eigentlich … Wahrnehmung?
(What actually is perception?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
935

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text
936

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
937

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
938

Recognizing the Value of Manual Therapy Interventions in Women's Health: An Interim Report
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
939

Chiropraktik in der Bundesrepublik Deutschland von 1949 bis 1975
(Chiropractic in the Federal Republic of Germany from 1949 to 1975)
Mildenberger, F. G.
Osteopathische Medizin, 2015/03
940

Chronic inflammatory disease and osteopathy: a systematic review
Cicchitti, L., Martelli, M., Cerritelli, F.
PLoS One, 2015/03
Free full text
941

The clinical observation of muscle energy techniques and ligamentous articular strain in 2 cases of cervical disc herniation with thoracic outlet syndrome
Kim, M., Chi, E. H., Lee, J., Ha, I. H.
International Journal of Osteopathic Medicine, 2015/03
942

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03
943

Osteopathic Considerations in the Management of Migraine in Pregnancy
Soshnick, S., Mezzone, C., Yao, S., Abu-Sbaih, R.
Osteopathic Family Physician, 2015/03
Free full text
944

Nervus-axillaris-Läsion als mögliche Ursache für Beschwerden in der Schulterregion
(Axillary nerve lesion as possible cause of symptoms in the shoulder region)
Beck, M.
Osteopathische Medizin, 2015/03
945

Osteopathische Behandlung bei unspezifischen Rückenschmerzen – Literaturübersicht und Metaanalyse
(Osteopathic treatment for unspecific low back pain - systematic review and meta analysis)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2015/03
946

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text
947

Sutherlands Herangehensweise an den Körper als Ganzes: Die Schoßtechnik
(Sutherland's approach to the body as a whole: the lap technique)
Chandler, P., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
948

Are We Ready to Lead? ACGME Merger: An Opportunity to Fulfill Osteopathy’s Mission
O'Connell, J. A.
The AAO Journal, 2015/01
949

Osteopathische Sterbebegleitung
(Osteopathic terminal care)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
Free full text
950

Alt geworden oder jung geblieben?
(Grown old or stayed young?)
von Studzinski, I.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
951

Veränderungen im Alter
(Changes in old age)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
952

Patienteninfo: Gute Ernährung für gesundes Altern
(Patient information: Good nutrition for healthy aging)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
953

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01
954

Durch Tanzen anders altern
(Aging differently through dancing)
Gierz, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
955

Kann die Arbeit mit dem Liquor älteren Patienten helfen?
(Can working with cerebrospinal fluid help elderly patients?)
Grundberg, S., Höflehner-Schnürch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
956

A single graduate medical education accreditation system: ensuring quality training for physicians and improved health care for the public
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/4
Free full text
957

Pitfalls and challenges involved in the process of perception and interpretation of palpatory findings
Liem, T.
International Journal of Osteopathic Medicine, 2014/12
958

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text
959

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12
960

Laser Doppler Flowmetry in Manual Medicine Research
Zegarra-Parodi, R., Snider, E. J., Park, P. Y. S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/12
Free full text
961

CV4 vs Meditation: Die Auswirkungen auf das vegetative Nervensystem verglichen anhand der Herzratenvariabilität
(The impact of CV4 vs meditation on the vegetative nervous system measured by analysis of heart-rate variability: a comparative study)
Buschatzky, B.
Unpublished MSc thesis, 2014/12
Free full text
962

Cardiovascular Response to Vertebral Osteopathic Manipulative Treatment (OMT), On Asymptomatic Human Subjects
Pedapati, C.
Unpublished MSc thesis, 2014/12
963

The accelerated physician assistant pathway: a three-year medical school curriculum for physician assistants to obtain DO degrees
Kauffman, M., Ferretti, S. M.
Academic Medicine, 2014/12
Free full text
964

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text
965

‘I am afraid to make the damage worse’ – Fear of engaging in physical activity among patients with neck or back pain
Thomson, O.
International Journal of Osteopathic Medicine, 2014/12
966

Osteopathic decapitation: Why do we consider the head differently from the rest of the body? New perspectives for an evidence-informed osteopathic approach to the head
Gabutti, M., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2014/12
967

Safeguarding children in osteopathic practice: Part 1: Identifying children at risk
Maddick, A. F., Feld, A., Laurent, S.
International Journal of Osteopathic Medicine, 2014/12
968

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text
969

Prozess der Wahrnehmung und Interpretation von Palpationsbefunden
(Process of perception and interpretation of palpation findings).
Liem, T.
Osteopathische Medizin, 2014/11
970

Mesenchymale Entwicklung des Gehirn-Herz-Feldes
(Mesenchymal development of the brain-heart field.)
Lischent, M.
Osteopathische Medizin, 2014/11
971

Chiropraktik in Deutschland – die Zeit vor 1945
(Chiropractic in Germany - the time before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2014/11
972

Beeinflussung des autonomen Nervensystems durch eine osteopathische Recoiltechnik am Sternum
(Influencing the autonomic nervous system through the application of an osteopathic recoil technique on the sternum)
Mayrhofer, D.
Unpublished MSc thesis, 2014/11
Free full text
973

Embryologie nach Blechschmidt – Teil 2: Muskeln und Gelenke
(Embryology according to Blechschmidt - Part 2: Muscles and joints)
Wojtowicz, A.
Osteopathische Medizin, 2014/11
974

Use of beat-to-beat cardiovascular variability data to determine the validity of sham therapy as the placebo control in osteopathic manipulative medicine research
Henley, C. E., Wilson, T. E.
The Journal of the American Osteopathic Association, 2014/11
Free full text
975

Osteopathische Forschungsinstitutionen: eine Übersicht
(Osteopathic research institutions: an overview)
Newiger, C.
Osteopathische Medizin, 2014/11
976

Effect of myofascial techniques applied to the cranial region on autonomic Nervous System analyzed by Heart Rate Variability
Cantalino, J. L. R., Salgado, A. S. I., Santos, I. R., Oliveira, L. V. F., Oliveira, C. S., Ferreira, L. A. B., Da Silveira, N. J. F., Costa, M. S.
Manual Therapy, Posturology & Rehabilitation Journal, 2014/11
Free full text
977

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with persistent non-specific low back pain after childbirth. A randomized controlled trial)
Belz, S.
Unpublished MSc thesis, 2014/10
Free full text
978

Die Bedeutung der Faszien im Hochleistungssport
(The importance of fascia in high-performance sports)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
979

Das Fasziendistorsionsmodell (nach Typaldos): Die 6 Störungen und deren Behandlung
(The fascial distortion model (according to Typaldos): The 6 disorders and their treatment)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
980

Daumengrundgelenk: Taping zur Immobilisation eines Skidaumens
(Metacarpophalangeal joint: taping for immobilization of a ski thumb)
Langendoen, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
981

Als Osteopath bei den Olympischen Sommerspielen
(At the Summer Olympics as an Osteopath)
Maurer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
982

Das Supinationstrauma aus osteopathischer Sicht
(The supination trauma from an osteopathic point of view)
Peramo, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
983

Somatogene Reize bei Sportlern und deren Einfluss auf das Haltungssystem
(Somatogenic stimuli in athletes and their influence on the postural system)
van Caille, P.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
984

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in women with persistent non specific low back pain after childbirth. A randomized controlled trial)
Belz, S., Brix, K.
Unpublished D.O. thesis, 2014/10
985

Hypnose in Leistungssport und Osteopathie
(Hypnosis in competitive sports and osteopathy)
von Fischern, I.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
986

Achillodynie
(Achillodynia)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
987

Osteothek: Schnelle Hilfe und fundierte Informationen für die osteopathische Praxis
(Osteothek: Quick help and sound information for osteopathic practice)
Dierlmeier, D.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
988

Bewegung – osteopathische Domäne oder ungenutztes Potenzial?
(Movement - osteopathic domain or untapped potential?)
Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
989

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
990

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text
991

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09
992

Gesetz gegen den unlauteren Wettbewerb und Heilmittelwerbegesetz
(Law against unfair competition and the law on the advertising of medicinal products)
Köber, C.
Osteopathische Medizin, 2014/09
993

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text
994

Embryologie nach Blechschmidt – Entwicklung der Gliedmaßen
(Embryology according to Blechschmidt - development of the limbs)
Wojtowicz, A.
Osteopathische Medizin, 2014/09
995

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text
996

What about OMT and nutrition for managing the irritable bowel syndrome? An overview and treatment plan
Collebrusco, L., Lombardini, R.
Explore (NY), 2014/09
997

Osteopathic Primary Care of Patients With Inflammatory Bowel Disease: A Review
Bragg, J. D.
The Journal of the American Osteopathic Association, 2014/09
Free full text
998

Osteopathie und Naturheilkunde in der Schweiz
(Osteopathy and naturopathy in Switzerland)
Vogel, C.
Osteopathische Medizin, 2014/09
999

Osteopathic manipulative treatment for nonspecific low back pain: a systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
BMC Musculoskeletal Disorders, 2014/08
Free full text
1000

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
1001

Beeinflussung des Herz-Kreislauf-Systems durch die Faszien
(The fasciae's influence on the cardiovascular system)
Bartmer-Leitl, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1002

Das Herz – Eine Druck-Saug-Pumpe mit ausgeklügeltem Energierückgewinnungssystem
(The heart - A pressure-suction pump with a sophisticated energy recovery system)
Kuhmann, O.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1003

Stimmt unsere Vorstellung vom venösen System?
(Is our conception of the venous system accurate?)
Thon, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1004

Osteopathische Annäherung an die Arteriosklerose
(Osteopathic approach to arteriosclerosis)
Elferink, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1005

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1006

Impact of the single accreditation agreement on GME governance and the physician workforce
Kelley, C. S.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1007

Welche Bedeutung hatte das vaskuläre System in den Schriften von A. T. Still? – eine Literaturstudie
(What was the importance of the vascular system in the writings of A. T. Still? - a literature study)
Froger, P., Breton, J. L., Sarzeaud, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1008

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1009

Patienteninfo: Herzinfarkt bei Frauen
(Patient information; Heart attack in women)
Gräfin von Pfeil, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
1010

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1011

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 2
Hendryx, J. T.
The AAO Journal, 2014/06
Free full text
1012

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06
1013

Osteopath--ein eigenstandiger Heilberuf?
(Osteopath - an independent health profession?)
Ostendorf, G. M.
Versicherungsmedizin, 2014/06
1014

Vibration und Gewebewiederherstellung
(Vibration and tissue repair)
Garoli, A.
Osteopathische Medizin, 2014/06
1015

Osteopathie in Kenia – humanitäre Hilfe und Engagement gegen die weibliche Genitalverstümmelung
(Osteopathy in Kenya - Humanitarian aid and commitment against female genital mutilation)
Gassmaier, H.
Osteopathische Medizin, 2014/06
1016

Behandlung von Säuglingen mit Regulationsstörungen – Anregungen für die Ausbildung gemäß GAIMH
(Treatment of infants with adjustment disorders - Stimuli for the education according to the GAIMH)
Gillemot, B.
Osteopathische Medizin, 2014/06
1017

Bezuschussung osteopathischer Behandlungen: Versicherte und Krankenkassen profitieren
(Subsidization of osteopathic treatments: Insured and health insurance companies benefit)
Ismail-Tsaous, E.
Osteopathische Medizin, 2014/06
1018

Osteopathische Behandlung der Dura mater spinalis in der hochzervikalen Region
(Osteopathic treatment of the dura mater spinalis in the upper cervical region)
Liem, T.
Osteopathische Medizin, 2014/06
1019

Reprint of: Elevating the quality of disability and rehabilitation research: Mandatory use of the reporting guidelines
collective, Authors
International Journal of Osteopathic Medicine, 2014/06
Free full text
1020

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06
1021

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1022

Osteopathie als zusätzliche Leistung gesetzlicher Krankenkassen
(Osteopathy as an additional service of statutory health insurance companies.)
Newiger, C.
Osteopathische Medizin, 2014/06
1023

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1024

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text
1025

Two novel nonsurgical treatments of carpal tunnel syndrome
Schreiber, A. L., Sucher, B. M., Nazarian, L. N.
Physical Medicine and Rehabilitation Clinics of North America, 2014/05
1026

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1027

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1028

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1029

Development of a data collection tool to profile osteopathic practice: use of a nominal group technique to enhance clinician involvement
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
1030

Schlafstörungen bei Säuglingen und Kindern
(Sleep disorders in infants and children)
Lim, K. W., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1031

Das fetale Alkoholsyndrom
(Fetal alcohol syndrome)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1032

Patienteninfo: Alkohol in der Schwangerschaft
(Patient information: Alcohol during pregnancy)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1033

Hirnnerven und Dysfunktionen des Schädels
(Cranial nerves and dysfunctions of the skull)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1034

Auffinden von peripheren Nerven am Beispiel des N. radialis
(Locating peripheral nerves using the radial nerve as an example)
Van Loo, B.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1035

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1036

Wissenschaftliche Neubewertung der Liquordynamik
(Scientific reassessment of cerebrospinal fluid dynamics)
Hass-Degg, K.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
1037

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1038

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 1
Hendryx, J. T.
The AAO Journal, 2014/03
Free full text
1039

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03
1040

Hydrodynamik des Liquor cerebrospinalis – eine Neubewertung
(Cerebrospinal fluid hydrodynamics - A reassessment)
Chikly, B., Quaghebeur, J.
Osteopathische Medizin, 2014/03
1041

Tonische Immobilität als häufige Ursache für funktionelle Störungen
(Tonic immobility as a common cause of functional disorders)
Fleischhauer, M., Krebs, C.A.
Osteopathische Medizin, 2014/03
1042

Was wir fühlen – Dimensionen der taktilen Wahrnehmungsfähigkeit
(What we feel - Dimensions of the tactile perception ability)
Hartlep, M.
Osteopathische Medizin, 2014/03
1043

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1044

Osteopathic Manipulation in the Treatment of Primary Nocturnal Enuresis: A Retrospective Chart Review
Kanze, D. M., Kanze, K. A.
The AAO Journal, 2014/03
1045

Preliminary findings on the use of osteopathic manipulative treatment: outcomes during the formation of the practice-based research network, DO-Touch.NET
Degenhardt, B. F., Johnson, J. C., Gross, S. R., Hagan, C., Lund, G., Curry, W. J.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1046

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text
1047

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03
1048

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03
1049

The self-directed osteopathic medical student: Bringing adult learning into the osteopathic manipulative technique lab
Jons-Cox, L.A. D.
International Journal of Osteopathic Medicine, 2014/03
1050

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03
1051

Manuelle Behandlung des M. supraspinatus
(Manual treatment of the supraspinatus muscle)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03
1052

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly
Juhl, J. H.
The Journal of the American Osteopathic Association, 2014/02
Free full text
1053

A qualitative grounded theory study of the conceptions of clinical practice in osteopathy – A continuum from technical rationality to professional artistry
Thomson, O. P., Petty, N. J., Moore, A. P.
Manual Therapy, 2014/02
1054

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text
1055

Response to Letter Regarding “Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly“
Noll, D. R.
The Journal of the American Osteopathic Association, 2014/02
Free full text
1056

Osteopathie als “eigenstandiger Heilberuf“. Sollen Bademeister auf eigene Faust Patienten behandeln?
(Osteopathy as an “independent healing profession“. Should balneology specialists treat patients independently? )
Ostendorf, G. M.
MMW - Fortschritte der Medizin, 2014/02
1057

The integration of the “spirituality in medicine“ curriculum into the osteopathic communication curriculum at Kansas City University of Medicine and Biosciences
Talley, J. A., Magie, R.
Academic Medicine, 2014/01
Free full text
1058

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1059

A Research Primer, Part 2: Guidelines for Developing a Research Project
Yens, D. P., Brannan, G. D, Dumsha, J. Z.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1060

Schuhe und chronische Fußschmerzen im Alter
(Shoes and chronic foot pain in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1061

New frontiers in medical education: simulation technology at Campbell University School of Osteopathic Medicine
Maddox, R. W., Schmid, R. J.
North Carolina Medical Journal, 2014/01
1062

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01
1063

Die Entwicklung des Fußes und die Folgen des Laufens
(The development of the foot and the consequences of walking)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1064

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1065

Der lebendige Fuß des Menschen aus osteopathischer Sicht
(The living human foot from an osteopathic perspective)
Wales, A., Mitha, N., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1066

Der Osteopath am Fuße des Patienten
(The osteopath at the foot of the patient)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1067

Was ist Podo-Postural-Therapie?
(What's Podo-Postural Therapy?)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1068

Die Mechanik des Fußes
(The mechanics of the foot)
Zwierzchowska, Z., Vieten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1069

Die Galea aponeurotica als fasziale Struktur
(The galea aponeurotica as a fascial structure)
Barty, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1070

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1071

Patienteninformation: Gymnastik für gesunde Füße
(Patient information: Gymnastics for healthy feet)
Englisch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
1072

Osteopathy and low back pain, acupuncture and in vitro fertilization, Tai Chi and osteoarthritis, Andrographis paniculata and ulcerative colitis, and acupressure and vertigo
Pettit, J., Glickman-Simon, R.
Explore (NY), 2014/01
1073

Assessing impact of not attending lectures on osteopathic medical student performance: Brief survey of the literature and proposed future research
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2013/12
1074

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12
1075

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12
1076

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12
1077

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text
1078

Potential New Dimensions in Dermatology: The Osteopathic Approach to Cutaneous Disease
Michunovich, A. M., Stern, R.
The AAO Journal, 2013/12
Free full text
1079

The Application of the Cranial Concept in the Investigation of Baffling Medical Disorders and Their Treatment: A Synergopathic Medical Disease Model
Pribadi, K. S.
The AAO Journal, 2013/12
Free full text
1080

Das biodynamische Konzept im Rahmen der Osteopathie
(The biodynamic concept in the framework of osteopathy)
Weber, K.H.
Osteopathische Medizin, 2013/11
1081

Therapiekonzepte bei kraniofazialen Dysmorphien
(Treatment concepts in craniofacial dysmorphism)
Prediger, G., von Gernet, S.
Osteopathische Medizin, 2013/11
1082

Zukunft und Qualität der Osteopathie in Deutschland
(Future and quality of osteopathy in Germany)
Osteopathische Medizin, 2013/11
1083

Plagiozephalie – Ursachen und Hintergründe
(Plagiocephaly - Causes and background)
Künzel, K.H., Hoermann, R.
Osteopathische Medizin, 2013/11
1084

Evidenzbasierte Medizin – der Goldstandard auch in der Osteopathie?
(Evidence-based medicine - the golden standard also in osteopathy?)
Hartwig, B.
Osteopathische Medizin, 2013/11
1085

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text
1086

Effect of selected manual therapy interventions for mechanical neck pain on vertebral and internal carotid arterial blood flow and cerebral inflow
Thomas, L. C., Rivett, D. A., Bateman, G., Stanwell, P., Levi, C. R.
Physical Therapy, 2013/11
Free full text
1087

Swedenborgs Einfluss auf die Osteopathie
(Swedenborg's influence on osteopathy)
Fuller, D. B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1088

„Mein Andrew Taylor Still“
(“My Andrew Taylor Still“)
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1089

Die zeitlosen Lehren des Andrew Taylor Still
(The Timeless Teachings of Andrew Taylor Still)
Lewis, J.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1090

Bewegung und Stille in der Arbeit mit Kindern
(Movement and stillness while working with children)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1091

Abseits ausgetretener Pfade: Ein neuer Blick auf die Faszie
(Off the beaten paths: a new look at the fascia)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1092

Natural Bridge: Wo sich Osteopathie und Natur verbinden
(The Natural Bridge: Where osteopathy and nature combine)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1093

Patienteninfo: Die Anfänge der Osteopathie
(Patient information: The beginnings of osteopathy)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1094

A. T. Still und die Wissenschaft
(A. T. Still and science)
Trowbridge, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
1095

Osteopathic dermatology residency training through Nova Southeastern University College of Osteopathic Medicine at Largo Medical Center
Walls, B.
Cutis, 2013/10
Free full text
1096

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1097

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1098

The effects of osteopathic treatment on common femoral artery blood flow and skin temperature in spinal cord injured and able-bodied individuals
Murray, D.
Unpublished MSc thesis, 2013/10
Free full text
1099

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly: An Observational Study
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text
1100

Markenstreit beendet
(Brand dispute settled)
Osteopathische Medizin, 2013/09
1101

Emotional Tissue – eine Annäherung
(Emotional tissue - An approach)
Hartwig, B.
Osteopathische Medizin, 2013/09
1102

Osteopathie in Portugal staatlich reguliert
(Osteopathy in Portugal is regulated by the state)
Hartlep, M.
Osteopathische Medizin, 2013/09
1103

Neurologische Betrachtung der Osteopathie
(Neurological consideration of osteopathy)
Eckardt, P.
Osteopathische Medizin, 2013/09
1104

Neurologische Integration nach Allan Phillips
(Neurological integration by Allan Phillips)
Eckardt, P.
Osteopathische Medizin, 2013/09
1105

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text
1106

A single systems research design to examine the effectiveness of osteopathic treatment for people with osteoarthritis of the hip
Howat, T.
Unpublished MSc thesis, 2013/09
Free full text
1107

The effect of OMT on postoperative medical and functional recovery of coronary artery bypass graft patients
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/08
Free full text
1108

Wer waren eigentlich …
(Who actually were ...)
Lewis, J. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1109

Die osteopathische Behandlung der Geburtserfahrung
(Osteopathic treatment of the birth experience)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1110

Patienteninfo: Warum ist die Bauchlage für Säuglinge so wichtig?
(Patient information: Why is the prone position so important for infants?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1111

Okulomotorik und visuelle Teilleistungsstörungen
(Oculomotor and partial visual impairment)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1112

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1113

Die frühkindliche Bewegungsentwicklung
(Early childhood movement development)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1114

Reassessing cerebrospinal fluid (CSF) hydrodynamics: a literature review presenting a novel hypothesis for CSF physiology
Chikly, B., Quaghebeur, J.
Journal of Bodywork and Movement Therapies, 2013/07
1115

Oxytocingabe während der Geburt und ADHS
(Oxytocin during birth and ADHD)
Fleischer, F.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1116

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07
1117

Osteopathische Diagnostik und Behandlung bei Stillproblemen
(Osteopathic diagnostics and treatment for breastfeeding problems)
Haller, L.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1118

Spiegelneuronen – ein unentbehrliches Werkzeug in der Osteopathie
(Mirror neurons - An indispensable tool in osteopathy)
Von Gimborn, G.
Osteopathische Medizin, 2013/06
1119

Gesundheit durch Ganzheit – ein osteopathisch-salutogenetischer Ansatz
(Health by means of wholeness - An osteopathic-salutogenic approach)
Risch, A. J.
Osteopathische Medizin, 2013/06
1120

Neurolymphatische Bahnen: neue wissenschaftliche Nachweise untermauern die Perrin-Technik
(Neurolymphatic pathways: New scientific evidences corroborate the Perrin technique)
Perrin, R. N.
Osteopathische Medizin, 2013/06
1121

Perrin-Technik am Beispiel des chronischen Müdigkeitssyndroms
(Perrin technique using chronic fatigue syndrome as an example)
Perrin, R. N.
Osteopathische Medizin, 2013/06
1122

Osteopathie als Kunst?
(Osteopathy as art?)
Novy, R., Sommerfeld, P.
Osteopathische Medizin, 2013/06
1123

Osteopathic manipulative treatment and nutrition: An alternative approach to the irritable bowel syndrome
Collebrusco, L., Lombardini, R.
Health, 2013/06
Free full text
1124

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text
1125

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text
1126

Treatment of a posterior rib utilizing a multimodal sequence of osteopathic manipulative treatments
Baker, J. P., Ely, R.
The AAO Journal, 2013/06
Free full text
1127

The liquorodynamic model of the primary respiratory mechanism
Moskalenko, Y. E., Kravchenko, T. I., Weinstein, G. B., Vardy, T. C.
The AAO Journal, 2013/06
Free full text
1128

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
1129

The effect of osteopathic manipulative treatment on postoperative medical and functional recovery of coronary artery bypass graft patients
Wieting, J. M., Beal, C., Roth, G. L., Gorbis, S., Dillard, L., Gilliland, D., Rowan, J.
The Journal of the American Osteopathic Association, 2013/05
Free full text
1130

Back to back: postnatal osteopathic care
Johnson, C.
The Practising Midwife, 2013/05
1131

La prise en charge medicale et osteopathique de l'enuresie nocturne primalre isolee.
(The medical and osteopathic management of isolated primary nocturnal enuresis)
Burguete, E., Dubois, T.
Soins Pédiatrie/Puériculture, 2013/05
1132

Patienteninfo: Häusliche Versorgung – armer Rücken?
(Patient information: Home care - poor back?)
Janssen, A.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1133

Patientenrechtegesetz: Was bedeutet es für Behandelnde?
(Patients' Rights Act: What does it mean for practitioners?)
Kämper, S.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1134

Der venolymphatische Pumpmechanismus: Denkmodell oder Wirklichkeit?
(The venolymphatic pump mechanism: concept or reality?)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1135

Vaskularisierung der Lendenwirbelsäule
(Vascularization of the lumbar spine)
Rapprich, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1136

The use of placebo interventions in clinical practice
Linde, K.
Complementary Therapies in Medicine, 2013/04
Free full text
1137

Welches Gewebe ist verantwortlich für Lumbalgien und Ischialgien?
(Which tissue is responsible for lumbagos and sciaticas?)
Barth, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
1138

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1139

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1140

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1141

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1142

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1143

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text
1144

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03
1145

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03
1146

From distinct to indistinct, the life cycle of a medical heresy. Is osteopathic distinctiveness an anachronism?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2013/03
1147

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03
1148

The Biopsychosocial model: Redefining osteopathic philosophy?
Penney, J. N.
International Journal of Osteopathic Medicine, 2013/03
1149

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
1150

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03
1151

Osteopathie im Kontext der italienischen Politik
(Osteopathy in the context of Italian politics)
Tozzi, P.
Osteopathische Medizin, 2013/03
1152

Wie sehen die Finger? Unbewusste Wahrnehmung als eine Grundlage der Intuition
(How do the fingers see? Unconscious perception as a basis of intuition)
Sidler, S.
Osteopathische Medizin, 2013/03
1153

Osteopathische Aspekte der Haltungsasymmetrie des Säuglings – eine funktionelle Betrachtung
(Osteopathic aspects of infantile postural asymmetry – A functional examination)
Riedel, M.
Osteopathische Medizin, 2013/03
1154

Druckerhöhungen in den Kavitäten und ihr Einfluss auf den Organismus
(Increases in pressure in the cavities and their influence on the organism)
Maassen, A.
Osteopathische Medizin, 2013/03
1155

Evaluating teaching methods and assessment tools of high velocity low amplitude techniques for undergraduate osteopathic manipulative treatment of the spine
Channell, M. K.
The AAO Journal, 2013/03
Free full text
1156

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
1157

Trauma: Betrachtung aus osteopathischer Sicht
(Trauma: Viewed from an osteopathic perspective)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1158

Patienteninfo: Unterstützung eines Kindes nach einem Trauma
(Patient information: support of a child after trauma)
Korittko, A.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1159

Patienten mit Demenz: Das sollten Sie im Umgang mit ihnen beachten
(Patients with dementia: What you should bear in mind when dealing with them)
Maier, R., Mayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1160

Die Rolle des Diaphragmas bei der lymphatischen Absorption aus der Peritonealhöhle
(The role of the diaphragm in lymphatic absorption from the peritoneal cavity)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1161

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1162

Die Rolle der Osteopathie im Umgang mit Trauma – ein persönlicher Bericht
(The role of osteopathy in dealing with trauma - a personal account)
Brown, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1163

Physiologie seelischer Traumata und posttraumatischer Belastungsstörungen (PTBS)
(Physiology of mental trauma and post-traumatic stress disorder (PTSD))
Dietrich, B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1164

Biotensegrity: a unifying theory of biological architecture with applications to osteopathic practice, education, and research--a review and analysis
Swanson, R. L.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1165

Die Gesundheit im Trauma entdecken
(Discovering health within trauma)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1166

A logical approach to complicated sacral and innominate dysfunction
Klock, G. B.
The AAO Journal, 2012/12
Free full text
1167

The stabilometric platform as a measuring instrument
Huard, Y.
The AAO Journal, 2012/12
Free full text
1168

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12
1169

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12
1170

Osteopathische manuelle Behandlung von Scharlach bei Kindern im 19. und 20. Jahrhundert
(Osteopathic manual treatment of scarlet fever in children in the 19th and 20th centuries)
Liem, T., Ciranna-Raab, C.
Osteopathische Medizin, 2012/12
1171

Forscher entdecken ein neues Drainagesystem des Gehirns
(Researchers discover a new drainage system of the brain)
Risch, A. J.
Osteopathische Medizin, 2012/12
1172

Techniken der kardiovaskulären Osteopathie
(Techniques of cardiovascular osteopathy)
Van Den Heede, P., Danjon, J.L.
Osteopathische Medizin, 2012/12
1173

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12
1174

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1175

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1176

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1177

The effect of osteopathic manual therapy on the vascular supply to the lower extremity in individuals with knee osteoarthritis: A randomized trial
Jardine, W. M., Gillis, C., Rutherford, D.
International Journal of Osteopathic Medicine, 2012/12
1178

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1179

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1180

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1181

Wie viel Anatomie braucht die Osteopathie oder was haben Sie sich nur dabei gedacht, lieber Dr. Still?
(How much anatomy does osteopathy need, or what were you thinking, dear Dr. Still?)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1182

Form-Funktion und die Sache mit der Embryologie
(Form-Function and the matter of embryology)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1183

Patienteninfo: Wie viel raffinierter Zucker ist gesund?
(Patient information: How much refined sugar is healthy?)
Jongschaap, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1184

Why reservations remain: a critical reflection about the systematic review and meta-analysis “Osteopathic manipulative treatment for low back pain“ by Licciardone et al
Franke, H.
Journal of Bodywork and Movement Therapies, 2012/10
1185

Die osteopathische Behandlung bei Frauen mit persistierenden Rückenschmerzen post partum. Randomisierte kontrollierte Studie.
(Osteopathic treatment in women with persistent low back pain after childbirth. A randomized controlled trial)
Rother, D., Rother, K.
Unpublished D.O. thesis, 2012/10
1186

Die hilflosen Helfer
(Helplessly helping)
Textor, R.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1187

Posture and chronic gonalgia in the elderly: contribution of osteopathic treatment
Huard, Y.
Computer Methods in Biomechanics and Biomedical Engineering, 2012/10
1188

Osteopathic manipulative treatment: novel application to dermatological disease
Campbell, S. M., Winkelmann, R. R., Walkowski, S.
Journal of Clinical and Aesthetic Dermatology, 2012/10
1189

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text
1190

Heterotaxien in der menschlichen Entwicklung
(Heterotaxies in human development)
Doll, S.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1191

Die physiologische Entwicklung in den ersten Lebensjahren
(The physiological development in the first years of life)
Guerassimiouk, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1192

An open letter to those in purely osteopathic manipulative medicine practices on reimbursement strategies
Jorgensen, D. J.
The AAO Journal, 2012/09
1193

Somatic dissatisfaction - Somatic dysfunction and the role of intention in treatment
Comeaux, Z. J.
The AAO Journal, 2012/09
Free full text
1194

Osteopathie und Wissenschaft: Körperwahrnehmung durch innere und äußere Afferenzen
(Osteopathy and science: Body awareness through interoceptive and exteroceptive afferences)
Hartmann, C.
Osteopathische Medizin, 2012/09
1195

Funktionsstörungen des Ösophagus und des gastro-ösophagealen Übergangs: Anatomie und Pathomechanismus
(Functional disorders of the esophagus and esophagogastric junction: Anatomy and pathomechanism)
Raab, M., Scheuerer, L. M.
Osteopathische Medizin, 2012/09
1196

Metaphern für Gesundheit – Gesundheit als Metapher
(Metaphors for health - Health as metaphor)
Risch, A. J.
Osteopathische Medizin, 2012/09
1197

Funktionsstörungen des Ösophagus und des gastro-ösophagealen Übergangs: Techniken zur Behandlung
(Functional disorders of the esophagus and esophagogastric junction: Techniques for the treatment)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2012/09
1198

Wie denken die Finger? Unbewusstes Denken als eine Grundlage der Intuition
(How do the fingers think? Unconscious thinking as a basis of intuition)
Sidler, S.
Osteopathische Medizin, 2012/09
1199

Osteopathie bei Infantiler Zerebralparese – Pilotstudie Kann durch craniale Behandlung ein positiver Effekt auf die Gelenksbeweglichkeit bei Infantiler Zerebralparese erzielt werden?
(Osteopathic Treatment in Cases of Infantile Cerebral Palsy – Pilot Study Does cranial treatment achieve a positive effect on joint mobility in cases of infantile cerebral palsy?)
Palko, P.
Unpublished MSc thesis, 2012/09
Free full text
1200

The eccentricities of osteopathy
Moore, W.
The BMJ, 2012/09
1201

Einfluss der osteopathischen Behandlung auf die Blutdruckwerte bei Patienten mit essentieller arterieller Hypertonie
(Influence of Osteopathic Treatment on Blood Pressure Values of Patients with Essential Arterial Hypertension)
Wasserfaller, A.
Unpublished MSc thesis, 2012/09
Free full text
1202

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text
1203

Consent, competence and confidentiality for children and young people: Case problems from osteopathic practice
Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2012/09
1204

Vertebral and internal carotid artery flow during vascular premanipulative testing using duplex Doppler ultrasound measurements: A systematic review
Malo-Urriés, M., Tricás-Moreno, J. M., Lucha-López, O., Estébanez-de-Miguel, E., Hidalgo-García, C., Pérez-Guillén, S.
International Journal of Osteopathic Medicine, 2012/09
1205

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1206

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1207

Topografie des weiblichen Beckens
(Topography of the female pelvis)
Lütjen-Drecoll, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1208

Stressinkontinenz nach einer Geburt
(Stress incontinence after childbirth)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1209

„Sacral Sag“ und mögliche klinische Folgen
(“Sacral Sag“ and possible clinical consequences)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1210

Packende Fachartikel – So geht es
(Writing gripping professional articles - Here's how)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1211

Kaiserschnittgeburt: erhöhtes Risiko für Typ-1-Diabetes
(Caesarean delivery: increased risk for type 1 diabetes)
Schubert, A.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1212

Patienteninfo: Beckenbodenübungen
(Patient information: pelvic floor exercises)
Vleminckx, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1213

From clinical experience to a model for the human fascial system
Day, J. A., Copetti, L., Rucli, G.
Journal of Bodywork and Movement Therapies, 2012/07
1214

Trauma: Sexuelle Gewalt und ihre Folgen
(Trauma: Sexual Violence and its aftermath)
Dietrich, B.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1215

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1216

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1217

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1218

The safety and efficacy of osteopathic manipulation in the treatment of mTBI (mild traumatic brain injury) in U.S. service members as validated by SPECT scan: A report of planned research
Nevins, N. A., Fraix, M.
The AAO Journal, 2012/06
Free full text
1219

A consideration of the elbow as a tensegrity structure
Scarr, G.
International Journal of Osteopathic Medicine, 2012/06
1220

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06
1221

Anatomie des Neugeborenen unter besonderer Berücksichtigung des Schädels und der oberen Halswirbelsäule
(Anatomy of the newborn with special consideration of the cranium and the upper cervical spine)
Beck, M.
Osteopathische Medizin, 2012/06
1222

Differenzierung myofaszialer Schmerzpunkte in Genese und Therapie
(Differentiation of myofascial pain points in genesis and treatment)
Eisenreich, U.
Osteopathische Medizin, 2012/06
1223

Was ist Gesundheit? Was ist Krankheit? Überlegungen zu einem Problemkomplex
(What is health? What is disease? Deliberations about a complex of problems)
Flatscher, M., Liem, T.
Osteopathische Medizin, 2012/06
1224

Geburtstraumatisch bedingte Blockierungen an Schädel, Wirbelsäule und Becken des Säuglings
(Blockades on cranium, spine and pelvis of the infant induced by birth trauma)
Wildgruber, H.
Osteopathische Medizin, 2012/06
1225

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text
1226

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text
1227

ACGME tightens postgraduate training entry requirements: doctors of osteopathic medicine, international medical graduates most affected
Cearnal, L.
Annals of Emergency Medicine, 2012/05
1228

The effect of muscle energy techniques on disability and pain scores in individuals with low back pain
Day, J. M., Nitz, A. J.
Journal of Sport Rehabilitation, 2012/05
1229

Differenzialdiagnostik von Kopfschmerzen bei Erwachsenen
(Differential diagnostics of headache in adults)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1230

Kopfschmerzforschung – ein Update
(Headache research - an update)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1231

Perikranielle Anatomie der chirurgischen Migränetherapie
(Pericranial anatomy of surgical migraine therapy)
Muehlberger, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1232

Kopfschmerzen: Behandlung nach dem Fasziendistorsionsmodell
(Headache: treatment according to the fascial distortion model)
Nagel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1233

Zeitmanagement – Entschleunigen Sie Ihr Leben!
(Time management - slow down your life!)
Schopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1234

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1235

Wie Vorstellungen die Beschwerden der Patienten beeinflussen
(How beliefs influence patient discomforts)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
1236

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1237

What’s in a Name? A Brief Look at the History of Board Certification in Neuromusculoskeletal Medicine and Osteopathic Manipulative Medicine
Hruby, R. J.
The AAO Journal, 2012/03
Free full text
1238

Fasziendistorsionsmodell (FDM) nach Typaldos
(Fascial distortion model (FDM) according to Typaldos)
Harrer, G.
Osteopathische Medizin, 2012/03
1239

Osteopathie und Wissenschaft
(Osteopathy and science)
Liem, T., Hilbrecht, H., Schmidt, T.
Osteopathische Medizin, 2012/03
1240

Osteopathiestudium in Deutschland und Österreich
(Osteopathy studies in Germany and Austria)
Newiger, C.
Osteopathische Medizin, 2012/03
1241

Kopfschmerzbehandlung – Gedanken aus dem Praxisalltag
(Practice and technique: Treatment of headache - Thoughts from the practical daily routine)
Unverricht, R.
Osteopathische Medizin, 2012/03
1242

Osteopathie in Belgien
(Osteopathy in Belgium)
van Dun, P. L. S.
Osteopathische Medizin, 2012/03
1243

Selected fascial aspects of osteopathic practice
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2012/03
Free full text
1244

Reflex Relationships of Paravertebral Muscles
Elbe, J. N.
The AAO Journal, 2012/03
Free full text
1245

The Ram of Reason Seal: Musings on its Origin and Meaning
Hruby, R. J.
The AAO Journal, 2012/03
Free full text
1246

Spontaneous Release by Positioning
Jones, L. H.
The AAO Journal, 2012/03
Free full text
1247

The Neural Basis of the Osteopathic Lesion
Korr, I. M.
The AAO Journal, 2012/03
Free full text
1248

Structural Pelvic Function
Mitchell, F. L.
The AAO Journal, 2012/03
Free full text
1249

The Role of the Fascae in the Maintenance of Structural Integrity
Page, L. E.
The AAO Journal, 2012/03
Free full text
1250

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text
1251

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text
1252

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03
1253

Strain counterstrain: current concepts and clinical evidence
Wong, C. K.
Manual Therapy, 2012/02
1254

„Was Sie machen, ist doch keine Osteopathie!“ – Ansätze zu einem konsensfähigen Selbstverständnis
(“What you are doing is not osteopathy after all!“ - Approaches to a consensual self-image)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1255

Vom Dialog mit dem Gewebe zur Gestaltung der therapeutischen Beziehung
(From the dialogue with the tissue to the shaping of the therapeutic relationship)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1256

Wie viel Differenzialdiagnostik braucht die Osteopathie?
(How much differential diagnostics does osteopathy need?)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1257

Osteopathie studieren – wieso, weshalb, warum?
(Why study osteopathy?)
Meyer, B., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1258

Die ersten Tage der DO … Aus dem Nähkästchen geplaudert
(The first days of the DO - telling it all)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1259

Ankommen in der Gegenwart oder ist die Osteopathie noch zu retten?
(Arriving in the present or can osteopathy still be saved?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1260

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text
1261

Keep it simple!
(Keep it simple!)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1262

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1263

Fasziendistorsionsmodell nach Typaldos im Routinebetrieb eines Ambulatoriums
(Fascial distortion model according to Typaldos in routine operation of an outpatient clinic)
Gallei, L.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1264

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1265

Osteopathische Berührung im Spiegel der Supervision
(Osteopathic touch in the mirror of supervision)
Hähn-Jakobs, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1266

Beeinflusst die CV4 - Technik die Anpassungsfähigkeit für große und extreme Höhen?
(Does the CV4 technique influence adaptability to great and extreme heights)
Pichler, M.
Unpublished MSc thesis, 2012/01
Free full text
1267

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text
1268

The immediate effect of osteopathic ‘rib raising’ technique on heart rate variability: a randomised sham controlled experiment
White, N.
Unpublished MSc thesis, 2012/01
Free full text
1269

Ligamentous Articular Strain Technique – a manual treatment approach for ligamentous articular injuries and the whole body
Libbey, R.
Journal of Prolotherapy, 2012
Free full text
1270

A hypothesis to explain the palpatory experience and therapeutic claims in the practice of osteopathy in the cranial field
Hamm, D.
International Journal of Osteopathic Medicine, 2011/12
1271

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text
1272

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12
1273

Manipulative Methods of Dr. A.T. Still
Archer, J.
The AAO Journal, 2011/12
Free full text
1274

What is health? What is disease? Thoughts on a complex issue
Flatscher, M., Liem, T.
The AAO Journal, 2011/12
Free full text
1275

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text
1276

Palpation des kraniosakralen Rhythmus
(Palpation of the craniosacral rhythm)
Liem, T.
Osteopathische Medizin, 2011/12
1277

From The Archives: From: Still AT. The Autobiography of A.T. Still. Kirksville, MO: Published by the author; 1908: 324-328.
Still, A. T.
The AAO Journal, 2011/12
Free full text
1278

Osteopathie in Österreich
(Osteopathy in Austria)
Schulmeyer, A.
Osteopathische Medizin, 2011/12
1279

Wirksamkeit einer osteopathischen Behandlung bei Kinetose
(Effectiveness of an osteopathic treatment of motion sickness)
Thiel, O. L.
Osteopathische Medizin, 2011/12
1280

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text
1281

Innenstrukturen des Thorax
(Internal structures of the thorax)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1282

Steuerungsorgan Zwerchfell
(Control organ diaphragm)
Büsser, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1283

Wie zufrieden sind meine Patienten? – Patientenbefragungen in der Osteopathiepraxis richtig durchführen
(How satisfied are my patients? - Conducting patient surveys correctly in the osteopathic practice)
Ebersberger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1284

Atmung und obere Thoraxöffnung
(Breathing and upper thoracic opening)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1285

Lungen: Form und Funktion in der osteopathischen Praxis
(Lungs: Form and function in osteopathic practice)
Kuhlmann, C., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1286

Patienteninfo: Obstruktive Bronchitis im Kindesalter
(Patient information: Obstructive bronchitis in childhood)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1287

Osteopathische Behandlung der Lungenentzündung: schneller gesund, weniger Komplikationen
(Osteopathic treatment of pneumonia: faster recovery, fewer complications)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1288

Lymphatic pump treatment enhances the lymphatic and immune systems
Hodge, L. M., Downey, H. F.
Experimental Biology and Medicine (Maywood, N.J.), 2011/10
1289

Patterns of chronic pain in the population
Carnes, D.
International Journal of Osteopathic Medicine, 2011/09
1290

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text
1291

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09
1292

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text
1293

The role of spinal manipulation, soft-tissue therapy, and exercise in chronic obstructive pulmonary disease: a review of the literature and proposal of an anatomical explanation
Engel, R., Vemulpad, S.
The Journal of Alternative and Complementary Medicine, 2011/09
Free full text
1294

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text
1295

Das autonome Nervensystem in der Osteopathie: Überblick über die therapeutischen Optionen
(The autonomic nervous system in osteopathy: Overview of therapeutic options)
Beck, A.K.
Osteopathische Medizin, 2011/09
1296

Das autonome Nervensystem und seine neuroanatomischen und neurobiologischen Komponenten
(The autonomic nervous system and its neuroanatomical and neurobiological components)
Beck, M.
Osteopathische Medizin, 2011/09
1297

Neubewertung der klassischen osteopathischen Feldtheorie am Beispiel von Perzeption und Wahrnehmung
(Reevaluation of the classic osteopathic field theory using perception and cognition as example)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/09
1298

Situation der Osteopathie in Frankreich
(Situation of osteopathy in France)
Steringot, P.
Osteopathische Medizin, 2011/09
1299

Sutherland’s Signature
Stark, J.
The AAO Journal, 2011/09
Free full text
1300

Spondylogenic-cranial biomechanic disorders in patients with chronic cerebrovascular insufficiency in the vertebrobasilar basin and their osteopathic correction
Novoseltsev, S. V.
The AAO Journal, 2011/09
1301

Técnica articular para disfunción de malar en eversión
(Articular technique for zygoma in eversion dysfunction)
Antolinos Campillo, P. J., Baño Alcaraz, A., Pascual-Vaca, J. O.
Osteopatía Científica, 2011/09
1302

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09
1303

Sprache und Kommunikation in der Osteopathie: Glossare im Internet
(Language and communication in osteopathy: glossaries on the Internet)
Risch, A. J.
Osteopathische Medizin, 2011/09
1304

Der Wille des Patienten steht über allem
(The patient's will is above all else)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1305

Bauelemente des Lymphgefäßsystems und deren Funktion
(Structural elements of the lymphatic system and their function)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1306

Lymphofaszialer Release (LFR) – Faszie und Fluida in einem
(Lympho-fascia release (LFR) - fascia and fluids in one)
Chikly, B., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1307

Morphodynamik der Lymphe und Fluida im Körper
(Morphodynamics of lymph and fluids in the body)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1308

Lymphsystem und osteopathische Forschung
(Lymphatic system and osteopathic research)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1309

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text
1310

Patienteninfo: Lastenschiffer und Polizei – Lymphe und Lymphsystem
(Patient information: Cargo shippers and police - lymph and lymphatic system)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1311

Wie Wasser in Wasser: Metaphorik des Eingebettet-Seins in der Osteopathie
(Like water in water: metaphorics of being embedded in osteopathy)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1312

Den Fluch der somatischen Dysfunktion überwinden
(Overcoming the curse of somatic dysfunction)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
1313

The Hawthorne effect: stronger than the placebo effect?
Berthelot, J. M., Le Goff, B., Maugars, Y.
Joint Bone Spine, 2011/07
Free full text
1314

Re: The Fall of the postural-structural-biomechanical model in manual therapy: exemplified by lower back pain. A response to reviewers and further thoughts
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/07
1315

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06
1316

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06
1317

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06
1318

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text
1319

Osteopathie bei Kindern und Jugendlichen mit juveniler idiopathischer Arthritis
(Osteopathy for children and adolescents with juvenile idiopathic arthritis)
Strohmayer, A.
Unpublished MSc thesis, 2011/06
Free full text
1320

Veränderung der Hämodynamik der A. vertebralis in verschiedenen Kopfpositionen
(Changes in haemodynamics of the vertebral artery in various head positions)
Petautschnig, K.
Unpublished MSc thesis, 2011/06
Free full text
1321

Klassische Osteopathie: eine Feldtheorie als Vorbild und Grundlage
(Classic osteopathy: A field theory as a model and basis)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/06
1322

The use of videos in teaching psychomotor skills: A look at a new way of teaching osteopathic manipulative treatment to a remote campus
Ferronato, M., Hruby, R. J.
The AAO Journal, 2011/06
Free full text
1323

From The Archives: History of Osteopathy and Twentieth-Century Medical Practice. Cincinnati: Press of Jennings and Graham; 1906: 23-24.
Booth, E.R.
The AAO Journal, 2011/06
Free full text
1324

Jenette “Nettie” Bolles: First woman to pioneer osteopathy
Blumer, J.
The AAO Journal, 2011/06
Free full text
1325

Die Folgen der Armut lindern - osteopathische Behandlung in Kenia
(Alleviating the effects of poverty - osteopathic treatment in Kenya)
Abb, B.
Osteopathische Medizin, 2011/06
1326

Wechselseitige Beziehungsdynamiken und subjektive Ansätze in der Osteopathie
(Dynamics of reciprocal correlations and subjective approaches in osteopathy)
Liem, T.
Osteopathische Medizin, 2011/06
1327

Der Einfluss von Rudolf Virchow auf Andrew Taylor Still – eine kulturwissenschaftliche Untersuchung
(The influence of Rudolf Virchow on Andrew Taylor Still - A cultural scientific investigation)
Nagel, M., Bahr, C., Ciranna-Raab, C.
Osteopathische Medizin, 2011/06
1328

Überlegungen zur Untersuchung und Behandlung der Pleura parietalis über periphere Faszienanheftungen
(Deliberations about the examination and treatment of the parietal pleura over peripheral fascial fixations)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2011/06
1329

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1330

Osteopathie - Teil der Schulmedizin oder paramedizinisches Verfahren?
(Osteopathy - part of scientific medicine or paramedical method?)
Weiss, J.
Deutsche Medizinische Wochenschrift, 2011/05
1331

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1332

Tug technique de escafoides para escafoides en rotación externa
(The Tug navicular technique for externally rotated navicular bones)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
1333

Mecanismo de acción del tratamiento manipulativo vertebral
(Mechanism of action of spinal manipulative therapy)
Maigne, J.Y., Vautravers, P.
Osteopatía Científica, 2011/05
1334

Técnica de thrust para disfunción posterior unilateral del cóndilo occipital
(Thrust technique for unilateral posterior dysfunction of the occipital condyle)
Pérez Cátedra, P., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
1335

Kieferbeschwerden aus Sicht des Fasziendistorsionsmodells (FDM)
(Jaw complaints from the point of view of the fascial distortion model (FDM))
Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1336

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1337

Anatomie des Kiefergelenks als Teil des kraniomandibulären Systems
(Anatomy of the temporomandibular joint as part of the craniomandibular system)
Breul, R., Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1338

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1339

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1340

Was ist eigentlich …
(What actually is ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1341

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1342

CMD: Ein falscher Biss, der fatale Folgen haben kann
(TMD: A wrong bite that can have fatal consequences)
Sayfadini, A. A.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1343

Patienteninfo: Kiefergelenke – mehr als nur Mund auf und zu
(Patient information: Temporomandibular joint - more than just opening and closing the mouth)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1344

Zahnärztliche Schienentherapie bei CMD: Bewertung myogener Effekte in der Literatur
(Dental splint therapy for CMD: evaluation of myogenic effects in the literature)
Strate, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1345

Das Urheberrecht (UrhG)
(Copyright law (UrhG))
Ulusal, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1346

Schmerzverursachende Belastungen des Kausystems
(Pain-causing strains of the masticatory system)
Wühr, E.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
1347

Is a postural-structural-biomechanical model, within manual therapies, viable?: A JBMT debate
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04
1348

Invited response: (without science, there must be art)
Hannon, J. C.
Journal of Bodywork and Movement Therapies, 2011/04
1349

Invited response (the postural structural model, with boundary conditions)
Irvin, R. E.
Journal of Bodywork and Movement Therapies, 2011/04
1350

The fall of the postural-structural-biomechanical model in manual and physical therapies: exemplified by lower back pain
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/04
1351

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04
1352

Invited response
McGill, S.
Journal of Bodywork and Movement Therapies, 2011/04
1353

Helical tensegrity as a structural mechanism in human anatomy
Scarr, G.
International Journal of Osteopathic Medicine, 2011/03
1354

A “System” of Cranial Manipulation: An Original Contribution on Osteopathic Technique
Miller, D. S.
The AAO Journal, 2011/03
Free full text
1355

From The Archives: From: Fryette, HH. Principles of Osteopathic Technique. Carmel, CA: American Academy of Osteopathy, 1954. 61-64.
Fryette, H.H.
The AAO Journal, 2011/03
Free full text
1356

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text
1357

Prinzipien der osteopathischen Notfalltechniken nach Robert Rousse
(Principles of osteopathic emergency techniques according to Robert Rouse)
Prediger, G.
Osteopathische Medizin, 2011/03
1358

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03
1359

Manual therapy of the mandibular accessory ligaments for the management of temporomandibular joint disorders
Cuccia, A. M., Caradonna, C., Caradonna, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text
1360

Großbänder des hinteren Beckenrings: Sakrotuberal- und Sakrospinalband
(Major ligaments of the posterior pelvic girdle: sacrotuberous and sacrospinal ligaments)
Hammer, N., Bechmann, I., Steinke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1361

Morphologische und funktionelle Aspekte der Harnblase
(Morphological and functional aspects of the urinary bladder)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1362

Patienteninfo: Nein – eine Klingelhose möcht' ich nicht
(Patient information: No - I don't want diapers)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1363

Osteopathische Interventionen bei Erkrankungen der Prostata
(Osteopathic interventions in diseases of the prostate gland)
Marx, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1364

Von Littlejohn lernen: Osteopathie als angewandte biologische Wissenschaft (Teil 2)
(Learning from Littlejohn: Osteopathy as an Applied Biological Science (Part 2))
Pöttner, M., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1365

Chronische Prostatitis: Gemeinsam geht's besser! 
(Chronic prostatitis: Let's work together!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1366

Einschränkungen der Therapierfreiheit des Heilpraktikers im Urogenitalbereich
(Restrictions on the freedom of therapy of the alternative practitioner in the urogenital area)
Ulusal, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1367

Psychodynamik und Psychomorphologie am Beispiel der Nieren und des Dünndarms
(Psychodynamics and psychomorphology exemplified by the kidneys and the small intestine)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1368

Wer war eigentlich …
(Who actually was ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1369

A randomized controlled trial investigating the effects of craniosacral therapy on pain and heart rate variability in fibromyalgia patients
Castro-Sánchez, A. M., Matarán-Peñarrocha, G. A., Sánchez-Labraca, N., Quesada-Rubio, J. M., Granero-Molina, J., Moreno-Lorenzo, C.
Clinical Rehabilitation, 2011/01
1370

Osteopathy and (hatha) yoga
Liem, T.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text
1371

Ist der Rumpf stabil, bessern sich die Beschwerden: Behandlungskonzept bei lumbalen Rückenschmerzen
(Concept of treatment of low back pain)
Müller, R., Linz, W., Buchmann, J.
MMW - Fortschritte der Medizin, 2011/01
1372

Manualtherapie bei Insertionstendinosen: Fersensporn, Patellaspitzensyndrom, Tennisellenbogen, Schultersteife
(Manual therapy for insertional tendinosis)
Müller, R., Linz, W., Buchmann, J.
MMW - Fortschritte der Medizin, 2011/01
1373

Técnica semidirecta de thrust para una disfunción somática no neutra en ERS izquierda de la tercera vértebra cervical
(Thrust technique for left ERS somatic dysfunction of the third cervical vertebra)
Guerrero, A. M., Rodríguez, R. P.
Osteopatía Científica, 2011/01
1374

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011
1375

Wirkt sich eine viszerale Behandlung auf das parietale System aus? Eine Studie am Beispiel der arthrotischen Hüfte und der Unterbauchorgane
(Does a visceral treatment have an effect on the parietal system? A Case Study using the example of the arthritic hip and the pelvic organs)
Gosch, D.
Unpublished MSc thesis, 2010/12
Free full text
1376

Kompressionssyndrome der Apertura thoracis superior (Thoracic-Outlet-Kompressionssyndrom)
(Compression syndrome of the superior thoracic aperture (thoracic outlet compression syndrome))
Beck, M.
Osteopathische Medizin, 2010/12
1377

An Osteopathic Approach to Hypothyroidism
Burns, D. K.
The AAO Journal, 2010/12
Free full text
1378

Restoration of a McManis Treatment Stool
Clark, R. C.
The AAO Journal, 2010/12
Free full text
1379

Biomechanische Regulatoren – Modellkonzept zur Verbesserung der Gelenkbeweglichkeit
(Biomechanic regulators - Model concept for the improvement of joint mobility)
Föhrweiser-Wesolek, U.
Osteopathische Medizin, 2010/12
1380

Local and Systemic Mechanisms in Disturbance of Functions of the Vegetative Nervous System
Erofeev, N. P.
The AAO Journal, 2010/12
Free full text
1381

Atypical Pathologic Somatic Dysfunctions: Techniques Revisited
Miller, D. S.
The AAO Journal, 2010/12
Free full text
1382

EROP-Richtlinien: Kernkompetenzen und Praxisstandards in der osteopathischen Medizin
(EROP guidelines: Core competencies and practice standards in osteopathic medicine)
Mayer, J.
Osteopathische Medizin, 2010/12
1383

Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways
Watson, L. A., Pizzari, T.
International Journal of Osteopathic Medicine, 2010/12
1384

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text
1385

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11
1386

Das Schädeldach als Tensegrity-Struktur
(The cranial roof as a tensegrity structure)
Scarr, G., Hinz, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1387

Hinweise auf eine fasziale Rhythmizität?
(Evidence of fascial rhythmicity?)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1388

Knochen wie Kontinentalschollen
(Bones like continental floes)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1389

Anatomische Gesichtspunkte zur harten Hirnhaut
(Anatomical viewpoints on the hard meninges)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1390

Volumen- und Elastizitätsdiagnostik des Kraniums
(Cranial volume and elasticity diagnostics)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1391

Multiple Midliner: Ein osteopathisches Sommermärchen
(Multiple Midliners: An Osteopathic Summer's Tale)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1392

Hirnschädel und Menschsein
(Neurocranium and being human)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1393

Auf der Suche nach der Mittellinie
(Searching for the midline)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1394

Suturen des Hirnschädels
(Sutures of the cranium)
Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1395

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text
1396

Von Littlejohn lernen: Osteopathie – angewandte Wissenschaft (Teil 1)
(Learning from Littlejohn: Osteopathy as an Applied Science (Part 1))
Pöttner, M., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
1397

Placebo: Missverständnisse und Vorurteile
(Placebo: Misconceptions and prejudices)
Breidert, M., Hofbauer, K.
Osteopathische Medizin, 2010/09
1398

Alexander-Technik – Grundlagen und Parallelen zur Osteopathie
(The Alexander Technique Principles and parallels to osteopathy)
Eisenreich, U.
Osteopathische Medizin, 2010/09
1399

Übertragener Muskelschmerz ist primär peripheren Ursprungs: die Barrier-Dam-Hypothese
(Referred muscle pain is primarily of peripheral origin: The barrier-dam theory)
Farasyn, A.
Osteopathische Medizin, 2010/09
1400

Baby-Shiatsu – eine energetische Ergänzung zur osteopathischen Behandlung
(Baby Shiatsu: An energetic supplement to osteopathic treatment)
Kalbantner-Wernicke, K., Wernicke, T.
Osteopathische Medizin, 2010/09
1401

Dig on: A Case Study
Kolkhorst, A. B., Kary, D. J.
The AAO Journal, 2010/09
Free full text
1402

Various methods of CRI palpation of body parts, their diagnostic values and interpretation of the findings
Pribadi, K. S.
The AAO Journal, 2010/09
Free full text
1403

Tensegrity in der Osteopathie
(Tensegrity in osteopathy)
Pflüger, C.
Osteopathische Medizin, 2010/09
1404

Hamo-Study 3, Phase 1: Effects of sternotomy on the mobility of the heart under influence of respiration at 3-months postoperative
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2010/09
1405

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text
1406

Técnica de lift-off para dorsales medias (T4-T10)
(Lift off technique in medium dorsal vertebrae (T4-T10))
Iglesias, J. G., del Cerro, L. P., Rodríguez Blanco, C.
Osteopatía Científica, 2010/09
1407

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text
1408

A ‘system based’ approach to risk assessment of the cervical spine prior to manual therapy
Taylor, Alan J., Kerry, R.
International Journal of Osteopathic Medicine, 2010/09
1409

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07
1410

Physiotherapie et osteopathie: une prise en charge reellement holistique des sportifs.
(Physiotherapy and osteopathy: a real holistic supervision of athletes)
Larequi, Y.
Revue Medicale Suisse, 2010/08
1411

Notes on visceral adhesions as fascial pathology
Hedley, G.
Journal of Bodywork and Movement Therapies, 2010/07
1412

Der Gesichtsschädel
(Patient information: The viscerocranium)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1413

The Fickle finger of quackery in otology: the saga of Curtis H. Muncie, Osteopath
Swamy, R. S., Jackler, R. K.
Otology & Neurotology, 2010/07
1414

Nasen- und Darmschleimhaut in der osteopathischen Behandlung
(Nasal and intestinal mucosa in osteopathic treatment)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1415

Was sind eigentlich... Viszera?
(What actually are viscera?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
Free full text
1416

Der osteopathisch ganzheitliche Ansatz zur Homöostase (Teil 2)
(The osteopathic holistic approach to homeostasis, part 2)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1417

Zum Aufbau des Gesichts
(Regarding the facial structure)
Fanghänel, J., Eigenwillig, P., Proff, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1418

Osteopathische Techniken bei Nasennebenhöhlenentzündung
(Osteopathic techniques in sinusitis)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1419

CRPS und Osteopathie – Möglichkeiten und Grenzen
(CRPS and osteopathy - possibilities and limits)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1420

Entwicklung des Viszerokraniums
(Development of the viscerocranium)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
1421

What is 'manipulation'? A reappraisal
Evans, D. W., Lucas, N.
Manual Therapy, 2010/06
Free full text
1422

The application of osteopathic treatments to pediatric sports injuries
Bolin, D. J.
Pediatric Clinics of North America, 2010/06
Free full text
1423

Médecine manuelle – ostéopathie en France organisation – enseignement – champs de compétences
Manual medicine - osteopathy in France organization - education - fields of expertise
Vautravers, P., Isner, M. E., Blaes, C.
Annals of Physical and Rehabilitation Medicine, 2010/06
Free full text
1424

Einführung in die Methode der Fascial Manipulation®
(Introduction in the fascial manipulation method®)
Day, J. A., Stecco, C.
Osteopathische Medizin, 2010/06
1425

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text
1426

Principles of Osteopathy in the Battlefield
Kozminski, M.
The AAO Journal, 2010/06
Free full text
1427

Body Adjustment in der Frauenheilkunde
(Body adjustment in gynecology)
Masters, P.
Osteopathische Medizin, 2010/06
1428

Fließende Kunst an Körper und Seele: die traditionelle Thai-Massage
(Flowing art on body and soul: The traditional Thai massage)
Möller, H.
Osteopathische Medizin, 2010/06
1429

Median Arcuate Ligament Syndrome – Literature Study and Osteopathic Considerations
Peeters, L.
The AAO Journal, 2010/06
Free full text
1430

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06
1431

Why do spinal manipulation techniques take the form they do? Towards a general model of spinal manipulation
Evans, D. W.
Manual Therapy, 2010/06
Free full text
1432

Diagnostyka fizjoterapeutyczna i osteopatyczna w zawodowych zaburzeniach glosu.
(The application of physiotherapeutic and ostheopatic diagnostics in occupational voice disorders)
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Kowalska, M. S.
Medycyna Pracy, 2010/06
1433

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05
1434

L'osteopathie pour soulager certaines douleurs.
(Osteopathy for relieving certain pain)
Gnaho, S.
Revue de l'infirmiere, 2010/05
1435

The challenges of primary care and innovative responses in osteopathic education
Shannon, S. C., Ferretti, S. M., Wood, D., Levitan, T.
Health Affairs, 2010/05
1436

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text
1437

Klinische Relevanz statt Placebo-Kontrolle
(Clinical relevance instead of placebo control)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1438

Morbus Sudeck und Osteopathie?
(Complex Regional Pain Syndrome and Osteopathy?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1439

Formbarkeit von Faszien und Membranen: Behandlung innerer Brücken im Kontext der Forschung
(Plasticity of Fascias and Membranes: Treatment of Inner Bridges in the Context of Research)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1440

Störungsketten im Bindegewebe
(Patient information: Disruptive chains in the fascia)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1441

Ursprung, Raum und Wirklichkeit faszialer Motilität
(Origin, Space and Reality of Fascial Motility)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1442

Was ist eigentlich... intrinsische Bewegung?
(What actually is intrinsic movement?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1443

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1444

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text
1445

Kontraktilität von Faszien
(Contractility of Fascias – How is This Behavior Possible?)
Brand, E.M.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1446

Wasser und seine Bedeutung für Zellen und Bindegewebe
(Water as the Basis for Our Life and its Distribution in Our Body)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1447

Mikro- und makroskopische Betrachtung der Faszienfunktionen
(Microscopic and Macroscopic Reflections on the Functions of Fascias)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
1448

DOs vs. Dos: proposed medical school creates rift between osteopathic physicians, UNT
Ortolon, K.
Texas Medicine, 2010/03
1449

Osteopathic Manipulative Treatment In the Emergency Department: A Two-Dimensional Curriculum
Mesisca, M., Hoffman, K., Fenati, G., Hruby, R. J.
The AAO Journal, 2010/03
Free full text
1450

Relevanz der Intuition in der Osteopathie – Überlegungen und ein Literaturüberblick
(Relevance of intuition in osteopathy - Considerations and a literature overview)
Sidler, S.
Osteopathische Medizin, 2010/03
1451

Die Fascia thoracolumbalis als potenzielle Ursache für Rückenschmerzen: anatomische Grundlagen und klinische Aspekte
(The thoracolumbar fascia as potential cause of back pain: Anatomical bases and clinical aspects)
Tesarz, J.
Osteopathische Medizin, 2010/03
1452

Composite sacroiliac joint pain provocation tests: A question of clinical significance
McGrath, M. C.
International Journal of Osteopathic Medicine, 2010/03
1453

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1454

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1455

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1456

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
1457

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text
1458

Performing arts medicine--instrumentalist musicians, Part II--examination
Dommerholt, J.
Journal of Bodywork and Movement Therapies, 2010/01
1459

Osteopathie: Die Sicht der Bundesärztekammer
(Osteopathy: The view of the German Medical Association)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1460

Fascia: A missing link in our understanding of the pathology of fibromyalgia
Liptan, G. L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text
1461

Ist das Bindegewebe ein Organ?
(Patient information: Is fascia an organ?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1462

DO • Korrespondenten berichten - Die Entwicklung der Osteopathie in der Schweiz
(DO • Correspondents reporting - The development of osteopathy in Switzerland)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
Free full text
1463

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01
1464

The osteopathic physician and end-of-life care
Hernandez, M., Ledbetter, S., Trevil, R., Perez, A., White, C.
Osteopathic Family Physician, 2010/01
1465

Eine Faszienreise vom Musculus longissimus über den lumbosakralen Übergang bis zum Hyoid und dem Pharynx
(A Fascial Voyage from the Longissimus Muscle via the Lumbosacral Transition to the Hyoid and the Pharynx)
Bartmer–Leitl, E.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1466

Das Fasziendistorsionsmodell nach Stephen Typaldos
(The Fascial Distortion Model According to Stephen Typaldos)
Fischer, T., Rossmy, C., Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1467

Gary Fryer –”...there is not much that we can say without any doubt.”
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1468

Das viszerale Faszienskelett des Bauchraums
(The Visceral Fascial Skeleton of the Abdominal Cavity)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1469

Erkenntnisfindung in der Osteopathie des 20. Jahrhunderts – J. M. Littlejohn versus Sutherland Cranial Teaching Foundation
(Gaining Knowledge in the Osteopathy of the 20th Century)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1470

Osteopathische Betrachtung der Narbenbehandlung
(Osteopathic Reflection on the Treatment of Scars)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
1471

Contribution of the osteopathy on the flexibility of the lumbar column and intensity of pain in young adult patients with acute low back pain
Rocha, R., Pereira, J. S.
Revista Terapia Manual, 2010
1472

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12
1473

Die Rolle der Osteopathie in der Korrektur von Schädeldeformierungen bei Neugeborenen und Kleinstkindern
(The role of osteopathy in correcting cranial deformations in neonates and young infants)
Amiel-Tison, C., Soyez-Papiernik, E.
Osteopathische Medizin, 2009/12
1474

Beziehung und Bindung in der osteopathischen Kinderbehandlung
(Relationship and attachment in osteopathic treatment of children)
Dräger, K., Dräger, C.
Osteopathische Medizin, 2009/12
1475

Dr. A. T. Still’s Treating Chair
Archer, J.
The AAO Journal, 2009/12
Free full text
1476

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text
1477

There Are More Things in Heaven and Earth…
Ching, L. M.G.
The AAO Journal, 2009/12
Free full text
1478

Analyse critique de l’enseignement de techniques manipulatives rachidiennes basées sur les « lois de Fryette »
(Critical analysis of teaching spinal manipulation techniques based on the “Fryette laws“)
Zegarra-Parodi, R., Fabre, L.
Kinésithérapie, la Revue, 2009/12
1479

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text
1480

Reliabilitätsstudie über die Befunderhebung der Wirbelsäule nach der Methode der Lien Mécanique Ostéopathique
(A reliability study on spine findings according to the LMO method)
Hafen-Bardella, C.
Unpublished MSc thesis, 2009/11
Free full text
1481

Die Bedeutung des Rückfußes für Stand, Gang und Körperhaltung
(The Significance of the Calcaneal Part of the Foot for Standing, Gait and Posture in Functional Orthopedics)
Pfaff, G., Kaune, M.
DO - Deutsche Zeitschrift für Osteopathie, 2009/11
1482

Leben ist Bewegung
(Life is movement)
Gillemot, B., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1483

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1484

Osteopathie für Pferd und Reiter
(Osteopathy for Horse and Rider)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1485

Erfahrungsbericht aus dem Basketball–Trainingslager
(Report on the Experiences Gained During the Basketball Training Camp of the Men's National Team)
Kaufmann, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1486

Manipulation vor dem Wettkampf?
(Manipulative treatment before the competition?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1487

Osteopathie im Sport
(Osteopathy in sports)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1488

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1489

Leistung optimieren: Osteopathie und Sport
(Optimizing performance: Osteopathy and sports)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
1490

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
1491

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09
1492

The functions of breathing and its dysfunctions and their relationship to breathing therapy
Courtney, R.
International Journal of Osteopathic Medicine, 2009/09
1493

Trager® Psychophysische Integration
(Trager® Psychophysical Integration)
Heigl, M.
Osteopathische Medizin, 2009/09
1494

Kräfteverteilungen im Körper des Menschen am Beispiel von Gewichthebern – Tensegrity als Erklärungsmodell
(The distribution of forces in the human body using the example of a weightlifter - Tensegrity as explanatory model)
Siemsen, C.H., Dittrich, H.
Osteopathische Medizin, 2009/09
1495

Ligamente als Entstehungsort berufsbedingter Störungen
(The ligaments as points of origin of occupational diseases)
Solomonow, M.
Osteopathische Medizin, 2009/09
1496

Osteopathie nach HWS-Schleudertrauma
(Osteopathy after whiplash injury)
Tempelhof, S.
Osteopathische Medizin, 2009/09
1497

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
1498

Understanding the Process of Fascial Unwinding
Minasny, B.
International Journal of Therapeutic Massage and Bodywork, 2009/09
Free full text
1499

La langue : déglutition, fonctions oro-faciales, croissance crânio-faciale
(The tongue: deglutition, orofacial functions and craniofacial growth)
Landouzy, J.M., Sergent Delattre, A., Fenart, R., Delattre, B., Claire, J., Biecq, M.
International Orthodontics, 2009/09
1500

Human Volume Tissue Investigation Method
Mokhov, D. E., Chashchin, A. V., Erofeev, N. P., Vcherashny, D. B.
The AAO Journal, 2009/09
Free full text
1501

Swedenborg's influence on Sutherland's ‘Primary Respiratory Mechanism’ model in cranial osteopathy
Jordan, T.
International Journal of Osteopathic Medicine, 2009/09
1502

Análisis de la fiabilidad palpatoria del pulso en la arteria radial mediante sonografía Doppler
(Analysis of the reliability of radial artery pulse palpation through Doppler sonography)
Cortés Vega, M. D., Rodríguez Blanco, C., González García, P., Ribelles Mayo, J., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09
1503

Influencias de la relación maxilomandibular en el tratamiento postural mediante inhibición muscular
(Influence of maxillomandibular relationship in postural treatment involving muscle inhibition)
Rodríguez Blanco, C., Torres-Lagares, D., Munuera-Martínez, P. V., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09
1504

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text
1505

Time for the osteopathic profession to take the lead in musculoskeletal research
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/07
Free full text
1506

Towards evidence based medicine for paediatricians. Is cranio-sacral therapy useful in the management of crying babies?
Bradley, E., Finlay, F.
Archives of Disease in Childhood, 2009/07
1507

Osteopathische Behandlung akuter Erkrankungen
(Osteopathic Treatment of Acute Diseases)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1508

Magenulkus
(Gastric ulcer)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1509

Vincent Benedetto – Die Basis der Osteopathie
(Vincent Benedetto - The basis of osteopathy)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1510

Akute Krankheitsbilder – Möglichkeiten und Grenzen der klinischen Osteopathie heute
(Acute Clinical Pictures – Chances and Limits of Today's Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1511

Aufruf Arbeitskreis klinische Osteopathie
(Appeal for a Working Group Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1512

Osteopathie bei akuten Erkrankungen
(Osteopathy for acute diseases)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1513

Grundlagen der Entzündungspathologie
(Basics of the Pathology of Inflammation)
Siegert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1514

WPO–Osteo – Bedeutung und Rechtsfolgen
(WPO-Osteo - Significance and legal consequences)
Tamm, B.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1515

Akute Halswirbelsäulenerkrankungen – Grenzbereiche
(Frontiers – Acute Diseases of the Cervical Spine)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
1516

Die gewollte Spaltung
(Deliberate division)
Gröbmüller, J.
Osteopathische Medizin, 2009/06
1517

Muskeln als Verbundmaterial: Ein Überblick über die Kraftübertragung in Muskeln und Gliedmaßen
(Muscles as composite material: A review of force transmission in muscles and limbs)
Huijing, P. A.
Osteopathische Medizin, 2009/06
1518

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text
1519

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text
1520

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text
1521

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text
1522

Osteopathic postdoctoral training institutions: a decentralized model for facilitating accreditation and program quality
Peska, D. N., Opipari, M. I., Watson, D. K.
Academic Medicine, 2009/06
Free full text
1523

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text
1524

Strukturelle Integration durch Rolfing® und Normal Function
(Structural integration with Rolfing® and normal function)
Specka, I.
Osteopathische Medizin, 2009/06
1525

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
1526

Schwindel in der osteopathischen Praxis
(Dizziness in osteopathy practice)
Thomas, D.
Osteopathische Medizin, 2009/06
1527

Osteopathic medical graduates in ACGME residencies: a threat to the core philosophy and distinctiveness of osteopathic medicine.
Veit, K. J.
Academic Medicine, 2009/06
Free full text
1528

Accreditation standards of osteopathic and allopathic medical schools: could they affect educational quality?
Wood, D. L., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
1529

Staatliche Anerkennung: Hessische Osteopathie-Verordnung im Fokus von Standesinteressen
(State accreditation: Hessian osteopathy law focuses on the interests of the profession)
Wehr, M.
Osteopathische Medizin, 2009/06
1530

The separate osteopathic medical education pathway: isn't it time we got our acts together? Counterpoint
Cohen, J. J.
Academic Medicine, 2009/06
Free full text
1531

The impact of osteopathic physicians' participation in ACGME-accredited postdoctoral programs, 1985-2006
Cummings, M., Sefcik, D. J.
Academic Medicine, 2009/06
Free full text
1532

Scapular Glide: Functional relationships, dysfunction and treatment
Kary, D. J.
The AAO Journal, 2009/06
Free full text
1533

Osteopathic approach to the spleen
Peeters, L., Lason, G.
The AAO Journal, 2009/06
Free full text
1534

Técnica semidirecta de thrust con kick para lesión de ilíaco anterior izquierdo
(Semidirect thrust kick technique in left anterior iliac dysfunction)
Mancha, J. A. D., Martín, C. O.
Osteopatía Científica, 2009/05
1535

Pruebas para la detección de hipersensibilidad sensorial o hiperexcitabilidad central asociada al dolor cervical
(Testing for sensory hypersensitivity or central hyperexcitability associated with cervical spine pain)
Sterling, M.
Osteopatía Científica, 2009/04
1536

Classroom lectures - where are the students and don't they care?
Reed, K.
Iowa Medicine: Journal of the Iowa Medical Society, 2009/03-04
1537

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text
1538

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03
1539

Therapeutic needling in osteopathic practice: An evidence-informed perspective
Rickards, L. D.
International Journal of Osteopathic Medicine, 2009/03
1540

A Case History of Recent Problem Breathing and Special OMT for the Heart
Chapello, I. A.
The AAO Journal, 2009/03
Free full text
1541

The Integration of Undergraduate Osteopathic Manipulative Medicine Fellows into Medical Education: The KCUMB-COM Model
Cox, W. J., Boyajian-O'Neill, L. A., Roach, M. D., Ridgley, J. A.
The AAO Journal, 2009/03
Free full text
1542

Fred Mitchell Jr. und die Entwicklung der Muskel–Energie–Techniken
(Fred Mitchell Jr. and the Development of the Muscle Energy Techniques)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1543

WPO: Ein Meilenstein näher betrachtet
(WPO: A closer look at a milestone)
Fuhrmann, M., Weynen, R., von Tümpling, U.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1544

Geteilte Aufmerksamkeit
(Divided Attention)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1545

Das Handgelenk, eine Betrachtung
(The Wrist, a Reflection)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1546

Palpatorische Wahrnehmungen: Die fünf Sinne und darüber hinaus
(Palpation Perception: Five Senses And Beyond)
Psutka, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1547

Osteopathische Informationsquellen
(Osteopathic sources of information)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1548

Palpation und das Dilemma der osteopathischen Hände
(Palpation and the Dilemma of Osteopathic Hands)
Sommerfeld, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1549

Anatomie der Wahrnehmung – Somatoviszerosensorik: Wie man fühlt, was man spürt
(Anatomy of Perception – Somatovisceral Sensory System: How One Feels, What One Senses)
Storr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
1550

Palpation zwischen Struktur und Energie
(Palpation between Structure and Energy)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
Free full text
1551

Brachial plexus injuries in neonates: an osteopathic approach
Mason, D. C., Ciervo, C. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text
1552

Grenzen des Konzepts der Symmetrie in der osteopathischen Beurteilung: Eine Erweiterung des Konzepts in Hinblick auf Proportionalität führt zu besseren klinischen Ergebnissen
(The limits of the concept of symmetry in osteopathic diagnostics: Expanding the concept in regards to proportionality leads to improved clinical results)
Brooks, W.
Osteopathische Medizin, 2009/02
1553

Osteopathie und (Hatha-)Yoga
(Osteopathy and (Hatha) yoga)
Liem, T.
Osteopathische Medizin, 2009/02
1554

Die Leber – mehr als GOT und GPT?
(The liver – more than GOT and GPT?)
Preuße, U., Giebel, J.
Osteopathische Medizin, 2009/02
1555

Spracherwerb und osteopathische Gedanken zur Dyslalie
(Language acquisition and osteopathic thought in regards to dyslalia)
Riedel, M.
Osteopathische Medizin, 2009/02
1556

Abenteuer Osteopathie: Die Arbeit des Vereins Internationale Osteopathie e.V. (INO)
(The adventure of osteopathy: The work of the INO (Verein Internationale Osteopathie e.V.))
Ries, M., Bauer, C.
Osteopathische Medizin, 2009/02
1557

DO • Korrespondenten berichten
(DO • Correspondents reporting)
Jevbratt, M.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
Free full text
1558

Osteopathische Früherkennung
(Osteopathic early detection)
Bayer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1559

Prä– und postnatale Entwicklung des Hüftgelenks
(Prenatal and Postnatal Development of the Hip Joint)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1560

Wie lassen sich osteopathische Techniken für die Behandlung von Kindern adaptieren? – Die Herangehensweise des Osteopathischen Zentrums für Kinder in Wien
(How Can Osteopathic Techniques Be Adapted for the Treatment of Children?)
Burian–Lang, E., Mückler, A., Urbanek, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1561

Auf ein Wort: Zum Umgang mit Kindern in Sprache und Gestus
(A Word About Dealing with Children in Speech and Gestures by the Example of Enuresis)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1562

Osteopathie bei Frühgeborenen
(Osteopathy with Premature Infants)
Lamberts, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1563

Auswirkungen persistierender Reflexe auf die auditorische und visuelle Wahrnehmung
(Effects of Persisting Reflexes on the Auditory and Visual Perception)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1564

Neurobiologische Prinzipien und klinische Aspekte der Säuglingsentwicklung – Teil 2: Umgebungsfaktoren
(Neurobiological principles and clinical aspects of infant development - Part 2: Environmental factors)
Philippi, H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1565

Hilfe – mein Kind ist schief!
(Help - my child is crooked!)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
1566

Muscle Impulse, A Muscle Energy Variant
van Buskirk, R. L.
The AAO Journal, 2008/12
Free full text
1567

Hamo-study i: investigation of the effect of breathing on the position of the heart
Roncada, G., Bijnens, E., Dendale, P., Buekens, J.
International Journal of Osteopathic Medicine, 2008/12
1568

Hamo-study ii: effects of sternotomy on the mobility of the heart under influence of respiration
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2008/12
1569

Study on the effectiveness of a test-dependent osteopathic treatment for women with persistent post partum back pain: A randomized controlled trial
Recknagel, C., Roß, J., Recknagel, A., Ruetz, M., Schwerla, F.
International Journal of Osteopathic Medicine, 2008/12
1570

Cambios en la presión arterial y frecuencia cardíaca después de una presión sobre la válvula aórtica en sujetos con hipertensión arterial esencial
(Changes in arterial pressure and cardiac frequency after pressure on the aortic valve in patients with essential hypertension)
Benito, M. M., Marín, R. C.
Osteopatía Científica, 2008/12
1571

La prueba de la movilidad cervical: metodología e implicaciones clínicas
(Cervical motion testing: methodology and clinical implications)
Prushansky, T., Dvir, Z.
Osteopatía Científica, 2008/12
1572

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12
1573

Neurobiologische Aspekte eines Knackgeräusches im Rahmen einer HVLA Technik
(Neurobiological aspects of a cracking noise within the framework of an HVLA technique)
Beck, M.
Osteopathische Medizin, 2008/11
1574

Tensegrity und Mechanoregulation: Vom Skelett zum Zytoskelett
(Tensegrity and mechanoregulation: From skeleton to cytoskeleton)
Chen, C. S., Ingber, D. E.
Osteopathische Medizin, 2008/11
1575

Osteopathie in der Pädiatrie, Teil 4: Sakrum und Os sphenoidale
(Osteopathy in Pediatrics Part 4: Sacrum and Os Sphenoidale)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1576

Kinder!
(Children!)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1577

Unsere Haut – Bau und Leistungen, Teil 2
(Our Skin – Structure and Performance, Part 2)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1578

Framingham–Studie
(Framingham Study)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1579

Diagnosis and management of piriformis syndrome: an osteopathic approach
Boyajian-O'Neill, L. A., McClain, R. L., Coleman, M. K., Thomas, P. P.
The Journal of the American Osteopathic Association, 2008/11
Free full text
1580

Neurobiologische Prinzipien und klinische Aspekte der Säuglingsentwicklung, Teil 1
(Neurobiological principles and clinical aspects of infant development - Part 1)
Philippi, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1581

Die drei Säulen der Y–Fuge der Säuglingshüfte
(The Three Pillars of the Hypsiloid Cartilage of the Hip of Infants)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1582

Säuglinge sind Viszera
(Infants are Viscera)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
1583

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques: a pilot crossover trial
Rivers, W. E., Treffer, K. D., Glaros, A. G., Williams, C. L.
The Journal of the American Osteopathic Association, 2008/11
Free full text
1584

„Tensegrity” – ursprünglich ein Begriff aus der Architektur
('Tensegrity' – originally an architectonic term)
Eichhorn, V.
Osteopathische Medizin, 2008/11
1585

Manuelle Medizin an der Halswirbelsäule: Atraumatische Weichtechnik der Chirotherapie und HVLA-Technik der Osteopathie im Synergismus
(Manuel medicine targeting the cervical spine: Synergies between atraumatic chiropractic techniques and osteopathy's HLVA-technique)
Stahlhofer, H.
Osteopathische Medizin, 2008/11
1586

Haben osteopathische Behandlungen einen Einfluss auf die Artikulationsfähigkeit bei Vorschulkindern mit Sigmatismus / Schetismus? Eine randomisierte kontrollierte Studie
(Can osteopathic treatments improve the capability of articulation and speech of children between four and six years suffering from speech disorders (Dyslalia). A randomized controlled trial)
Beckewitz-Hübner, M., Kraus, M.
Unpublished D.O. thesis, 2008/10
1587

Osteopathische Behandlung bei somatoformen autonomen Funktionsstörungen des Herz- und Kreislaufsystems
(Osteopathic treatment of patients with cardiovascular somatoform autonomic dysfunctions (SAD). A randomized controlled trial)
Mühlen, N.
Unpublished D.O. thesis, 2008/10
1588

Legg reduction maneuver for patients with anterior shoulder dislocation
Dyck Jr., D. D., Porter, N. W., Dunbar, B. D.
The Journal of the American Osteopathic Association, 2008/10
Free full text
1589

Prevention, diagnosis, and management of osteoporosis-related fracture: a multifactoral osteopathic approach
Gronholz, M. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text
1590

The endocannabinoid system: an osteopathic perspective
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
1591

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text
1592

Osteopathic Medicine and the Geriatric Patient
Hruby, R. J.
The AAO Journal, 2008/09
Free full text
1593

Valuing osteopathy: What are (our) professional values and how do we teach them?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09
1594

Whose values are we teaching? Deconstructing responsibilities and duties of teachers of osteopathy
Sommerfeld, P.
International Journal of Osteopathic Medicine, 2008/09
1595

A model of the cranial vault as a tensegrity structure, and its significance to normal and abnormal cranial development
Scarr, G.
International Journal of Osteopathic Medicine, 2008/09
1596

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1597

Unsere Haut – Bau und Leistungen Teil 1
(Our Skin – Structure and Performance, Part 1)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1598

Einschneidende Rituale
(Drastic Rituals)
Knöppler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1599

Querschnitt– und Längsschnittstudien
(Cross-sectional and longitudinal studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1600

Bedeutung der Haut im Umgang mit Säuglingen
(Significance of the Skin when Dealing with Infants)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1601

Zwischen innen und außen: die Haut
(Between inside and outside: the skin)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1602

Therapie über die Körperoberfläche – Anatomische und physiologische Aspekte der neurolymphatischen Reflexpunkte am Beispiel der Augen– und Ohrzonen
(Therapy via the Body Surface – Anatomical and Physiological Aspects of the Neurolymphatic Reflex Points by the Example of Eye and Ear Zones)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
Free full text
1603

Erste Ansätze in der osteopathischen Behandlung der Haut
(First Approaches in the Osteopathic Treatment of the Skin)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
1604

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text
1605

Técnica combinada de articulación y thrust para disfunción de cóndilo posterior
(The combined articular thrust technique for posterior condyle dysfunction)
Guirao Cano, D.
Osteopatía Científica, 2008/08
1606

Manuelle Medizin in der Pädiatrie: ein osteopathischer Ansatz: Auszüge aus dem neuen Buch: Pediatric Manual Medicine: an osteopathic approach
(Pediatric manual medicine: An osteopathic approach)
Carreiro, J. E.
Osteopathische Medizin, 2008/07
1607

Sind Habits, Tics, Bruxismus, Sprechfehler und orofaziale Dyskinesien eine Expression notwendiger kraniosakraler und posturaler Autoregulation des Menschen?: Das Balance-Behandlungskonzept
(Are habits, tics, bruxism, speech disorder and orofacial dyskinesia an expression of necessary craniosacral and postural autoregulation in humans?)
Entrup, W.
Osteopathische Medizin, 2008/07
1608

Behandlung der Enuresis nocturna in der Osteopathie
(Treatment of noctural enuresis in osteopathy)
Liem, T.
Osteopathische Medizin, 2008/07
1609

Rediscovering the classic osteopathic literature to advance contemporary patient-oriented research: A new look at diabetes mellitus
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2008/07
1610

Kindliche Regulationsstörungen: Schrei-, Ess- und Schlafstörungen: Betrachtung der psychosozialen Zusammenhänge im Hinblick auf die osteopathische Behandlung
(Infantile regulatory disorders: Crying, eating and sleep disorders)
Gillemot, B.
Osteopathische Medizin, 2008/07
1611

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text
1612

Use of inappropriate titles by New Zealand practitioners of acupuncture, chiropractic, and osteopathy
Gilbey, A.
The New Zealand Medical Journal, 2008/07
1613

Teaching critical thinking in osteopathy – Integrating craft knowledge and evidence-informed approaches
Fryer, G.
International Journal of Osteopathic Medicine, 2008/06/01/
1614

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06
1615

The Cranial Plunger Theory
Burns, D. K.
The AAO Journal, 2008/06
Free full text
1616

Criticality, research, scholarship and teaching: Osteopaths as educators – what makes a good teacher?
Wallace, S. S.
International Journal of Osteopathic Medicine, 2008/06
1617

“Poiseuille’s Panacea”: a New Direction in Osteopathic Manipulation of the Thorax
McCombs, T. M., Towne, S., Treece, M.
The AAO Journal, 2008/06
Free full text
1618

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text
1619

The Osteopath Should Find Health
Höppner, J.P.
Osteopathische Medizin, 2008/05
1620

Osteopathische Medizin und ihre Anpassung an das Älterwerden
(Osteopathic medicine and its adjustment to aging patients)
Hruby, R.
Osteopathische Medizin, 2008/05
1621

Spanien - eine neue wissenschaftliche Zeitschrift für die Osteopathie
(A new scientific journal for osteopathy in Spain)
Ricard, F.
Osteopathische Medizin, 2008/05
1622

Die Hand des Menschen, Teil 1: Funktionelle Anatomie und Biomechanik des Carpus
(The Human Hand - Part 1: Functional Anatomy and Biomechanics of the Carpus)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1623

Das Herz - mehr als nur eine Pumpe
(The Heart - More Than Just a Pump)
Fraval, M., Norrie, A., del Pilar Munoz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1624

Osteopathie in der Pädiatrie, Teil 3: Das Os temporale
(Osteopathy in Pediatrics, Part 3: The Temporal Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1625

Retrospektive und prospektive Studien
(Retrospective and prospective studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1626

Das komplexe regionale Schmerzsyndrom
(The complex regional pain syndrome)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1627

Osteopathische Diagnostikmöglichkeiten an der Hand
(Osteopathic Diagnostic Possibilities in the Hand)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1628

Wunderwerkzeug Hand
(Miracle tool hand)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1629

Form und Formlosigkeit. Morphologie in der Osteopathie heute
(Form and Formlessness. Morphology in Osteopathy Today)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
1630

Técnica semidirecta de thrust para torsión anterior derecha del sacro: TDD
(Indirect thrust manipulation for right anterior torsion of the sacrum on a right oblique axis)
Rodríguez Blanco, C.
Osteopatía Científica, 2008/04
1631

Autistic Spectrum Disorder
Sorrell, M. A.
The AAO Journal, 2008/03
Free full text
1632

“Even though you’re choking on it, it’s all in your mind” – an osteopathic perspective on Globus Hystericus
Comeaux, Z. J.
The AAO Journal, 2008/03
Free full text
1633

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text
1634

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03
1635

Die osteopathische Dysfunktion der Arterie
(Osteopathic Dysfunction of the Arteries)
Chauffour, P., Prat, E., Michaud, J.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1636

Medical conditions in works of art
Salter, V., Ramachandran, M.
British Journal of Hospital Medicine, 2008/02
1637

Osteopathie in der Pädiatrie, Teil 2: Intraossäre Läsionen des Os occipitale
(Osteopathy in Pediatrics, Part 2: Intraosseus Lesions of the Occipital Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1638

Entwicklung von Blut- und Lymphgefäßen
(The Development of Blood and Lymph Vessels)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1639

Die visuelle Analogskala
(The visual analog scale)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1640

Eigenrhythmizität von Blutgefäßen
(The Innate Rhythmicity of Blood Vessels)
Schmid-Schönbein, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1641

Arterienbehandlung bei Bluthochdruck
(Arterial treatment for hypertension)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1642

Für Durchblutung sorgen - Die Behandlung von Arterien
(Providing blood circulation - The treatment of arteries)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1643

Über das mechanische Verhalten elastischer Arterien
(On the mechanical behavior of elastic arteries)
Vogt, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1644

Behandlung der intramuralen Gefäße der Viszera am Beispiel des Magens
(Treatment of the Intramural Vessels of the Viscera Using the Stomach as an Example)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1645

Der Rhythmus des Blutflusses
(The Rhythm Of Perfusion)
Wyvekens, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
1646

Spirit(ualität) in der Osteopathie heute: Entwicklung des SpREUK-Fragebogens zur Analyse der unterschiedlichen Phänomene und Perspektiven der Spiritualität bei chronisch Kranken
(Spirit(uality) in osteopathy today)
Büssing, A.
Osteopathische Medizin, 2008/01
1647

Slow-Thrust Technik
(Slow thrust technique)
Dräger, K.
Osteopathische Medizin, 2008/01
1648

Die Gleitfähigkeit subkutaner Strukturen beim Menschen – eine Einführung
(Introduction to the knowledge of subcutaneous sliding system in humans)
Guimberteau, J. C., Sentucy-Rigall, J., Panconi, B., Bouleau, R., Mouton, P., Bakhach, J.
Osteopathische Medizin, 2008/01
1649

Methoden der Erkenntnisgewinnung in der Osteopathie
(Methods of obtaining knowledge in osteopathy. Part 1: The founders - A.T. Still and W.G. Sutherland)
Kaiser, F.
Osteopathische Medizin, 2008/01
1650

Sinnsuche: Krankheit, Spiritualität und Heilung
(The search for meaning: Illness, spirituality and healing)
Kalitzkus, V.
Osteopathische Medizin, 2008/01
1651

Manuelle Thermodiagnose nach Jean-Pierre Barral – Grundlagen
(Manual thermodiagnosis according to Jean-Pierre Barral - Basis principles)
Lossing, M. K., Lossing, K.
Osteopathische Medizin, 2008/01
1652

Spiritualität und Manuelle Medizin: Perspektiven für ein wiederentdecktes Forschungsthema
(Spirituality and manual medicine: Perspectives for a rediscovered topic of research)
Ostermann, T.
Osteopathische Medizin, 2008/01
1653

Vom Aschenputtel ins Rampenlicht: Das Bindegewebe im Mittelpunkt neu erwachten Forscher-Interesses
(From Cinderella in the limelight: Connective tissue in the focus of attention of eager researchers)
Schleip, R., Lambacher, M.
Osteopathische Medizin, 2008/01
1654

„Attentionality”: Osteosophische Basisschritte zur sensorischen Körper-Spiritualität in der osteopathischen Medizin
('Attentionality': Basic osteosophic steps towards a sensory spirituality of the body in osteopathic medicine)
Beuckels, J. M.
Osteopathische Medizin, 2008/01
1655

Osteopathie und Musikermedizin
(Osteopathy in musician's medicine)
Ridder, P.H.
Osteopathische Medizin, 2008/01
1656

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text
1657

OMT Homework
Clark, R. C.
The AAO Journal, 2007/12
Free full text
1658

Using integrative therapies to treat women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2007/11
Free full text
1659

Schmerzsyndrome in der Regio Inguinalis
(Pain syndroms of the inguinal region)
Beck, M.
Osteopathische Medizin, 2007/10
1660

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 3
(The craniomandibular system and its effects on the posture - Part III: Etiology, diagnosis and treatment of disorders of the CMS)
Honikel, M.
Osteopathische Medizin, 2007/10
1661

Manuelle Medizin wirkt auf schmerzhemmende Systeme!
(Manual medicine acts on pain inhibitory systems)
Locher, H., Sell, K.
Osteopathische Medizin, 2007/10
1662

Biomechanische Annäherung an die Dysfunktion - Teil 3: Die helikoidale Achse
(Biomechanical approach to dysfunction - Part 3: The helical axis)
Sommerfeld, P., Klein, P.
Osteopathische Medizin, 2007/10
1663

The influence of an Osteopathic treatment on the performance of a high - performance athlete
Böhmüller, E.
Unpublished MSc thesis, 2007/10
Free full text
1664

Frühkindliche Hinweise auf Lernstörungen und osteopathische Behandlungsansätze
(Signs of Learning Disorders in Early Childhood and Osteopathic Treatment Approaches)
Bierent-Vass, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1665

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1666

Spina bifida - Entstehung und Folgen
(Spina bifida - Development and Consequences)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1667

Masterkurs in Kirksville - ein Stimmungsbild
(Master course in Kirksville - an impression)
Kaiser, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1668

Lebensqualität
(Quality of Life)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1669

Hat die osteopathische Behandlung einen positiven Effekt bei Frauen mit persistierenden Rückenschmerzen post partum? Eine randomisierte kontrollierte Studie
(Study on the effectiveness of osteopathic treatment for women with persistent post partum back pain. A randomized controlled trial)
Recknagel, C., Roß, J.
Unpublished D.O. thesis, 2007/10
1670

Osteopathische Begleitung bei frühkindlichen Fehlbildungen
(Osteopathic treatment for infantile malformations)
Mückler, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1671

Müsli gegen Spina bifida
(Muesli against spina bifida)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1672

Rauchen schadet Embryo
(Smoking harms the embryo)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1673

Kurze Entwicklungsgeschichte des enterischen Nervensystems (ENS)
(Brief evolutionary history of the enteric nervous system (ENS))
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
Free full text
1674

Zum Verständnis grundlegender Konzepte bei A.T. Still: form, function, generation, degeneration
(Understanding basic concepts in A.T. Still: form, function, generation, degeneration)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
1675

Systematische Analyse der anatomischen Verbindungen der cranialen Gefäßabgänge des Aortenbogens mit Strukturen der oberen Thorax-apertur sowie der experimentellen Überprüfung ihrer mechanischen Abhängigkeit
(Systematically research of the anatomic links of the supraaortic arteries with thoracic outlet structures and an experimental testing of their mechanical dependence)
Vogt, R.
Unpublished D.O. thesis, 2007/10
1676

Occipital Compression and its Potential Uses in Obstetrics
McAfee, S. N., Chila, A. G.
The AAO Journal, 2007/09
Free full text
1677

Independence and Interdependence
Paulus, S. F.
The AAO Journal, 2007/09
Free full text
1678

The Establishment of a Neuromusculoskeletal-Osteopathic Manipulative Medicine Service in a 700 Allopathic Physician Practice
Richards, T. M.
The AAO Journal, 2007/09
Free full text
1679

The influence of the osteopathic treatment on the vegetative neural system.The technique “Compression of the 4th ventricle“ influences brain activity, bloodpressure, heart rate and respiration rate
Brandstötter, L., Winkler, W.
Unpublished MSc thesis, 2007/09
Free full text
1680

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 2
(The craniomandibular system and its effect on the posture - Part II)
Honikel, M.
Osteopathische Medizin, 2007/08
1681

Die Entwicklung der Wirbelsäule (Teil 2)
(The Development of the Spinal Column (Part 2))
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1682

Emotionale Diagnose und Behandlung nach J.P. Barral
(Diagnosis and Treatment of Emotional Problems according to Barral)
Klein Lossing, M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1683

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1684

SEE - Die SomatoEmotionale Entspannung nach Upledger
(SER - SomatoEmotional Release according to Upledger)
Landeweer, G. G., Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1685

Bundesarbeitsgemeinschaft Osteopathie e.V. (BAO) informiert
(Federal working group Osteopathy e.V. (BAO) informs)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1686

Das Aufbaumittel der Natur - „Nature's Tonic”-Auszug aus dem Osteopathic Magazine „Nature's Way to Health” von 1925
(Nature's Tonic - Excerpt from the 1925 Osteopathic Magazine 'Nature's Way to Health')
Radel, V.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1687

Speisen hält Leib und Seele zusammen
(Dining holds body and soul together)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1688

Medizin und Kreativität
(Medicine and creativity)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1689

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1690

Eine kurze Geschichte der Seele
(A Short History of the Soul)
Sommerfeld, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1691

Anforderungen an eine osteopathische Psychosomatik
(What to expect from a psychosomatic approach in osteopathy)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
1692

Neuromusculoskeletal Causes of Back Pain in Competitive Figure Skaters
Goldman, S. I., Moyer, M.
The AAO Journal, 2007/06
Free full text
1693

Alleviating Atypical Tender Points Through the Use of Myofascial Release of Scar Tissue
Thomas, B. P.
The AAO Journal, 2007/06
Free full text
1694

Manuscript preparation and publication for would-be writers: An aid to disseminating osteopathic research
Mullinger, B.
International Journal of Osteopathic Medicine, 2007/06
1695

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 1
(The craniomandibular system (cms). Part 1: The cms and its effects on the body posture)
Honikel, M., Bruderhofer, A.
Osteopathische Medizin, 2007/05
1696

Biomechanische Annäherung an die Dysfunktion - Teil 2
(Biomechanical approach to dysfunction - Part 2: The movement index)
Klein, P., Sommerfeld, P.
Osteopathische Medizin, 2007/05
1697

Eine Einführung in die Harmonischen Techniken
(An introduction to Harmonic Technique)
Lederman, E.
Osteopathische Medizin, 2007/05
1698

Harmonische Techniken - Ausgewählte Beispiele
(Harmonic technique - Selected examples of Eyal Lederman)
Lederman, E.
Osteopathische Medizin, 2007/05
1699

Bau und Funktion des Ellbogengelenks
(Construction and Function of the Elbow)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1700

Die Motrizität
(Motricity)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1701

Studienarten
(Types of studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1702

Embryologie des Ellbogens
(Embryology of the Elbow)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1703

Tennisellbogen: Osteopathie statt Kortison!
(Tennis elbow: Osteopathy instead of cortisone!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1704

Tennisellbogen: Was hilft? Was hilft wirklich?
(Tennis elbow: What helps? What really helps?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1705

Der verletzte Ellbogen - Überlegungen aus orthopädischer und osteopathischer Sicht
(Elbow Trauma - Considerations from an orthopedic and osteopathic point of view)
Schleusener, R., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1706

Der Ellbogen
(The elbow)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
1707

Is Osteopathy research relevant? A challenge has been made
Lucas, N. P., Moran, R. W.
The AAO Journal, 2007/03
Free full text
1708

The effect of cranial-sacral membrane and fluid balance technique on the autonomic nervous system using pulse rate, breathing frequency and blood pressure as indicators
Schneider, R.
Unpublished MSc thesis, 2007/03
Free full text
1709

Counterstrain Tender Points as Indicators of Sustained Abnormal Metabolism: Advancing the Counterstrain Mechanism of Action Theory
Rennie, P. R.
The AAO Journal, 2007/03
Free full text
1710

The Influence of osteopathy on the vegetative nervous system in chronic pain patients
Fürpaß, E.
Unpublished MSc thesis, 2007/03
Free full text
1711

Effects of Osteopathic Work to Mother and Child Regarding Foetal Heart Rate, Uterine contractions, Lumbosacral Mobility, and Objective Parameters of Delivery
Hampel, E.
Unpublished MSc thesis, 2007/03
Free full text
1712

Back pain and the homoeostatic requirements of the spinal system
Brownhill, K.
International Journal of Osteopathic Medicine, 2007/03
1713

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03
1714

Biomechanische Annäherung an die Dysfunktion - Teil 1
(Biomechanical approach to dysfunction - Part 1)
Klein, P., Sommerfeld, P.
Osteopathische Medizin, 2007/02
1715

Biomechanik - Versuch einer Darstellung
(Biomechanics: Study of a description)
Sommerfeld, P.
Osteopathische Medizin, 2007/02
1716

Mechanical Link. Ein osteopathisches Diagnose- und Behandlungskonzept
(The mechanical link: An osteopathic diagnosis and treatment concept)
Somody-Neplaz, I., Chauffour, P., Prat, E.
Osteopathische Medizin, 2007/02
1717

Osteopathie in Kenia: Ein Projekt von Care Highway International
(Osteopathy in Kenya: A project of Care Highway International)
Soriano, L. C.
Osteopathische Medizin, 2007/02
1718

The heart - an expanded osteopathic approach
Wagner, G.
Unpublished MSc thesis, 2007/01
Free full text
1719

Die Anhaftungen des Perikards zu seinen Nachbarstrukturen und seine Funktion im Mediastinum
(Connections between the pericardium and its neighbouring structures and its function in the mediastinum)
Bartmer-Leitl, E., Kaufer, C. R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1720

Das Mediastinum und Intrathorakales Fasziales Release
(The mediastinum and intrathoracal fascial release)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1721

Die Bewegungen der Viszera: Die Mobilität, Teil 2
(Visceral Movements: Mobility, Part 2)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1722

Für eine streitbare und lebendige Osteopathie
(For a contentious and lively osteopathy)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1723

Verleihung des D.O. honoris causa an Karl-Ludwig Resch
(Award of the D.O. honoris causa to Karl-Ludwig Resch)
Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1724

Das Mediastinum - der Raum zwischen den Lungenflügeln
(The mediastinum - the space between the lungs)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1725

Das Herz: Allgemeine osteopathische Überlegungen und spezielle Ansätze in der Kinderosteopathie
(The Heart: General osteopathic reflections and special applications in pediatric osteopathy)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1726

Osteopathie, Quantenphysik, Offenbarung, Teil 2
(Osteopathy, Quantum Physics, Revelation, Part 2)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
1727

The influence of osteopathic treatment during gestation onto the course of delivery - a comparative study on the frequency of medical intervation during child birth
Ruspeckhofer, M.
Unpublished MSc thesis, 2007/01
Free full text
1728

The Use of OMT in Patients with Osteoarthritis: Case Report
Zaidi, T., Williams, S.
The AAO Journal, 2006/12
Free full text
1729

Dr. A. T. Still’s Treating Chair
Jordan, T. R.
The AAO Journal, 2006/12
Free full text
1730

Cranial osteopathy: its fate seems clear
Hartman, S. E.
Chiropractic & Manual Therapies, 2006/12
Free full text
1731

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text
1732

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11
1733

Unser Fuß, ein komplexes Organ
(The Foot - A Complex Organ)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1734

Osteopathie, Quantenphysik, Offenbarung, Teil 1
(Osteopathy, Quantum Physics, Revelation, Part 1)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1735

Osteopathische Behandlung von Frauen mit Rückenschmerzen während der Schwangerschaft. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of women with low back pain during pregnancy. A randomized controlled trial)
van der Linde, M., Peters, R.
Unpublished D.O. thesis, 2006/10
1736

Berührung - Wahrnehmung des Fernen im Nahen?
(Touching - Perception of the distant in closeness?)
Sommerfeld, P.
Osteopathische Medizin, 2006/10
1737

Folgen des intrauterinen Gefängnis: Fußdeformitäten
(Consequences of intrauterine imprisonment: Deformities of the Foot)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1738

Das Fulkrum - Auszug aus dem Journal of the Osteopathic Cranial Association,Jahrbuch von 1953
(The Fulcrum - Excerpt from the Journal of the Osteopathic Cranial Association,Yearbook of 1953)
Schooley, T. F.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1739

Osteopathische Diagnostik des oberen und unteren Sprunggelenks
(Osteopathic diagnostics of the upper and lower ankle joint)
Schallier, F.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1740

Osteopathic reasoning for the treatment of low back pain
Rennie, P. R.
Manuelle Medizin, 2006/10
1741

Brauchen Kinderfüße Einlagen?
(Do children's feet need insoles?)
Luthin, D., Rossi, S.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1742

Evidence based-Medizin (EBM)
(Evidence-based medicine (EBM))
Krause, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1743

Aspekte der traditionellen chinesischen Medizin bei der osteopathischen Behandlung des Fußes
(Aspects of traditional Chinese medicine in osteopathic treatment of the foot)
Kaufmann, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1744

Die Bewegungen der Viszera: Die Mobilität - Teil 1
(Visceral Movements: Mobility - Part 1)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1745

“Ich habe zu jeder Zeit von allen gelernt“: Ein Interview mit Laurie Hartman
(“I have learned from all at any time“: An interview with Laurie Hartman)
Franke, H., Hartman, L.
Osteopathische Medizin, 2006/10
1746

Bewusstheit für Bewegung - Die minimale Hebeltechnik und das Behandlungskonzept von Laurie Hartman
(Awareness for movement)
Franke, H.
Osteopathische Medizin, 2006/10
1747

Was bringt die Ganganalyse? - Pro und Contra
(What are the benefits of gait analysis? - Pros and cons)
Fink, M., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
1748

One Heritage, Two Traditions; A Look to the Future
Steele, K. M.
The AAO Journal, 2006/09
Free full text
1749

Palpation of the sacroiliac joint: An anatomical and sensory challenge
McGrath, M. C.
International Journal of Osteopathic Medicine, 2006/09
1750

Infantile colic: A critical appraisal of the literature from an osteopathic perspective
Lim, K. W.
International Journal of Osteopathic Medicine, 2006/09
1751

Osteopathic medicine in transition: postmortem of the Osteopathic Medical Center of Texas
Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2006/09
Free full text
1752

Palpatory Evidence for Viscero-somatic Influence upon the Musculoskeletal System
Eland, D. C.
The AAO Journal, 2006/09
Free full text
1753

The Effects of Manipulation on Ligaments and Fascia from a Fluids Model Perspective
Crow, W. T.
The AAO Journal, 2006/09
Free full text
1754

Zen-Bewusstsein bei der Lehre der Palpation: Ein osteopathischer Ansatz
(Zen awareness in the teaching of palpation: An osteopathic perspective)
Comeaux, Z.
Osteopathische Medizin, 2006/08
1755

Merilyn Johnston Brooks über ihren Vater William L. Johnston: “Er engagierte bis zu seinem Tode für das Leben“
(Merilyn Johnston Brooks about her father William L. Johnston: “He committed himself to life until his death“)
Brooks, M. J.
Osteopathische Medizin, 2006/08
1756

Bewegung ist das primäre Kennzeichen von Leben
(Motion is the primary feature of life)
Vorro, J.
Osteopathische Medizin, 2006/08
1757

Das Mitchell-Johnston-Experiment: Funktioneller versus strukturellem Ansatz)
(The Mitchell-Johnston experiment: Functional versus structural approach)
Mitchell Jr., F. L.
Osteopathische Medizin, 2006/08
1758

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08
1759

Forschungen zur Somatischen Dysfunktion
(Research on somatic dysfunction)
Heath, D. M., Gevitz, N.
Osteopathische Medizin, 2006/08
1760

(Local versus passive regional motion input: Indication for viscero-somatic input)
Eland, D.
Osteopathische Medizin, 2006/08
Free full text
1761

Zur Übersetzung grundlegender Konzepte von A.T. Still: Soul
(Regarding the translation of A.T. Still's basic concepts: Soul)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1762

Benötige ich ein Kunstgelenk?
(Do I need an artificial joint?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1763

Das Ohr, Anatomie und Physiologie
(The Ear, Anatomy and Physiology)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1764

Behandlung eines temporomandibulären Problems bessert langfristig Tinnitus-Symptome
(Treatment of a temporomandibular problem improves tinnitus symptoms in the long term)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1765

Akuter Tinnitus: Selbstheilungskräfte dominieren
(Acute tinnitus: self-healing powers dominate)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1766

Osteopathische Therapie des chronischen Schwindels: Nutzen offen
(Osteopathic therapy of chronic vertigo: benefit unknown)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1767

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1768

Konfidenzintervall
(Confidence interval)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1769

Tinnitus aurium - Wenn das Ohr pfeift
(Tinnitus - When the ear whistles)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1770

Das Os temporale und seine Beziehungen
(The Temporal Bone and its Relations)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
1771

What is the best treatment for infants with colic?
Crotteau, C. A., Wright, S. T.
The Journal of Family Practice, 2006/07
1772

Post Operative Osteopathic Manipulative Protocol for Delivery by Students in an Allopathic Environment
Clark, R. C., McCombs, T. M.
The AAO Journal, 2006/06
Free full text
1773

Psychology and low back pain
Bogduk, N.
International Journal of Osteopathic Medicine, 2006/06
1774

Was ist der „kraniosakrale Rhythmus“?
(What is the craniosacral rhythm? An article on employing craniosacral osteopathy (CSO))
von Heymann, W., Kohrs, C.
Manuelle Medizin, 2006/06
1775

Sacroiliac Mechanics Revisited
Jordan, T. R.
The AAO Journal, 2006/06
Free full text
1776

Understanding comorbidity with depression and anxiety disorders
Aina, Y., Susman, J. L.
The Journal of the American Osteopathic Association, 2006/05
1777

Nonobstetric lacerations of the vagina
Sloin, M. M., Karimian, M., Ilbeigi, P.
The Journal of the American Osteopathic Association, 2006/05
Free full text
1778

Mechanism-of-injury approach to evaluating patients with blast-related polytrauma
Scott, S. G., Belanger, H. G., Vanderploeg, R. D., Massengale, J., Scholten, J.
The Journal of the American Osteopathic Association, 2006/05
Free full text
1779

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05
1780

Treating patients for comorbid depression, anxiety disorders, and somatic illnesses
Dolnak, D. R.
The Journal of the American Osteopathic Association, 2006/05
1781

Morphologische Veränderungen des passiven Bewegungsapparates im Alter
(Morphologic Alterations in the Passive Musculoskeletal System in the Elderly)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1782

The Drive for Legitimation by Osteopathy and Chiropractic in Australia: Between Heterodoxy and Orthodoxy
Baer, H. A.
Complementary Health Practice Review, 2006/04
Free full text
1783

Zur Übersetzung grundlegender Konzepte von A.T. Still: Spiritual Being
(Regarding the translation of A.T. Still's basic concepts: Spiritual Being)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1784

Was die Osteopathie „Golden Girls” zu bieten hat
(What osteopathy has to offer „Golden Girls”)
Tettambel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1785

Kontinenzorgan Beckenboden - Biomechanische Leistungen des Bindegewebes für die Kontinenz sowie therapeutische Anmerkungen
(The pelvis as a continence organ - biomechanical tissue continence function and therapeutic notes)
Tanzberger, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1786

Sind strukturelle Veränderungen behandelbar? - Pro und Contra
(Are structural changes treatable? - Pros and cons)
Seider, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1787

Alles Schrott?
(All scrap?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1788

Altern und Osteopathie: Die Rolle von Beweisen
(Aging and Osteopathy: The Role of Evidence)
McGovern, R. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1789

Signifikanz
(Significance)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1790

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1791

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
1792

Gross range of motion in the cervical spine: the effects of osteopathic muscle energy technique in asymptomatic subjects
Burns, D. K., Wells, M. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
1793

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text
1794

Intercostal rib release
McCarty, C. L.
The AAO Journal, 2006/03
Free full text
1795

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03
1796

The effect of different rates of application of a rib raising technique on cardiovascular and respiratory measures in asymptomatic individuals
Farthing, R., Gosling, C., Williams, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2006/03
1797

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text
1798

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1799

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1800

Matrix-Rhythmus-Therapie und osteopathischer Ansatz
(Matrix rhythm therapy and osteopathic approach)
Randoll, U. G., McCutcheon, R., Hennig, F. F.
Osteopathische Medizin, 2006/02
1801

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1802

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1803

Die Neue Schmerz- und Organtherapie (NPSO) nach Rudolf Siener - Geschichte und Anwendung
(The new pain and organ therapy (NPSO) according to Rudolf Siener - History and application)
Münch, M., Kaufmann, W.
Osteopathische Medizin, 2006/02
1804

Das bedeutende Vermächtnis der osteopathischen Prinzipien
(The most important legacy of osteopathic principles)
McGovern, J. J.
Osteopathische Medizin, 2006/02
1805

(Various approaches for the treatment of postpartal problems)
Ligner, B.
Osteopathische Medizin, 2006/02
Free full text
1806

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text
1807

Ethische Überlegungen zur Anwendung manipulativer Therapien in Altenpflegeheimen
(Ethical considerations for the use of manipulative therapy in nursing homes for the elderly)
Buckler, D., Strait, B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1808

Zur Übersetzung grundlegender Konzepte von A.T. Still: Philosophy, God and Experience
(For the translation of basic concepts of A.T. Still: Philosophy, God and Experience)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1809

Das Studium des Lebens
(The study of life)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1810

Osteopathie bei älteren Menschen und der derzeitige Stand der klinischen Forschung
(Osteopathy in the elderly and the current state of clinical research)
Noll, D. R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1811

Die osteopathische Versorgung älterer Menschen
(Osteopathic treatment of the elderly)
McGovern, J. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1812

Mit Statistik manipulieren
(Manipulate through statistics)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
1813

Gedanken zur Gesundheit und zum Altern von Dr. Andrew Taylor Still
(Thoughts on Health and Aging by Dr. Andrew Taylor Still)
Haxton, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
Free full text
1814

Cranial State of Mind - Does cranial osteopathy influence the patient's state of consciousness?
Engel, R.
Unpublished MSc thesis, 2006/01
Free full text
1815

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12
1816

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text
1817

American Osteopathic Association adopts policies on treatment of patients in pain: an overview
D'Alonzo, G. E., Jr., Stipp
The Journal of the American Osteopathic Association, 2005/11
Free full text
1818

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text
1819

Haben osteopathische Behandlungen einen Effekt bei Patienten mit Gonarthrose im Vergleich zu physikalischer und medikamentöser Therapie? Eine randomisierte kontrollierte Studie
(How effective are osteopathic treatments to patients with gonarthritis in comparison to the two most current forms of treatment namely physiotherapy and medication. A randomized controlled trial)
Auracher, M.
Unpublished D.O. thesis, 2005/10
1820

Manual techniques addressing the lymphatic system: origins and development
Chikly, B. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
1821

Increased lymphatic flow in the thoracic duct during manipulative intervention
Knott, E. M., Tune, J. D., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2005/10
Free full text
1822

Hemodynamic effects of osteopathic manipulative treatment immediately after coronary artery bypass graft surgery
Olivencia-Yurvati, A. H., Carnes, M. S., Clearfield, M. B., Stoll, S. T., McConathy, W. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
1823

Andrew Taylor Still-Techniken
(Andrew Taylor Still techniques)
Bachand, P.
Osteopathische Medizin, 2005/10
1824

Die osteopathische Medizin im Dilemma zwischen Tradition und Moderne
(Osteopathic medicine in the dilemma between tradition and modern approach)
Beck, M., Unverricht, R.
Osteopathische Medizin, 2005/10
1825

Osteopathie bei somatoformen autonomen Funktionsstörung des Herz- und Kreislaufsystems. Eine kontrollierte klinische Studie.
(Osteopathic treatment of somatoform autonomic dysfunction of the cardiovascular system)
Sauerburger, S., Zorgman, M.
Unpublished D.O. thesis, 2005/10
1826

(H. M. Patterson, D.O.: His life as an osteopath)
Patterson, M. M.
Osteopathische Medizin, 2005/10
1827

Osteopathie. Eine quasi-medizinische Spielart des unvollständigen Nihilismus? Versuch einer ontologischen Standortbestimmung
(Osteopathy - A quasi-medical game of incomplete nihilism? Attempt of an ontological status)
Sommerfeld, P.
Osteopathische Medizin, 2005/10
1828

Morphologie, Funktion und Biomechanik des Hüftgelenks
(Morphology, function and biomechanics of the hip joint)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1829

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1830

Der fasziale Test und die Behandlung der Articulatio coxae
(The fascial test and treatment of the articulatio coxae)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1831

Automatic Shifting
Paulson, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1832

Ein Osteopath auf eigenen Wegen
(An osteopath on his own paths)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1833

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1834

Die akute Hüfte. Differenzialdiagnostische Überlegungen aus orthopädischer Sicht
(The Acute Hip. Considerations in Differential Diagnosis from an Orthopedic Aspect)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1835

Das Hüftgelenk
(The hip joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1836

Der holistische Imperativ in der Osteopathie
(The holistic imperative in osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
1837

Interventional pain management: an overview for primary care physicians
Boyajian, S. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1838

Headache pain
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1839

Management of neuropathic pain
Galluzzi, K. E.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1840

Clinical Prevention and Population Health Curriculum Framework: the nursing perspective
Allan, J. D., Stanley, J., Crabtree, M. K., Werner, K. E., Swenson, M.
Journal of Professional Nursing, 2005/09
Free full text
1841

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1842

Management of osteoarthritic knee pain
Rubin, B. R.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1843

An osteopathic approach to treating women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1844

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text
1845

Legends and Lessons: William “Wild Bill” Wyatt, DO
Capobianco, A. D.
The AAO Journal, 2005/09
Free full text
1846

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text
1847

Anatomy in the Osteopathic Field
Paulus, S. F.
The AAO Journal, 2005/09
Free full text
1848

The Instrument of our Distinction: The Hand
Smutny, C. J. III.
The AAO Journal, 2005/09
Free full text
1849

Somatische Dysfunktion - Reflektion über die Anwendung des Begriffs in der osteopathischen Praxis
(Somatic dysfunction - Reflection on the use of the term in osteopathic practice)
Comeaux, Z.
Osteopathische Medizin, 2005/09
1850

Muscle energy technique: Geschichte, Modell und Wirksamkeit, Teil 2 - Das Modell
(Muscle energy technique. History, model and effectiveness, part 2 - The model)
Franke, H.
Osteopathische Medizin, 2005/09
1851

Biologische Basis des osteopathischen Konzeptes
(Biological basis of osteopathic concepts)
Korr, I. M.
Osteopathische Medizin, 2005/09
1852

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text
1853

The mechanics of cranial motion—the sphenobasilar synchondrosis (SBS) revisited
Cook, A.
Journal of Bodywork and Movement Therapies, 2005/07
1854

Muscle Energy Technique. Geschichte, Modell und Wirksamkeit, Teil 1
(Muscle energy technique. History, model and effectiveness - Part 1)
Franke, H.
Osteopathische Medizin, 2005/07
1855

Osteopathische Narbenbehandlung
(Osteopathic cicatrice treatment)
Mayer, J.
Osteopathische Medizin, 2005/07
1856

Qualitätssicherung in der Osteopathie in Österreich
(Quality assurance in osteopathy in Austria)
Mückler, A.
Osteopathische Medizin, 2005/07
1857

Dreigliedrige Osteopathie
(Triune osteopathy)
Pöttner, M., Hartmann, C.
Osteopathische Medizin, 2005/07
1858

Das stomatognathe System aus osteopathischer Sicht
(The Stomatognathic System from an Osteopathic Aspect)
Amigues, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1859

Das Kiefergelenk des Menschen
(The Human Jaw)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1860

Störungen in der Entwicklung des kindlichen Kiefers
(Developmental Disorders of the Jaw in Children)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1861

Literaturliste
(Bibliography)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1862

Etienne Cloet - Was wirklich zählt
(Etienne Cloet - What really matters)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1863

Osteopathie bei Kindern mit Asthma
(Osteopathy in children with asthma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1864

Soll Kieferorthopädie mit fest sitzenden Apparaten durch Osteopathie begleitet werden? Pro und Contra
(Should orthodontics with fixed appliances be accompanied by osteopathy? Pros and cons)
Seider, R., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1865

Tagebuch aus Kirksville
(Diary from Kirksville)
Sutmar, S.C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1866

Das Kiefergelenk
(The temporomandibular joint)
Terhorst, L., Sundermann, W.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1867

Erfahrungsprozess oder Bungee-Sprung in den Interzellularraum? Zu den Grundlagen osteopathischer Spiritualität
(A matter of experience or a bungee jump into intercellular space? On the foundations of osteopathic spirituality)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
1868

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text
1869

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text
1870

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text
1871

Active fascial contractility: Fascia may be able to contract in a smooth muscle-like manner and thereby influence musculoskeletal dynamics
Schleip, R., Klingler, W., Lehmann-Horn, F.
Medical Hypotheses, 2005/06
1872

Abreactions in Ligamentous Articular Strain
McMurrey, L., Williams, S. F.
The AAO Journal, 2005/06
Free full text
1873

The UK BEAM trial – a review and discussion
Vogel, S., Dear, J., Evans, D. W.
International Journal of Osteopathic Medicine, 2005/06
1874

Sir William Osler then and now: thoughts for the osteopathic profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2005/05
Free full text
1875

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text
1876

La fondation de losteopathie par Andrew Taylor Still.
(The foundation of osteopathy by Andrew Taylor Still)
Hamonet, C.
La Revue du praticien, 2005/05
1877

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
1878

Facilitated oscillatory release - a dynamic method of neuromuscular and ligamentous/articular assessment and treatment
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/04
1879

Zur Übersetzung grundlegender Konzepte von A.T. Still: „Man is Triune“
(Regarding the translation of fundamental concepts of A.T. Still: “Man is Triune“)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1880

Das okulo-vestibulo-zervikale Funktionsmodell in der osteopathischen Praxis
(The oculo-vestibulo-cervico function model in the osteopathic practice)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1881

Osteopathische Therapie bei Glaukom
(Osteopathic Therapy of Glaucoma)
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1882

Wanderer zwischen den Osteopathiewelten
(Roamer between osteopathic worlds)
Fossum, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1883

Der Einfluss der osteopathischen Behandlung auf die Verkrümmung der Cornea
(The influence of osteopathic treatment on corneal curvature)
Haase, A.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1884

Tränenkanalstenose und andere Augenbeschwerden bei Kindern
(Lacrimal duct stenosis and other eye disorders in children)
Heinisch, M., Oberhuber, H.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1885

Die Bedeutung von Abstracts
(The importance of abstracts)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1886

Wie wichtig ist die visuelle Wahrnehmung in der Osteopathie? Pro und Contra
(How important is visual perception in osteopathy? Pros and cons)
Muts, R. K., Cloet, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1887

Osteopathie gegen Schielen
(Osteopathy for strabismus)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1888

Osteopathische Pilotstudie zum Offenwinkelglaukom
(Osteopathic pilot study on open-angle glaucoma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1889

Okulomotorik. Was bewegt das Auge?
(Oculomotorics: What makes the eye move?)
Storr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
1890

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1891

Pain management in end-of-life care
Leleszi, J. P., Lewandowski, J. G.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1892

AOA's position against use of placebos for pain management in end-of-life care
Nichols, K. J., Galluzzi, K. E., Bates, B., Husted, B. A., Leleszi, J. P., Simon, K., Lavery, D., Cass, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1893

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament: part 2. Effect of sex differences and manipulative “priming“
Sucher, B. M., Hinrichs, R. N., Welcher, R. L., Quiroz, L. D., St Laurent, B. F., Morrison, B. J.
The Journal of the American Osteopathic Association, 2005/03
Free full text
1894

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03
1895

Medical Coverage for the American Team at the World 24-hour Championship Race in Brno Czech Republic
Lovy, A.
The AAO Journal, 2005/03
Free full text
1896

Rolfing und Osteopathie: Form und Funktion aus der Sicht des Rolfing
(Rolfing and osteopathy: Form and function from the viewpoint of rolfing)
Flury, H.
Osteopathische Medizin, 2005/03
1897

Applied Kinesiology: Ein Interview mit Hans Garten
(Applied kinesiology: An interview with Hans Garten)
Garten, H.
Osteopathische Medizin, 2005/03
1898

Qualität in der Osteopathiepraxis
(Quality in osteopathy practice)
Hafen, F.
Osteopathische Medizin, 2005/03
1899

Wo steht die Osteopathische Medizin? Stand und Zukunft der Osteopathischen Medizin aus Sicht des EROP
(What is the position of osteopathic medicine? Current state and future of osteopathic medicine from the viewpoint of the European Register for Osteopathic Physicians (EROP))
Mayer, J.
Osteopathische Medizin, 2005/03
1900

Palpation und Forschung
(Palpation and research in osteopathy)
Muzzi, D.
Osteopathische Medizin, 2005/03
1901

Wie ein Osteopath die Rolfingmethode sieht
(How an osteopath looks upon the rolfing method)
Proby, J.
Osteopathische Medizin, 2005/03
1902

Heilige Einfalt/Spannungsreiche Dreifaltigkeit
(Philosophy in osteopathic medicine: Sacred naivety/excoting trinity)
Wührl, P.
Osteopathische Medizin, 2005/03
1903

The biodynamic model of osteopathy in the cranial field
McPartland, J. M., Skinner, E.
Explore (NY), 2005/01
1904

Integrating Osteopathic terminology into SNOMED CT
Nash, S.
AMIA - Annual Symposium Proceedings, 2005/01
Free full text
1905

Wie hilfreich sind Fryette’s Gesetze in der Praxis? Pro und Contra
(How helpful are Fryette's laws in practice? Pros and cons)
Duncan, S., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1906

John Wernham - A.T. Stills “Enkel”
(John Wernham - A.T. Still's “Grandson“)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1907

The effects of slow rib raising on heart rate, blood pressure, respiration rate and pain pressure threshold
Farthing, R.
Unpublished MSc thesis, 2005/01
Free full text
1908

Viszerosomatische Reflexe
(Viscerosomatic reflexes)
Friedman, H. D.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1909

Die Wirbelsäule
(The Spine)
Fuhrmann, M., Kühn, J.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1910

Osteopathie und Chiropraktik
(Osteopathy and chiropractic)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1911

Die Entwicklung der Wirbelsäule (Teil 1)
(The Development of the Spinal Column (Part 1))
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1912

Safety bei Untersuchung der Wirbelsäule
(Safety in the area of the spinal column)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1913

The effect of rapid rib raising technique on heart rate, respiratory rate, pain pressure threshold and systolic and diastolic blood pressure in asymptomatic participants
Williams, K.
Unpublished MSc thesis, 2005/01
Free full text
1914

Aktuelle medizinische Definitionen: Die Verwendung der MeSH
(Current medical definitions: The use of medical subjects headings (MeSH))
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1915

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1916

Subakuter Rückenschmerz: Osteopathie als nützliche und kosteneffektive Ergänzung der Routinebehandlung
(Subacute spinal pain: Osteopathy as a useful and cost effecticve add-on to usual care)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1917

Untersuchungsresultate der Herzmobilität durch dreidimensionale Observation
(Heart motion, quantified by magnetic resonance imaging)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1918

Zur Übersetzung grundlegender Konzepte von A.T. Still: Biogen
(Regarding the translation of fundamental concepts of A.T. Still: Biogen)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
1919

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text
1920

Blagrave-Technik zur Halswirbelsäulenbehandlung
(The Blagrave procedure for the treatment of the cervical spine)
Blagrave, P.
Osteopathische Medizin, 2004/11
1921

Die sensomotorische Entwicklung des Kindes
(The sensomotoric development of the child)
Darraillans, B.
Osteopathische Medizin, 2004/11
1922

Osteopathie beim Kleinkind
(Osteopathy in small children)
Dufresne, D.
Osteopathische Medizin, 2004/11
1923

Gibt es eine kranielle Osteopathie?
(Is there such a thing as cranial osteopathy?)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1924

F. X. Mayr-Diagnostik -Therapie und Osteopathie
(F.X. Mayr diagnosis and therapy and osteopathy)
Wilde, W.
Osteopathische Medizin, 2004/11
1925

Osteopathie in der kraniellen Sphäre
(Osteopathy in the cranial sphere)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1926

Anatomie der Schädelbasis: Os sphenoidale, ethmoidale und die Sinus paranasales
(Anatomy of the Skull Base)
Eser-Bindl, U.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1927

Ist das alte Modell der sphenobasilaren Symphyse noch aktuell? Pro und Contra
(Is the old sphenobasilar symphysis model still relevant? Pros and cons)
Esser, T., Guillaume, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1928

Sutherland und das “flüssige Licht”
(Sutherland and the “liquid light“)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1929

The unique role of osteopathic physicians in treating patients with low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/11
Free full text
1930

“Kraniosakral”- Mythen und Fakten
(“Craniosacral” - Myths and Facts)
Resch, K.L., Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1931

Intraossäre Läsion des Sphenoids und Os temporale - Ansichten und Vorgehen von Viola Frymann
(Intraosseus lesion of the sphenoid and temporalis. Views and Procedures from Viola Frymann)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1932

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text
1933

Kraniosakrale Osteopathie - Was ist das?
(What's craniosacral osteopathy?)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
1934

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text
1935

Einigung über Curriculum in Frankfurt
(Agreement on curriculum for osteopathic training in Germany
Schmidt, S.
Osteopathische Medizin, 2004/11
1936

Die osteopathische Behandlung von Patienten mit Coxarthrose
(The osteopathic treatment of patients with coxarthritis)
Kießling, G., Trantenroth, M.
Unpublished D.O. thesis, 2004/10
1937

The elephant in the room: does OMT have proved benefit?
Bledsoe, B. E.
The Journal of the American Osteopathic Association, 2004/10
Free full text
1938

An introduction to the use of outcomes questionnaires in osteopathic practice
Vaughan, B., DiVenuto, G.
Journal of Osteopathic Medicine, 2004/10
1939

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09
1940

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09
1941

Wirksamkeit der Manipulation bei der Behandlung von Lumbago: Die Gültigkeit der Schlussfolgerungen bei Metaanalysen
(Effectiveness of manipulation in the treatment of low back pain: Validity of the conclusions in metaanalyses)
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Osteopathische Medizin, 2004/08
1942

Das Selbstverständnis eines Osteopathen
(Self-image of an osteopath)
Dräger, K.
Osteopathische Medizin, 2004/08
1943

Osteopathie beim Säugling
(Osteopathy in infants)
Dufresne, D.
Osteopathische Medizin, 2004/08
1944

Einführung in die Aquatische Osteopathie
(Introduction to aquatic osteopathy)
Dufresne, M.
Osteopathische Medizin, 2004/08
1945

Fulkren in der Aquatischen Osteopathie
(Fulcrum in aquatic osteopathy)
Dufresne, M.
Osteopathische Medizin, 2004/08
1946

Zur klinischen Bedeutung der Suturen im Hinblick auf das kraniosakrale System
(Clinical significance of sutures with regard to the craniosacral system)
Fanghänel, J., Preuße, U.
Osteopathische Medizin, 2004/08
1947

Suturen – Wachstumszentren des Schädels
(Sutures - Cranial growth centers)
Fanghänel, J., Preuße, U.
Osteopathische Medizin, 2004/08
1948

Den M. transversus perinei profundus gibt es nicht
(The deep transverse muscle of the perineum does not exist)
Gshwend, J., Hirth, T.
Osteopathische Medizin, 2004/08
1949

Ein Interview mit Bernhard Hartwig
(An interview with Bernhard Hartwig)
Hartwig, B.
Osteopathische Medizin, 2004/08
1950

Der gastro-ösophagale Übergang in der Diagnostik und Behandlung (Teil 2)
(The esophagogastric junction in diagnosis and treatment (Part 2))
Helsmoortel, J., Hirth, T., Kleßen, H.
Osteopathische Medizin, 2004/08
1951

Russische Forschungsstudien im Bereich der kranialen Osteopathie
(Russian research in cranial osteopathy)
Kravchenko, T. I., Moskalenko, Y. E., Vartanyan, I. A.
Osteopathische Medizin, 2004/08
1952

Die Level der Halsweichteile – praktische Nomenklatur nach Neck dissection
(The level of soft tissues of the neck - Practical nomenclature after neck dissection)
Lehnert, B.
Osteopathische Medizin, 2004/08
1953

Verkettungen in der muskuloskelettalen Medizin
(Concatenations in musculoskeletal medicine)
Lewit, K.
Osteopathische Medizin, 2004/08
1954

Literaturrecherche mithilfe des Internets
(Literature search on the internet)
Müller, T. M.
Osteopathische Medizin, 2004/08
1955

Einheitliche Ausbildungsrichtlinien für Osteopathen Einigung in greifbarer Nähe
(Standardized educational guidelines for osteopaths)
Schmidt, S.
Osteopathische Medizin, 2004/08
1956

Ganz ganzheitlich: Ganzheitlichkeit der Osteopathie?
(Completely comprehensive: Comprehensiveness of osteopathy?)
Wührl, P.
Osteopathische Medizin, 2004/08
1957

Ganz ganzheitlich: Was von den Teilen in der Ganzheit übrig bleibt
(Completely comprehensive: What remains of the parts in the entirety)
Wührl, P.
Osteopathische Medizin, 2004/08
1958

Rechtsgutachten: Ist der Osteopath zur selbstständigen Berufsausübung in der Osteopathie berechtigt?
(Legal expert's opinion: Is an osteopath authorized to practice independently in osteopathy?)
Boxberg, E.
Osteopathische Medizin, 2004/08
1959

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1960

Anatomischer Aufbau und Funktion des Thorax - Topografie des Mediastinums
(Anatomic structure and function of the thorax - a topography of the mediastinum)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1961

Der Thorax: eine polyvalente, integrative wichtige Körperzone
(The thorax: an important polyvalent and integrative part of the body)
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1962

Globale integrierte Myofasziale Osteopathische Therapie (GIMFOT)
(Global integrated myofascial osteopathic therapy (GIMFOT))
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1963

Vom Gegen- und Miteinander
(Of working together and working against each other)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1964

Mobilisation der Rippen - in die ein geschränkte oder in die freie Richtung? Pro und Contra
(Mobilization of the ribs - in the restricted or in the free direction? Pros and cons)
Küttner, T., Geldschläger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1965

Eckpunkte für Curriculum festgelegt
(Cornerstones for curriculum established)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1966

Charles J. Smutny III - Neuer Fellow der AAO
(Charles J. Smutny III - New Fellow of the AAO)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
Free full text
1967

Wissenschaft, die Wissen schafft
(Science creating knowledge)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1968

Osteopathie im Bereich des Brustkorbs
(Osteopathy in the thoracic region)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
1969

Risk management for chiropractors and osteopaths: informed consent. A common law requirement
Walker, B. F., Cameron, M., French, S., Pollard, H. P., Vitiello, A. L., Reggars, J. W., Werth, P. D.
Australasian Chiropractic & Osteopathy, 2004/07
1970

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text
1971

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text
1972

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text
1973

Assessing the Gender Component in Coronary Heart Disease; A Comparative Analysis of Osteopathic and Allopathic Rural Physicians' Medical Approaches to Diagnosing and Treating Female Coronary Heart Disease
Curtis, V. S.
Unpublished PhD thesis, 2004/06
Free full text
1974

Osteopathie und Senkung der Arbeitsunfähigkeitszeit
(Osteopathy and disability reduction)
Hack, A.
Manuelle Medizin, 2004/05
1975

Die Entwicklung und osteopathische Behandlung von Kindern
(The development and osteopathic treatment of children)
Beinborn, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1976

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1977

Schutzimpfungen bei Kindern - Pro und Contra
(Vaccinations in children - pros and cons)
Dockx-Reinken, F., Rabe, S.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1978

Zur funktionellen Anatomie des kindlichen Schädels
(The functional anatomy of the infantile skull)
Fanghänel, J., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1979

The spotted monster
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1980

A randomized controlled trial of osteopathic manipulative treatment following knee or hip arthroplasty
Licciardone, J. C., Stoll, S. T., Cardarelli, K. M., Gamber, R. G., Swift, J. N., Jr., Winn
The Journal of the American Osteopathic Association, 2004/05
Free full text
1981

Das Unmögliche wagen
(Daring the impossible)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1982

Aspekte des Dialogs zwischen Kinderarzt und Osteopath
(Aspects of dialogue between paediatricians and osteopath)
Philippi, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1983

Das Okziput - ein wichtiger Aspekt der kraniosakralen Osteopathie bei Säuglingen
(Occiput: An important aspect of craniosacral osteopathy in infants)
Schwerdtner, H.P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
1984

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text
1985

A divisional approach to enhancing research among osteopathic family practice residents
Smith-Barbaro, P., Fulda, K. G., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2004/04
Free full text
1986

Viewpoint
Evans, D.
Journal of Osteopathic Medicine, 2004/04
1987

Breathing pattern disorders, motor control, and low back pain
Chaitow, L.
Journal of Osteopathic Medicine, 2004/04
1988

Clinical considerations of sacroiliac joint anatomy: a review of function, motion and pain
McGrath, M. C.
Journal of Osteopathic Medicine, 2004/04
1989

The use of cranial osteopathy in the treatment of infants with breast feeding problems or sucking dysfunction
Wescott, N.
The Australian Journal of Holistic Nursing, 2004/04
1990

Energy medicine: an osteopath's personal view
Handoll, N.
The Journal of Alternative and Complementary Medicine, 2004/03
1991

The Neuroendocrine-Immune Complex Illustrated in the Work of Dr. Frank Chapman
Capobianco, J. D.
The AAO Journal, 2004/03
Free full text
1992

From the Archives: The Lymphatic System, Applied Anatomy
Millard, F. P.
The AAO Journal, 2004/03
Free full text
1993

Tägliche Eigenübungen
(Daily self-exercises)
Comeaux, Z., Haßfeld, U.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1994

Akuter Lumbago - ein funktioneller Ansatz
(Acute lumbago: a functional approach)
Debroux, J.J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1995

John Martin Littlejohn, Vater der europäischen Osteopathie
(John Martin Littlejohn, father of European osteopathy)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1996

Das Meeting der World Osteopathic Health Organisation (WOHO)
(The meeting of the World Osteopathic Health Organisation (WOHO))
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1997

“...jederzeit voll und ganz dabei sein!“
(“...be fully involved at all times!“)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
1998

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text
1999

Die Bedeutung der Faszien in der manuellen Therapie
(The importance of fasciae in manual therapy)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
2000

Wie viel Intensität braucht die Behandlung des Fasziengewebes? Pro und Contra
(How much intensity does the treatment of fascial tissue need? Pros and cons)
Schwind, P., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
2001

Der “Diagnostic Touch“ von Rollin E. Becker
(The diagnostic touch from Rollin E. Becker)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
2002

Stills Faszienkonzept
(Still’s fascia concept)
Stark, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
2003

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text
2004

Efficacy of manipulation in low back pain treatment: The validity of meta-analysis conclusions
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Journal of Bodywork and Movement Therapies, 2004/01
2005

Presumption of perception: people with arthritis challenge the importance of pain in treatment
Goodwin, R.
Unpublished MSc thesis, 2004/01
Free full text
2006

Erectile dysfunction and comorbid diseases, androgen deficiency, and diminished libido in men
Fine, S. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text
2007

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text
2008

The perceived effect that part-time work has on undergraduate and postgraduate osteopathic students
Nolle, C.
Unpublished MSc thesis, 2004/01
Free full text
2009

Emu oil for osteoarthritic hand pain
Power, R.
Unpublished MSc thesis, 2004/01
Free full text
2010

Effects of osteopathic treatment on people with psoriatic arthritis: a pilot study
Wall, R., Ryan, E., Kiatos, J.
Unpublished MSc thesis, 2004/01
Free full text
2011

Review of integrated neuromusculoskeletal release and the novel application of a segmental anterior/posterior approach in the thoracic, lumbar, and sacral regions
Danto, J. B.
The Journal of the American Osteopathic Association, 2003/12
Free full text
2012

From The Archives: A Glimpse of Dr. Still's Art
McConnell, C. P.
The AAO Journal, 2003/12
Free full text
2013

The Common Compensatory Pattern: Its Origin and Relationship to the Postural Model
Pope, R. E.
The AAO Journal, 2003/12
Free full text
2014

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11
2015

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text
2016

Osteopathie hilft bei Prävention & Reha
(Osteopathy helps in prevention and rehabilitation)
Schaa, J.
Pflege Aktuell, 2003/11
2017

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text
2018

Position-Assisted Combination Technique (PACT) in the Management of Type-II Impairment in the Thoracic and Lumbar Spine
Makofsky, H. W.
Journal of Manual and Manipulative Therapy, 2003/10
2019

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10
2020

A review of the physiology of cranial osteopathy
Ferguson, A.
Journal of Osteopathic Medicine, 2003/10
2021

Intervertebral dysfunction: a discussion of the manipulable spinal lesion
Fryer, G.
Journal of Osteopathic Medicine, 2003/10
2022

The Epley manoeuvre for treatment of benign paroxysmal positional vertigo: a simple office based technique
McIlwraith, B.
Journal of Osteopathic Medicine, 2003/10
2023

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10
2024

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text
2025

Viewpoint
Chaitow, L.
Journal of Osteopathic Medicine, 2003/10
2026

Ist der Osteopath in Deutschland zur selbstständigen Berufsausübung berechtigt?
(Is the osteopath authorized to practice independently in Germany?)
Boxberg, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2027

Veränderungen im Bereich des Beckenbodens in der Schwangerschaft
(Pregnancy-related changes in the pelvic floor region)
Dittmar, F. W.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2028

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2029

Osteopathie in der Schwangerschaft
(Osteopathy during pregnancy)
Gillemot, B.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2030

Osteopathie – ohne Frauen undenkbar!
(Osteopathy - unthinkable without women!)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2031

James McGovern, Anwalt der Osteopathie
(James McGovern, Osteopathic Advocate)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2032

Osteopathische Begleitung während der Schwangerschaft
(Osteopathic support during pregnancy)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2033

Ein Blick über den Zaun: Beckenbodentraining bei Schwangerschaftsinkontinenz
(Looking beyond the fence: pelvic floor muscle training during pregnancy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2034

Osteopathie in der Schwangerschaft: Profitieren Mutter und Kind?
(Osteopathy in pregnancy: positive impact on mother and child?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2035

Gesundheitsstörungen in der Schwangerschaft: Joker Osteopathie?
(Pregnancy associated health problems: joker osteopathy?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2036

Behandlung von Symphysis pubis, knöchernem Becken und Beckenboden
(Treatment of symphysis pubis, bony pelvis and pelvic floor)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2037

Osteopathische Selbsthilfe bei Unterleibsschmerzen und Beckenbodendysfunktion
(Osteopathic self-help for abdominal pain and pelvic floor dysfunction)
Tettambel, M. A.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2038

Place de l’acupuncteur et du thérapeute manuel dans la prise en charge pluridisciplinaire des douloureux chroniques
(Place of acupuncturist and osteopath in multidisciplinary chronic pain management)
Meas, Y., Nizard, J., Rouxeville, Y., Lajat, Y.
Douleur et Analgesie, 2003/09
2039

Likening Likening Strikes. Psychiatry, Osteopathy, and the Likeness Argument
Tyreman, S.
Philosophy, Psychiatry & Psychology, 2003/09
2040

Objectively and subjectively observed changes in patients diagnosed with primary coxarthrosis following osteopathic treatment with and without supplemental glucosaminosulfate and MSM
Bergthaler, H.
Unpublished MSc thesis, 2003/09
2041

History of Osteopathy in France
Barillon, B.
The AAO Journal, 2003/09
Free full text
2042

Facilitated Oscillatory Release - a method of dynamic assessment and treatment of Somatic Dysfunction
Comeaux, Z. J.
The AAO Journal, 2003/09
Free full text
2043

Dynamic Strain-Vector Release: An Energetic Approach to OMT
Hendryx, J. T., O'Brien, R. L.
The AAO Journal, 2003/09
Free full text
2044

“The Energy cyst“: Its Ramifications and Use in Osteopathic Manipulative Management
MacDonald, R. C.
The AAO Journal, 2003/09
Free full text
2045

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text
2046

A primary care approach to comprehensive care of patients with type 1 and type 2 diabetes mellitus
Keilers, R. K.
The Journal of the American Osteopathic Association, 2003/08
Free full text
2047

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text
2048

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text
2049

Osteopathic manipulative medicine in the treatment of hypertension: An alternative, conventional approach
Spiegel, A. J., Capobianco, J. D., Kruger, A., Spinner, W. D.
Heart Disease, 2003/07
2050

Treating patients in primary care: the impact of mood, behavior, and thought disturbances
Baron, D. A., Hay, D. P., Easom, H. M.
The Journal of the American Osteopathic Association, 2003/07
Free full text
2051

Aufbau und Funktion des Peritoneums
(Structure and function of the peritoneum)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2052

Abenteuer Leichenbeschaffung
(Adventure of providing cadavers)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2053

Die mechanische Funktion des rechten Kolonwinkels
(The mechanical function of the right colonic angle)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2054

Zum primären Verletzungsmechanismus bei Beschleunigungsverletzungen
(Whiplash injury: What you should know)
Keller, M., Bischoff, A., Schwerla, B. S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2055

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2056

Nackenschmerzen: Hand anlegen überlegen!
(Neck pain: manual therapy scores best)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2057

Nackenschmerzen: Manualtherapie am günstigsten
(Cost-effectiveness of common treatments for neck pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2058

Bauchschmerzen - Wer untersucht? Wer behandelt?
(Abdominal pain - Who examines? Who treats?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2059

Die Viszera - Konsequenzen aus der Autonomie für die Osteopathie? Pro und Contra
(The viscera - consequences of autonomy for osteopathy? Pros and cons)
Wührl, P., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2060

From the Archives: A Manual of Cranial Technique
Lippincott, R. C., Lippincott, H. A.
The AAO Journal, 2003/06
Free full text
2061

Physiological Background of the Cranial Rhythmic Impulse and The Primary Respiratory Mechanism
Moskalenko, Y., Frymann, V., Kravchenko, T., Weinstein, G.
The AAO Journal, 2003/06
Free full text
2062

A call for osteopathic descriptive research: use of a functional model to distinguish segmental motion behavior
Johnston, W. L., Vorro, J.
Journal of Osteopathic Medicine, 2003/04
2063

What is the clinical utility of the cervical extension rotation test as routinely applied in the premanipulative screening process?
Moran, R., Mullany, A.
Journal of Osteopathic Medicine, 2003/04
2064

Single system research designs in osteopathy
Sanders, G.
Journal of Osteopathic Medicine, 2003/04
2065

Praktische osteopathische Überlegungen zu den Nasennebenhöhlen
(Practical osteopathic considerations for the paranasal sinuses)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2066

Sinus sphenoidalis und ethmoidalis
(Sphenoid sinus and ethmoid sinus)
Eser-Bindl, U.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2067

Funktionelle Anatomie der Nasennebenhöhlen
(Functional anatomy of the paranasal sinuses)
Fanghänel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2068

Wie kam die Allopathie in die amerikanische Osteopathie?
(How did allopathy get into American osteopathy?)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2069

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2070

Renzo Molinari, Medizin des dritten Jahrtausends
(Renzo Molinari, Medicine of the third millennium)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2071

Die chronische Sinusitis: Eine Übersicht
(A review of chronic sinusitis)
Resch, K.L., Häfner, S., Stadler, M., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2072

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2073

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2074

Wissenswertes zum Bereich von Hals, Nase und Ohren
(Things to know about the area of the throat, nose and ears)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2075

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2076

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2077

Bibliotherapy: the therapeutic use of didactic and literary texts in treatment, diagnosis, prevention, and training
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2003/03
Free full text
2078

Bioelectric responsiveness of fascia: A model for understanding the effects of manipulation
O'Connell, J. A.
Techniques in Orthopaedics, 2003/03
2079

Etiological Factors in Sacral Somatic Dysfunctions
Danto, J. B.
The AAO Journal, 2003/03
Free full text
2080

From the Archives: The Contribution of John Martin Littlejohn to Osteopathy
Hall, T. E., Wernham, J.
The AAO Journal, 2003/03
Free full text
2081

Conceptual and Treatment Models in Osteopathy
Jordan, T.
The AAO Journal, 2003/03
Free full text
2082

Andrew Taylor Still and the birth of osteopathy (Baldwin, Kansas, USA, 1855)
Hamonet, C.
Joint Bone Spine, 2003/02
2083

Spinal manipulation for low-back pain: a treatment package agreed to by the UK chiropractic, osteopathy and physiotherapy professional associations
Harvey, E., Burton, A. K., Moffett, J. K., Breen, A.
Manual Therapy, 2003/02
2084

Manipulation of the cervical spine
Hing, W. A., Reid, D. A., Monaghan, M.
Manual Therapy, 2003/02
2085

The national cholesterol education program adult treatment panel ill guidelines
Clearfield, M. B.
The Journal of the American Osteopathic Association, 2003/01
Free full text
2086

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text
2087

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01
2088

Allgemeiner Aufbau des Kniegelenks
(General structure of the knee joint)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2089

Praxis optimieren: Eingang und Flur
(Optimizing your practice: Entrance and hallway)
Edelmann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2090

Hausaufgaben und Tipps für’s Knie
(Homework and tips for the knee)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2091

Anthony G. Chila - Die zwei Seiten einer Medaille
(Anthony G. Chila - Two sides of the same coin)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2092

Die Arthrose in die Knie gezwungen? Studie zu chronisch-degenerativen Knie- bzw. Hüftschmerzen
(Osteoarthritis brought to its knees? Study on chronic degenerative knee or hip pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2093

Das schmerzhafte Knie: Eine Übersicht
(The painful knee: an overview)
Resch, K.L., Bachem, S., Salzmann, I., Schwartz, U., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2094

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2095

Traumatologische Diagnostik des Kniegelenks
(Traumatological diagnostics of the knee joint)
Schwerdtner, H.P., Schallier, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2096

Das posttraumatische Kniegelenk
(The post-traumatic knee joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2097

The Primary Respiratory Mechanism
Nelson, K. E.
The AAO Journal, 2002/12
Free full text
2098

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2099

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2100

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11
2101

Aptitude for osteopathic training. 1939
Yarborough, J. U.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2102

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2103

A critical appraisal of an article comparing the effectiveness of osteopathic manipulation and chemonucleolysis in the management of symptomatic lumbar disc herniation
Legge, D.
Journal of Osteopathic Medicine, 2002/10
2104

Developing research at The British School of Osteopathy
Nash, K., Vogel, S.
Journal of Osteopathic Medicine, 2002/10
2105

Getting to the point: an osteopathic appreciation of Janet Travell
McPartland, J. M.
Journal of Osteopathic Medicine, 2002/10
2106

Osteopathic perturbation and immune network compensation
Degabriele, R.
Journal of Osteopathic Medicine, 2002/10
2107

From the Archives: Vindication
Bennett, G. M.
The AAO Journal, 2002/09
Free full text
2108

Digging On: Some thoughts on the integration of Russellian Cosmology and Osteopathy
Scariati, P. D.
The AAO Journal, 2002/09
Free full text
2109

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text
2110

Educating health professionals, first responders, and the community about bioterrorism and weapons of mass destruction
Silvagni, A. J., Levy, L. A., McFee, R. B.
The Journal of the American Osteopathic Association, 2002/09
Free full text
2111

Osteopathy in the cranial field: uncovering challenges and potential applications
King, H. H.
The Journal of the American Osteopathic Association, 2002/07
Free full text
2112

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
2113

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text
2114

A Discussion of Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
Lemley, W. W.
The AAO Journal, 2002/06
Free full text
2115

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text
2116

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text
2117

Joint cracking and popping: understanding noises that accompany articular release
Protopapas, M. G., Cymet, T. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text
2118

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04
2119

A critical appraisal of an article examining the efficacy of ultrasound treatment for carpal tunnel syndrome
Lucas, N.
Journal of Osteopathic Medicine, 2002/04
2120

The immune network and homeostasis
Degabriele, R.
Journal of Osteopathic Medicine, 2002/04
2121

Inter-examiner reliability in detecting cervical spine dysfunction: A short review
Vaughan, B.
Journal of Osteopathic Medicine, 2002/04
2122

'We will look for health': the Osteopathic Center for Children
Chilton, K.
Alternative Therapies in Health and Medicine, 2002/03
2123

Tackling birth trauma with cranio-sacral therapy
Turney, J.
The Practising Midwife, 2002/03
2124

The Impact of Osteopathic Manipulative Medicine On Inpatient Outcomes
Klock, G. B.
The AAO Journal, 2002/03
Free full text
2125

From the Archives: Osteopathic Fundamentals
Page, L. E.
The AAO Journal, 2002/03
Free full text
2126

Edgar Cayce and Osteopathy: Can we learn more about osteopathic philosophy from Cayce?
Richardson, M. E.
The AAO Journal, 2002/03
Free full text
2127

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text
2128

The Anatomy Professor That Ate New York: Some Dinosaurs Are Teachers, And Some Teach About Dinosaurs
Cammarata, J.
The AAO Journal, 2002/03
Free full text
2129

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02
2130

Proposed tenets of osteopathic medicine and principles for patient care
Rogers, F. J., D'Alonzo, G. E., Jr., Glover, J. C., Korr, I. M., Osborn, G. G., Patterson, M. M., Seffinger, M. A., Taylor, T. E., Willard
The Journal of the American Osteopathic Association, 2002/02
Free full text
2131

Can an Internet-based system assist with administration and distance learning for third- and fourth-year rural clinical rotations?
Baker, H. H., Foster, R. W., Cope, M. K., Boisvert, C., Wallace, G. H.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2132

Introduction to the Texas College of Osteopathic Medicine at the University of North Texas Health Science Center at Fort Worth
Aylett, K., Squires, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2133

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2134

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text
2135

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2136

Pre-Doctoral Fellowship Program in the Osteopathic Manipulative Medicine Program at the Texas College of Osteopathic Medicine
Slicho, T., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2137

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2138

Research Accomplishments of the Department of Osteopathic Manipulative Medicine of the Texas College of Osteopathic Medicine
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
2139

Neuromusculoskeletal Medicine and Osteopathic Manipulative Treatment Residency Programs at the Osteopathic Medical Center of Texas
Stoll, S. T., Carnes, M., Brooks, L.
The AAO Journal, 2001/12
Free full text
2140

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2141

A framework for and case study of medical informatics development at Michigan State University College of Osteopathic Medicine
Notman, M., Greene, J. F.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2142

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2143

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2144

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text
2145

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text
2146

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text
2147

Hands on care
Turney, J.
Nursing Standard, 2001/10
2148

Measurement challenges in physical diagnosis: refining inter-rater palpation, perception and communication
Comeaux, Z., Eland, D., Chila, A. G., Pheley, A., Tate, M.
Journal of Osteopathic Medicine, 2001/10
2149

Considerations for planning and conducting clinic-based research in physical therapy
Fitzgerald, G., Delitto, A.
Journal of Osteopathic Medicine, 2001/10
2150

Examining diagnostic tests: An evidence-based perspective
Fritz, J., Wainner, R.
Journal of Osteopathic Medicine, 2001/10
2151

Patient positioning and spinal locking for lumbar spine rotation manipulation
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10
2152

Acute low cervical nerve root conditions: symptom presentations and pathobiological reasoning
Gifford, L.
Journal of Osteopathic Medicine, 2001/10
2153

Destiny of osteopathic profession. 1916
Meacham, W. B.
The Journal of the American Osteopathic Association, 2001/10
2154

Cervical spine manipulation and the precautionary principle
Vautravers, P., Maigne, J.Y.
Journal of Osteopathic Medicine, 2001/10
2155

The case for uncontrolled clinical trials: a starting point for the evidence base for complementary and alternative medicine (CAM)
White, A., Ernst, E.
Journal of Osteopathic Medicine, 2001/10
2156

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text
2157

Andrew Taylor Still Memorial Lecture: the osteopathic difference--is it only manipulation? 1984
Siehl, D.
The Journal of the American Osteopathic Association, 2001/10
2158

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09
2159

A research program for the osteopathic profession. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2160

Research our great and only hope
Snyder, O. J.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2161

Elbow injuries in golf
Stockard, A. R.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2162

Osteopathische Diagnose und Behandlung von Dysfunktionen des Brustkorbs und der Rippen
(Osteopathic diagnosis and treatment of thoracic and costal dysfunctions)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2001/09
2163

Angina pectoris with special reference to its mechanical causes. 1938
Appleyard, E. C.
The Journal of the American Osteopathic Association, 2001/08
Free full text
2164

Osteopathic treatment of the common cold. 1937
Becker, A. D.
The Journal of the American Osteopathic Association, 2001/08
Free full text
2165

The osteopathic lesion as the etiological factor in some common surgical disorders. 1948
Conley, G. J.
The Journal of the American Osteopathic Association, 2001/08
Free full text
2166

Methods of applying manipulative technic. 1945
Burns, L.
The Journal of the American Osteopathic Association, 2001/07
Free full text
2167

Soft tissues in areas of osteopathic lesion. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/07
Free full text
2168

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2169

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2170

Cold-induced urticaria
Mahmoudi, M.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2171

A randomized clinical trial of exercise and spinal manipulation for patients with chronic neck pain
Bronfort, G., Evans, R., Nelson, B., Aker, P. D., Goldsmith, C. H., Vernon, H.
Journal of Osteopathic Medicine, 2001/04
2172

Evaluation of acute headaches in adults
Clinch, C. R.
Journal of Osteopathic Medicine, 2001/04
2173

Spinal manipulation: Indications, risks and benefits
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/04
2174

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text
2175

Balanced on a tight rope between low back pain and evidence-based practice
Shacklock, M.
Journal of Osteopathic Medicine, 2001/04
2176

Osteopathic treatment considerations for rheumatic diseases
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
2177

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
2178

Abbreviations for use in osteopathic case notes
Fryer, G.
Journal of Osteopathic Medicine, 2001/04
2179

The Interdisciplinary Generalist Curriculum Project at Nova Southeastern University College of Osteopathic Medicine
Blavo, C., Steinkohl, D. C.
Academic Medicine, 2001/04
Free full text
2180

Review of Sacral Somatic Dysfunction
Janiak, D. D.
The AAO Journal, 2001/03
Free full text
2181

The primary respiratory mechanism beyond the craniospinal axis
Lee, R. P.
The AAO Journal, 2001/03
Free full text
2182

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text
2183

Researched and demonstrated: inquiry and infrastructure at osteopathic institutions
Gevitz, N.
The Journal of the American Osteopathic Association, 2001/03
Free full text
2184

The somatic components of disease. 1956
MacBain, R. N.
The Journal of the American Osteopathic Association, 2001/03
Free full text
2185

Osteopathische Medizin
(Osteopathic Medicine)
Tempelhof, S., Weingart, J. R.
Erfahrungsheilkunde, 2001/03
2186

Muscle and the myoneural junction. Their relation to segmental spinal dysfunctions. 1955
Cole, W. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text
2187

Analyzing the osteopathic lesion. 1940
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/02
Free full text
2188

The place of the osteopathic concept in the healing art. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/01
Free full text
2189

Collaboration on research picks up steam
Dyer, M. J., Wood, D. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text
2190

Osteopathy--fifty years later. Founders Memorial Lecture. 1951
Fischer, R. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text
2191

Minor depression in primary care
Banazak, D. A.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2192

Endoscopic retrograde cholangiopancreatography: what role does it have in primary care?
Biery, D. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2193

Sleep-related gastroesophageal reflux
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2194

Spirituality in Osteopathic Medicine
Lee, R. P.
The AAO Journal, 2000/12
Free full text
2195

What osteopathists stand for in legislation. 1910
Hildreth, A. G.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2196

Re-expansion pulmonary edema following puncture of a giant bulla
McCoskey, E. H., McKinney, L. M., Byrd, R. P., Jr., Roy
The Journal of the American Osteopathic Association, 2000/12
Free full text
2197

Government control of medicine
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2198

A primary care approach to pediatric gastroesophageal reflux
Sunku, B., Marino, R. V., Sockolow, R.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2199

The future in retrospect. 1935
Swope, C. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2200

Tendencies in a social, political, and governmental way which may influence doctors. 1937
Thomas, E. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2201

Acute gastrointestinal bleeding: clinical essentials for the initial evaluation and risk assessment by the primary care physician
Zuckerman, G. R.
The Journal of the American Osteopathic Association, 2000/12
2202

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2203

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2204

The venous side: current directions in anticoagulant therapy
Kaatz, S.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2205

Long-term therapy of coronary artery disease: a vascular biology perspective
Mathé, A. J., Clearfield, M. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2206

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2207

Diagnosis and treatment of carotid artery stenosis
Mintz, B. L., Hobson, R. W.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2208

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2209

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2210

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2211

Thrombolytic, antithrombin, and antiplatelet treatment of acute coronary syndromes
Puma, J. A., Sketch, M. H.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2212

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2213

The clinical spectrum of acute coronary syndromes
Rogers, F. J.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2214

How West Virginia School of Osteopathic Medicine achieves its mission of providing rural primary care physicians
Stookey, J. R., Baker, H. H., Nemitz, J. W.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2215

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2216

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2217

Osteoporosis
Cymet, T. C., Wood, B., Orbach, N.
The Journal of the American Osteopathic Association, 2000/10
2218

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text
2219

Managing common problems in perimenopausal women
Forstein, D. A.
The Journal of the American Osteopathic Association, 2000/10
2220

Vascular medicine and osteopathic medicine: treating the whole patient
Gironta, M. G., Rosenfeld, C. R.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2221

Endovascular treatment of peripheral arterial disease
Gray, B. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2222

Glycation as the glucose link to diabetic complications
Gugliucci, A.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2223

Hypertension and renal artery stenosis: a complex clinical scenario
Jaff, M. R.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2224

Clinical use of selective estrogen receptor modulators
Krueger, P. M.
The Journal of the American Osteopathic Association, 2000/10
2225

Diagnosis and medical management of patients with intermittent claudication
LaPerna, L.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2226

Influencing the vegetative nervous system through manipulation. 1945
Northup, G. W.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2227

Update: the latest on hormone replacement therapy
Packin, G. S.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2228

Spirituality in history taking
Spaeth, D. G.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2229

The autonomic nervous system in osteopathic therapy. 1948
Waitley, D. D.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2230

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2231

Headache as a manifestation of otolaryngologic disease
Cosenza, M. J.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2232

The Role of Vibration or Oscillation in the Development of Osteopathic Thought
Comeaux, Z. J.
The AAO Journal, 2000/09
Free full text
2233

An Ancient Persian High-Velocity, Low-Amplitude Thrusting Technique for Somatic Dysfunctions of the Thoracic Spine
Namazian, M., Clark, R. C., Binkerd, J.
The AAO Journal, 2000/09
Free full text
2234

Carpal tunnel syndrome: more than just a problem at the wrist
Ramey, K. A.
The AAO Journal, 2000/09
Free full text
2235

Osteopathic cranial lesions. 1948
Kimberly, P. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2236

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2237

Psychologic aspects of chronic headache
Mueller, L.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2238

The cranial bowl. 1944
Sutherland, W. G.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2239

Treatment of acute migraine attacks
Weintraub, J. R.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2240

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09
2241

Strategic choices for a primary care advantage: re-engineering osteopathic medicine for the 21st century
Glover, S. H., Rivers, P. A.
Health Services Management Research, 2000/08
2242

Circadian rhythm sleep disorders
D'Alonzo, G. E., Krachman, S. L.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2243

Dangers of sleepiness and inattention while driving
Eberhart, R., Hu, X., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2244

Sleep and breathing disorders: the genesis of obstructive sleep apnea
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2245

Osteopathy and insanity. 1917
Gerdine, L. V.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2246

Schizophrenia. 1939
Hildreth, A. G., Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2247

Workup and indications for polysomnography in patients with sleep-related complaints
Knox, K. S., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2248

Osteopathic and “old school“ results in mental diseases. 1933
Merrill, E. S.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2249

Psychosis and osteopathy
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2250

The mechanism of anatomical structure in its relation to osteopathy. 1911
Bernard, H.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2251

Clinical research: the process
Goldstein, F. J.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2252

The emerging concept of the osteopathic lesion. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2253

Latex allergy: a primary care primer
Mahmoudi, M., Hunt, L. W.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2254

Inhaled corticosteroid-induced bone loss and preventive strategies
Singh, R. F., Muskelly, C. C.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2255

Early legal cases on appeal that became case law for osteopaths and chiropractors
Jackson, R. B.
Chiropractic History, 2000/06
2256

Osteopathic practice. 1903
Bernard, H. E.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2257

Rural osteopathic family physician supply: past and present
Tooke-Rawlins, D.
The Journal of Rural Health, 2000/06
2258

From the Archives: Prenatal Care
Grow, O. P.
The AAO Journal, 2000/06
Free full text
2259

Cardiovascular disease and obstructive sleep apnea: implications for physicians
Foresman, B. H., Gwirtz, P. A., McMahon, J. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2260

The compensatory pattern, as seen in art and osteopathy
Quinn, A.
The AAO Journal, 2000/06
Free full text
2261

Palpatory diagnosis. 1932
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2262

A glimpse of Dr. Still's art. 1917
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2263

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05
2264

One hundred thousand cases of influenza with a death rate of one-fortieth of that officially reported under conventional medical treatment. 1919
Smith, R. K.
The Journal of the American Osteopathic Association, 2000/05
Free full text
2265

Influenza and its osteopathic management. 1937
Ward, E. A.
The Journal of the American Osteopathic Association, 2000/05
Free full text
2266

Osteopathic success in the treatment of influenza and pneumonia. 1919
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/05
Free full text
2267

Somatic sensory impulses and vertebral lesions. 1921
Burns, L.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2268

Use of magnetic resonance imaging to diagnose common wrist disorders
DiMarcangelo, M. T., Smith, P. A.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2269

Early research: the A.T. Still Research Institute and Louisa Burns
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2270

Osteopathie - Die sanfte Chirotherapie
(Osteopathy - The gentle chirotherapy)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2000/04
2271

Research Directions From 1940-1988
Beal, M. C.
The AAO Journal, 2000/03
Free full text
2272

Advancing Osteopathic Medicine in Health Care: Integrating OMM into Osteopathic Medical Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 2000/03
Free full text
2273

The overactive bladder in multiple sclerosis
Fingerman, J. S., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 2000/03
Free full text
2274

Office evaluation of the patient with an overactive urinary bladder
Kowalczyk, J. J.
The Journal of the American Osteopathic Association, 2000/03
Free full text
2275

Surgical and medical treatment options for urge incontinence
Lonsway, J. M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
2276

Manual medicine treatment of the cervical spine and whiplash injury
Bilkey, W. J., Tomski, M. A.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
2277

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02
2278

The Comprehensive Osteopathic Medical Licensing Examination, COMLEX-USA: a new paradigm in testing and evaluation
Osborn, G. G., Meoli, F. G., Buser, B. R., Clearfield, M. B., Bruno, J. P., Sumner-Truax, L.
The Journal of the American Osteopathic Association, 2000/02
Free full text
2279

Reiter's syndrome and reactive arthritis
Parker, C. T., Thomas, D.
The Journal of the American Osteopathic Association, 2000/02
2280

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
2281

The economic burden of back pain in the UK
Maniadakis, N., Gray, A.
Pain, 2000/01
2282

Management of osteoporosis in the new millennium
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2000/01
2283

Osteoporosis: a new understanding of its impact and pathogenesis
Chopra, A.
The Journal of the American Osteopathic Association, 2000/01
2284

Effective strategies for the prevention of osteoporosis across the life span
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2000/01
2285

Role of antileukotriene agents in asthma therapy
Gawchik, S. M., Saccar, C. L.
The Journal of the American Osteopathic Association, 2000/01
Free full text
2286

Osteopathy an independent system co-extensive with the science and art of healing. 1901
Littlejohn, J. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text
2287

Evaluation of osteoporosis
Nichols, K. J.
The Journal of the American Osteopathic Association, 2000/01
2288

Muscle energy concepts - a need for change.
Fryer, G.
Journal of Osteopathic Medicine, 2000
Free full text
2289

What's in a name? For DOs, plenty
Guglielmo, W. J.
Medical Economics, 1999/12
2290

An overview of osteopathic medicine
Lesho, E. P.
Archives of Family Medicine, 1999/11
2291

ABC of complementary medicine. The manipulative therapies: osteopathy and chiropractic
Vickers, A., Zollman, C.
The BMJ, 1999/10
2292

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text
2293

Gastroesophageal reflux disease update for the primary care physician
Mitz, H. S.
Journal of Osteopathic Medicine, 1999/08
Free full text
2294

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text
2295

An osteopathic approach to asthma
Rowane, W. A., Rowane, M. P.
Journal of Osteopathic Medicine, 1999/05
Free full text
2296

Support programs for minority students at Ohio University College of Osteopathic Medicine
Thompson, H. C., Weiser, M. A.
Academic Medicine, 1999/04
2297

Visualization technology in medical education
Gorbis, S., Hallgren, R. C.
Journal of Osteopathic Medicine, 1999/04
Free full text
2298

So you want to be an ... osteopath
Hocking, J.
Nursing Times, 1999/03
2299

A century of radiology in osteopathic healthcare
Rosenbaum, R. R.
Journal of Osteopathic Medicine, 1998/12
Free full text
2300

The evolution of professional identity: the case of osteopathic medicine
Miller, K.
Social Science & Medicine, 1998/12
2301

Women's health osteopathy: an alternative view
Hyne, J.
Nursing Management, 1998/12
2302

AOA continuing medical education
Rodgers, D. J.
Journal of Osteopathic Medicine, 1998/11
Free full text
2303

Osteopathic graduate medical education
Swallow, C. S., Bronersky, V. M., Falbo, P. W.
Journal of Osteopathic Medicine, 1998/11
Free full text
2304

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text
2305

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text
2306

Research programs of the AOA and their role in osteopathic medical education
McGill, S. L., Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text
2307

Income and expenditures of osteopathic medical colleges
Kowert, C.
Journal of Osteopathic Medicine, 1998/11
Free full text
2308

Dual approval of a residency program: ten years' experience and implications for postdoctoral training
Hayes, O. W.
Journal of Osteopathic Medicine, 1998/11
Free full text
2309

Undergraduate osteopathic medical education
Kowert, C.
Journal of Osteopathic Medicine, 1998/11
Free full text
2310

Certification of osteopathic physicians
Glatz, L., Dolan, S.
Journal of Osteopathic Medicine, 1998/11
Free full text
2311

L'ostéopathie et la chiropraxie.
(Osteopathy and chiropractic)
Klein, P.
Revue médicale de Bruxelles, 1998/09
2312

Integrating cranial osteopathy with gnathologic orthopedics
Kennedy, J. M.
The Journal - American Academy of Gnathologic Orthopedics, 1998/09
2313

The origin and relief of common pain
Irvin, R. E.
Journal of Back and Musculoskeletal Rehabilitation, 1998/09
2314

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text
2315

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06
2316

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05
2317

Muscle energy concepts and coupled motion of the spine
Gibbons, P., Tehan, P.
Manual Therapy, 1998/05
2318

The sword and the scalpel--the osteopathic 'war' to enter the Military Medical Corps: 1916-1966
Gevitz, N.
Journal of Osteopathic Medicine, 1998/05
2319

Craniosacral rhythm: reliability and relationships with cardiac and respiratory rates
Hanten, W. P., Dawson, D. D., Iwata, M., Seiden, M., Whitten, F. G., Zink, T.
Journal of Orthopaedic & Sports Physical Therapy, 1998/03
Free full text
2320

Communication for osteopathic manipulative treatment (OMT): the language of lived experience in OMT pedagogy
Gaines, E., Chila, A. G.
Journal of Osteopathic Medicine, 1998/03
2321

The medical school curriculum for the 21st century
Wood, D. L., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/02
2322

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02
2323

A compilation of the thoughts of George W. Northup, DO, on the philosophy of osteopathic medicine
Peterson, B.
Journal of Osteopathic Medicine, 1998/01
2324

Positional release techniques in the treatment of muscle and joint dysfunction
Chaitow, L.
Clinical Bulletin of Myofascial Therapy, 1998/01
2325

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01
2326

Using heart variability to measure the effects of manual medicine on autonomic activity
Zullow, M.
Unpublished MSc thesis, 1997/10
2327

Efficacy of osteopathic manipulative treatment in improving clinical outcomes in patients with orthopedic diagnoses admitted to a hospital-based rehabilitation unit
Brittain, P. D.
Unpublished MSc thesis, 1997/06
2328

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12
 
 
 






  • Impressum • Legal notice • Datenschutz •


ostlib.de/advanced



Supported by

OSTLIB recommends