Advanced search



 
 80% of the records
 
 20.0 % of the records
 
 56.7 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Medically Underserved Area*Osteopathic Medicine*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademicacademic barrieracademic difficultiesacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic successacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced trainingadvancing TBI careadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappraisalsapproachaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaaspirationassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical swallowingaudiovisual aidsauditory canalauditory channelauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioenergetic modelbioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumablack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrand disputeBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinC-tactileC-tactile afferentsC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SteeleC. WeaverC1C3cability crisiscadavercadaver dissectioncadaveric dissectioncadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCanadaCanadiancanal syndromecancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1cold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasesColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial volumecranial-sacral-motioncraniocranio sacral osteopathycranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutionculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latadeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdeglutition disordersdegreesdehydrationdelayed developmentdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational technologyeducational toolseducational valueEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30elastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemployment disabilityemu oilenactivismencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocular musclesextrinsic sleep disorderseyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial structurefacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilityGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenomicsgentlenessgeodesicgeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationgluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycosylationglygoaminoglycansglymphaticglymphatic systemglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead painhead positionhead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare costhealthcare costshealthcare deliveryhealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organshome carehome exercisehomeless personshomeless populationhomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehumanitiesHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8Interleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra ocular pressureintra- and inter-rater reliabilityintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohnston’s functional methodsjointjoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney mobilitykidney motilitykidney stonekidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdle muscular dystrophylimb injurieslimb placodelimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatrix-rhythm-therapymattermaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionmediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien TettambelmembershipmembranesmemorymemosmenMeniere’s diseasemeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticameridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetastasismetastatic abdominal cancermetastudiesmethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRImsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle contractilitymuscle contractionmuscle developmentmuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathyMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal hyperbilirubinemianeonatal intensive care unitneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuropsychiatric disorderneuropsychiatryneuropsychological testsneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotomesneurotransmissionneurotransmitterneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid use disorderopioid-related disordersopioidsopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral aversionoral cavityoral diagnosisoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondrosisosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered carepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphytotherapyPIC syndromepicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disordersplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologypreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprisonprivate collegesprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studyPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsrctre-findingsre-orientation processreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniascholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspeakingspecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific laryngeal manipulationspecificityspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintsSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal manipulationsternal painsternal recoil techniquesternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth settingtelemanagementtelemedicinetelemetrytelephonetelescopic bridgeworktemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamicsurogenital stage or phallic stageurogenital systemurogenital tracturologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. ComeauxzenZIMMTzinczinc deficiencyZink modelZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

2777 results (please see below)  Sort:    



4

Journal Club 2025 – 1
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2025/06


6

Osteopathic approach to injuries of the overhead thrower’s shoulder
De Luigi, A. J., Raum, G. M., King, B. W., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/06
Free full text


8

Prone Still Technique for an Upslipped Innominate
Hartwell, L. E., Gustafson, H. C., Rudberg-Post, L. J., Matz, O. C., Woolley, A. L.
The AAO Journal, 2025/06

9

Combined Myofascial Technique for a Second Posterior Sacral Segment Dysfunction
Stellon, A. G., Rudberg-Post, L. J., Gustafson, H. C., Hartwell, L. E., Matz, O. C., Woolley, A. L.
The AAO Journal, 2025/06


11

Evaluating the Efficacy of AI Note-Taking Software in Documenting Osteopathic Manipulative Medicine Treatment Encounters
Milius, M., Jurges, T., Pentlarge, J., Gabriel, D., Yang, N., Yadalla, S., Siddiqui, S., Bills, K., Barnhurst, N.
The AAO Journal, 2025/06

12

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06

13

Elbow injuries in overhead throwing athletes: clinical evaluation, treatment, and osteopathic considerations
King, B. W., Raum, G. M., De Luigi, A. J., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/05
Free full text

14

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2025/04

15

Context is complex: Challenges and opportunities addressing contextual factors in manual therapy mechanisms research
Keter, D. L., Esteves, J. E., Loghmani, M. T., Rossettini, G., Cook, C. E.
International Journal of Osteopathic Medicine, 2025/03

16

Advancing Equitable Osteopathic Practice: Integrating Person-Centredness & Addressing Racial Biases Through the Lens of Critical Theory
Mhadhbi, H., MacMillan, A., Draper-Rodi, J., Ménard, M., Sinderholm Sposato, N.
International Journal of Osteopathic Medicine, 2025/03

17

The Seven Drivers of Change in Osteopathic Education
Engel, R.
International Journal of Osteopathic Medicine, 2025/03





22

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/03

23

Impact of osteopathic tests on heart rate and heart rate variability: an observational study on osteopathic students
Gillet, F., Gault, M., Dussault, V., Cheggour, S., Grinand, M., Martinez, P.
Journal of Osteopathic Medicine, 2025/03
Free full text




27

The Spiritual Component Of Still's Writings
Kimberly, P. E.
The AAO Journal, 2025/03





32

Gaskell, Langley, and the “para-sympathetic“ idea
Brunet, J. F.
Elife, 2025/03
Free full text


34

Die Milz
(The Spleen)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03

35

Altersbedingte Veränderungen des autonomen Nervensystems
(Age-related changes in the autonomic nervous system)
Scheuchl, F., Peuker, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03


37

American Osteopathic History Tour 2024: eine Reise zu den Ursprüngen der Osteopathie
Wittchow, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03

38

Protecting the profession: lessons from the recent physician scandals
Kelso, R. A., Schmidt, D., McLay, C.
Journal of Osteopathic Medicine, 2025/02
Free full text

39

Dr. William Garner Sutherland (1873-1954): The Founder of Cranial Osteopathy
Childs, B., Hammes, C.
Cureus, 2025/02
Free full text

40

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text

41

Generative Artificial Intelligence in Medical Education—Policies and Training at US Osteopathic Medical Schools: Descriptive Cross-Sectional Survey
Ichikawa, T., Olsen, E., Vinod, A., Glenn, N., Hanna, K., Lund, G. C., Pierce-Talsma, S.
JMIR Medical Education, 2025/02
Free full text

42

Leadership and Capacity Building in International Osteopathic Research: introducing Strengthening Osteopathy Leadership and Research (SOLAR) Program
McIntyre, C., McLeod, G. A., Antunes Ferreira, A. P., Cerritelli, F., Draper-Rodi, J., Feehan, J., Fleischmann, M., Sampath, K. K., Morin, C., Muddle, L., Sinderholm Sposato, N., Thomson, O. P., Treffel, L., Tripodi, N., Vaughan, B., Steel, A., Adams, J.
International Journal of Osteopathic Medicine, 2025/02
Free full text

43

Pioneering the future: incorporating lifestyle medicine tools in osteopathic medical education
Bansal, S., Shubrook, J. H.
Journal of Osteopathic Medicine, 2025/02
Free full text

44

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01


46

Heilungshindernisse
(Obstacles to healing)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01

47

Cochlea-Implantat-Versorgung mit besonderem Blick auf die kindliche Versorgung
Lesinski-Schiedat, A.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01

48

Dr. William Garner Sutherland: The Man Who Changed Osteopathy Forever
Sharath, H. V., Phansopkar, P., Qureshi, M. I., Raghuveer, R., Kaur, G.
Cureus, 2025/01
Free full text


50

Journal Club 2024 – 1
Franke, H., Rotter, G.
Osteopathische Medizin, 2024/12





55

Strömungsdynamik in den Faszien
(Fluid dynamics in the fasciae)
Schleip, R.
Osteopathische Medizin, 2024/12


57

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12


59

Investigation of Suboccipital Release, Muscle Energy, and Combination Therapy, Respectively Evaluating their Effect on Carotid Artery Blood Flow: Preliminary Results
Sabbagh, M., Moriarty, S., Perera, I., Dziepak, S., Santiago, M., Peddibhotla, V., Rubis, C., Anandakrishnan, R., Rawlins, F., Brolinson, P. G.
Journal of Osteopathic Medicine, 2024/12

60

Haltung bewahren. Körperhaltung und OMT
Liem, T.
Naturheilpraxis, 2024/12


62

Prone Counterstrain Technique for a High Ilium Sacroiliac Tenderpoint
Hartwell, L. E., Gustafson, H. C., Rudberg-Post, L. J., Matz, O. C., Woolley, A. L.
The AAO Journal, 2024/12


64

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text

65

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text

66

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10


68

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2024/10

69

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10

70

Paradigmata der (ursprünglichen) Osteopathie
(Paradigms of (original) osteopathy)
Engel, M.
Osteopathische Medizin, 2024/09
Free full text



73

Chronic pain, complexity and a suggested role for the osteopathic profession
McDonald, H. N., Lowe, T. J.
International Journal of Osteopathic Medicine, 2024/09


75

Osteopathy: A potential ally against anorexia?
Mattatia, J.
Advances in Integrative Medicine, 2024/09



78

Das Ellenbogengelenk: ein Multitalent
(The elbow joint: a multi-talent)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

79

Endometriose
(Endometriosis)
Engel-Schulmeyer, A., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

80

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

81

Das respiratorisch-zirkulatorische Modell in der osteopathischen Praxis
Tozzi, P.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

82

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text


84

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text


86

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text

87

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text


89

The Neurophysiological Effects of Craniosacral Treatment on Heart Rate Variability: A Systematic Review of Literature and Meta-Analysis
Cook, A. C., Egli, A. E., Cohen, N. E., Bernardi, K., Chae, M. Y., Kapalko, B. A., Coyne, S. A., Scott, R.
Cureus, 2024/07
Free full text


91

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text

92

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07

93


94

Leitlinien in der Osteopathie: Pro und Kontra
(Guidelines in osteopathy: Pros and cons)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07




98

Resonanz in der Osteopathie
Sonntag, M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07

99

Leitlinien in der Osteopathie: Pro und Kontra
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07

100

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06

101

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/06

102

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/06
Free full text

103

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/06


105

Синдром короткой ноги в клинической практике
(Short leg syndrome in clinical practice)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06

106

Seize the Dura: An Osteopathic Approach to Postictal Delirium
Vijayakar, R., Obialo, S., Nixon, K.
The AAO Journal, 2024/06

107


108

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06



111

A Qualitative and Quantitative Analysis of Suboccipital Release on Heart Rate Variability
Moon, J., Fotopoulos, T. J., Gustin, D., Thornburgh, K. R., Wenner, A. R., McAllister, J. M.
The AAO Journal, 2024/06

112

Post Isometric Muscle Energy at the Cervical Spine (OA, C1, C2) Increases Vagal Tone as Quantified by Heart Rate Variability Metrics
Nakashima, T., Curran, C., Yates, H., Fanous, S., Johns, J., Fotopoulos, T. J., Miller, A.
The AAO Journal, 2024/06


114

The osteopathic concept after a century
Mackenzie, A. S.
The AAO Journal, 2024/06
Free full text

115

Osteopathic Approach to the Voice
Surve, S.
The AAO Journal, 2024/06


117

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text

118

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05

119

Waste not, want not: call to action for spinal manipulative therapy researchers
Aspinall, S. L., Nim, C., Hartvigsen, J., Cook, C. E., Skillgate, E., Vogel, S., Hohenschurz-Schmidt, D., Underwood, M., Rubinstein, S. M.
Chiropractic & Manual Therapies, 2024/05


121

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05

122

Augmentation of immune response to vaccinations through osteopathic manipulative treatment: a study of procedure
Sanchez, J., Martinez, E. S., Loveless, B., Sees, J. P., Zammuto, J., Szurmant, H., Fuchs, S., Crone, P., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/04
Free full text

123

The effectiveness of an osteopathic manual technique compared with a breathing exercise on vagal tone as indicated by heart rate variability, a crossover study
Cavanagh, M., Cope, T., Smith, D., Tolley, I., Orrock, P., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text


125

A superficial dissection approach to the sphenopalatine (pterygopalatine) ganglion to emphasize osteopathic clinical relevance
Matz, O. C., Rudberg-Post, L. J., Gustafson, H. C., Matz, D. G.
Journal of Osteopathic Medicine, 2024/04
Free full text

126

Lumbar Spinal Stenosis: Diagnosis and Management
Webb, C. W., Aguirre, K., Seidenberg, P. H.
American Family Physician, 2024/04

127

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text

128

Relational clinical practice: A hermeneutic, enactive, intersubjective model of osteopathy
Banton, A., Vogel, S.
International Journal of Osteopathic Medicine, 2024/03

129

Combating Modern DO Stigmatization
Cooney, A., Vega, L., Goodwin, B. J., Adams, J., Mangrola, F., Price, L. M., Powell, L.
International Journal of Osteopathic Medicine, 2024/03


131

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03

132

Introduction to running analysis in the clinical setting: A masterclass
Tripodi, N., Feehan, J., Corcoran, D., Vaughan, B., McLaughlin, P.
International Journal of Osteopathic Medicine, 2024/03
Free full text



135



137

Funktionelle Anatomie der Interozeption
(Functional anatomy of interoception)
Luthin, D., Neuhuber, W.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

138

Der Schluckakt
(The act of swallowing)
Sergueef, N.
Osteopathische Medizin, 2024/03
Free full text

139

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

140

Aus der digitalen Welt
(From the digital world)
Sonntag, M.
Osteopathische Medizin, 2024/03
Free full text

141

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03


143

Abstracts From the First Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 15, 2023
Amalfitano, A., Obando, P., Ismail, R., Akenami, F.
Spartan Medical Research Journal, 2024/03
Free full text

144

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03

145

The Sentient Cell: Implications for Osteopathic Medicine
Bordoni, B., Escher, A. R., Castellini, F., Vale, J.
Cureus, 2024/02
Free full text

146

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text

147

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text

148

Analysis of Variation in the Origin of the Obturator Artery in Midwestern American Donor Bodies
Diemer, C., Schubert, B., Funk, S., Markand, S.
Cureus, 2024/02
Free full text


150

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

151

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

152

Das Mundatmungssyndrom in der osteopathischen Praxis
(Mouth breathing syndrome in the osteopathic practice)
Keller, M., Brümmer, M., Schulz, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

153

Mitleid und Mitgefühl
(Pity and compassion)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01


155

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

156

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text






162

Psychosomatische Osteopathie
(Psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2023/12

163

Besonderheiten osteopathischer Forschung
(Peculiarities of osteopathic research)
Scheuchl, F., Peuker, E., Kamp, R.
Osteopathische Medizin, 2023/12

164

(Gender competence in medicine and osteopathy)
Wikus, P., Wimpissinger, A.
Osteopathische Medizin, 2023/12

165

Power and capital: In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12

166

Effects of combined taping of quadriceps and hamstring muscles on pain and disability in patients with knee osteoarthritis: Randomized assessor-blinded controlled study
Mohamed, Y. E., Abd-Alkareem, D. S., Balbaa, A.E. A.A., Samy, M. M., Ashour, R. S.
International Journal of Osteopathic Medicine, 2023/12

167

Application of high-velocity low-amplitude technique in cervicothoracic junction produces cardiovascular responses in subjects with C7-T1 dysfunction: Randomized crossover trial
Zago, J., de Souza, B. U. L., Amatuzzi, F., Rondinel, T. Z., Queiroz, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2023/12



170

(Features of the state of occlusion with partial loss of teeth (literature review))
Zhulev, E. N., Saakyan, M. Y., Vel'makina, I. V., Bragina, O. M., Vokulova, Y. A.
Russian Osteopathic Journal, 2023/12

171

Simplicity of Osteopathy
Fryette, H. H.
The AAO Journal, 2023/12
Free full text

172

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text

173

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12


175

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12

176

Analyzing ChatGPT’s Proficiency In Multiple Choice Osteopathic Manipulative Medicine Questions: Insights and Implications
Sundin, A., Gawash, A., Zia, H., Lo, D. F., Averell, N., King, A., Powell, L.
Journal of Osteopathic Medicine, 2023/12

177

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text


179

Dermal Reflections of Neural Disorders: An Hypothesis
Patriquin, D. A.
The AAO Journal, 2023/09
Free full text

180

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text

181

Adductor magnus: Extending the knowledge – A short review of structure and function
Corcoran, D., McNamara, T., Feehan, J., Tripodi, N.
International Journal of Osteopathic Medicine, 2023/09

182

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09

183

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09


185

Stomatognathes System: Stellenwert für die Osteopathie
(Stomatognathic system: Significance for osteopathy)
Prätorius, O., Herdick, T.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09

186

Die Rolle des Menstruationszyklus bei Sportverletzungen
(The role of the menstrual cycle in sports injuries)
Stierl, J. A., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09

187

Mechanische Eigenschaften der Arterien
(Mechanical characteristics of the arteries)
Wyvekens, M., Hirth, T., Wyvekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09


189

Остеопатия в мире современной медицины
(Osteopathy in the world of modern medicine)
Konopleva, E. L., Ostapenko, V. M., Tarasov, N. A.
Russian Osteopathic Journal, 2023/09
Free full text

190

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09

191

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09

192


193

Short-term effects on heart rate variability of occipito-mastoid suture normalization in healthy subjects
Besson, C., Mur, T., Benaim, C., Schmitt, L., Gremeaux, V.
Frontiers in Neuroscience, 2023/09
Free full text

194

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text

195

Gleichgewicht und Propriozeption
(Balance and proprioception)
Barral, J.P.
Osteopathische Medizin, 2023/09



198

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09

199

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text

200

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text


202

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text

203

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07

204

Peritoneal Adhesions in Osteopathic Medicine: Theory, Part 1
Bordoni, B., Escher, A. R., Girgenti, G. T.
Cureus, 2023/07
Free full text

205

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text



208

Sprechen wir noch eine Sprache?
(Are we still speaking the same language?)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06


210

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06

211

Investigating the mechanism of dextrose prolotherapy in vitro: fibroblast proliferation and production of growth factors
Harting, B., Fox, S., Motyka, T., Hinkelman, A.
The AAO Journal, 2023/06
Free full text




215

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06

216

Combating poor mental health in emergency responders: Helping Emergency Responders Overcome (HERO) Act
Derynda, B., Gupta, K. A., Bhattacharya, S., Hollar, T. L.
Osteopathic Family Physician, 2023/06

217

Embryologie und Midline
(Embryology and midline)
Wojtowicz, A., Freeman, B., Dijs, P.
Osteopathische Medizin, 2023/06
Free full text


219

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06


221

Соматическая дисфункция. Клинические рекомендации 2023
(Somatic Dysfunction. Clinical Guidelines 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
Free full text

222

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06



225

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05

226

Effectiveness of the muscle energy technique on postpartum meralgia paresthetica: A randomized controlled trial
El-Din Mahmoud, L. S., El Meligie, M. M., Yehia, R. M.
Journal of Back and Musculoskeletal Rehabilitation, 2023/05

227

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text

228

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text

229

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text

230

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

231

Abwertung als Ziel
(Devaluation as a goal)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

232

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text

233

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

234

Anatomie der Halswirbelsäule
(Anatomy of the cervical spine)
Mihajlovic, Z., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03







241

Fascia; facts and fantasies
Hoppeler, H.
European Journal of Translational Myology, 2023/03

242

A Heart for Medicine: Palpitations In the Midst of Training
Coggins, J.
Osteopathic Family Physician, 2023/03

243

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text



246

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03

247

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text

248

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03

249

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text

250

Prostate Cancer with a Presenting Symptom of Lower Thoracic Back Pain
Malhotra, V., Singh, C., Weening, A., Patel, S., Mayi, B., Migliozzi, J., Malhotra, V.
Osteopathic Family Physician, 2023/03



253

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03

254

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text

255

Mind, Body and Spirit: What Makes Osteopathic Medicine is Hands on
Williams, B. R.
Osteopathic Family Physician, 2023/03



258

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text

259

Characteristics of patients presenting at a university outpatient department for com-plementary and integrative medicine
Rotter, G., Binting, S., Teut, M., Ortiz, M., Willich, S. N., Brinkhaus, B.
Complementary Medicine Research, 2023/02


261

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text

262

Reconceptualizing Somatic Dysfunction in the Light of a Neuroaesthetic Enactive Paradigm
Consorti, G., Castagna, C., Tramontano, M., Longobardi, M., Castagna, P., Di Lernia, D., Lunghi, C.
Healthcare, 2023/02
Free full text

263


264


265

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01


267

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text


269

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text

270

Dynamic touch induces autonomic changes in preterm infants as measured by changes in heart rate variability
Manzotti, A., Cerritelli, F., Monzani, E., Savioli, L., Esteves, J. E., Lista, G., Lombardi, E., Rocca, S. L., Biasi, P., Galli, M., Chiera, M., McGlone, F. P.
Brain Research, 2023/01

271


272

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12




276

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/12




280

Variations of the Cystohepatic Blood Supply in American Midwestern Donor Cadavers
Memar, S. A., VanSickle, C., Funk, S., Houser, J. J., Markand, S.
Cureus, 2022/12
Free full text

281

Reconceptualizing the therapeutic alliance in osteopathic practice: Integrating insights from phenomenology, psychology and enactive inference
Shaw, R., Abbey, H., Casals-Gutiérrez, S., Maretic, S.
International Journal of Osteopathic Medicine, 2022/12



284

Five challenges for manual therapies trials with placebo controls: A proposal
D'Alessandro, G., Ruffini, N., Iacopini, A., Annoni, M., Kossowsky, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/12


286

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11

287

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text

288

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09




292

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text


294

Синдром грушевидной мышцы
(Piriformis syndrome)
Belash, V. O., Petrova, E. A.
Russian Osteopathic Journal, 2022/09

295

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match
McCormick, M. E., Seideman, C. A.
The Journal of Urology, 2022/09



298

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09

299

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09



302

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/09


304

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/09

305

Where do people acquire their beliefs about low back pain?
Suhail, A., Poulter, D. C.
International Journal of Osteopathic Medicine, 2022/09

306

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text

307

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08

308

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/08
Free full text

309

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08

310

Das zerebrospinale venöse System
(The cerebrospinal venous system)
Flenker, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07

311

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07

312

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text

313

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text

314

Addressing disparities in medicine through medical curriculum change: a student perspective
Kureshi, A., Landman, S., Ahmed, M., Savinova, O. V., Becker, D.
Journal of Osteopathic Medicine, 2022/07
Free full text

315

Overcoming reward deficiency syndrome by the induction of “dopamine homeostasis” instead of opioids for addiction: illusion or reality?
Blum, K., Soni, D., Badgaiyan, R. D., Baron, D.
Journal of Osteopathic Medicine, 2022/07
Free full text

316

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07

317

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07

318

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07

319

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07



322

Pediatric unilateral knee swelling: a case report of a complicated differential diagnosis and often overlooked cause
Guardado, K. E., Sergent, S.
Journal of Osteopathic Medicine, 2022/06
Free full text

323

An Enactive-Ecological Model to Guide Patient-Centered Osteopathic Care
Cerritelli, F., Esteves, J. E.
Healthcare, 2022/06
Free full text

324

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text


326

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06



329

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text



332

Transverse colon adenocarcinoma with direct cutaneous extension: complex multidisciplinary surgical management
Snow, Z. A., Marshall, B. N., Dreher, P., Parikh, S. N., Walchak, A., Cahn, D. B.
Journal of Osteopathic Medicine, 2022/06
Free full text

333

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text

334

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/05

335

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text


337

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text

338

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text


340

Os trigonum identified after trauma to heel
Pargeon, M. E., Tjiattas-Saleski, L. R.
Journal of Osteopathic Medicine, 2022/05
Free full text

341

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text

342

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text

343

Clinical evaluation and management of calcific tendinopathy: an evidence-based review
Catapano, M., Robinson, D. M., Schowalter, S., McInnis, K. C.
Journal of Osteopathic Medicine, 2022/04
Free full text

344

Bleeding gums due to immune thrombocytopenic purpura
Trydal, L., Liu, T.
Journal of Osteopathic Medicine, 2022/04
Free full text

345

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text



348

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text

349

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text


351

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

352

A.T. Still’s Biogen
Masiello, D. J.
The AAO Journal, 2022/03
Free full text


354

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text

355

Should person-centredness care be an affordable goal in French osteopathic education?
Salmon, M., Cretal, A., Gonzales-Bandres, M.
International Journal of Osteopathic Medicine, 2022/03
Free full text

356

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

357

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03


359

Weibliche Anatomie: Die Harnblase
Female Anatomy: The Urinary Bladder
Bazin, O., Naudin, M.
Osteopathische Medizin, 2022/03



362

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03

363

Sticky Floor, Broken Ladder, and Glass Ceiling in Academic Obstetrics and Gynecology in the United States and Canada
Kim, K. Y., Kearsley, E. L., Yang, H. Y., Walsh, J. P., Jain, M., Hopkins, L., Wazzan, A. B., Khosa, F.
Cureus, 2022/02
Free full text

364

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text

365

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02

366

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text

367

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text

368

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02

369

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text

370

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text



373

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01

374

Teilleistungsstörung bei visueller Wahrnehmungsstörung
(Partial performance disorder in visual perception disorder)
Engemann, K., Preiss-Leger, B.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01

375




378

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05

379

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text




383

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12





388

Osteopathic ableism: A critical disability view of traditional osteopathic theory in modern practice
MacMillan, A.
International Journal of Osteopathic Medicine, 2021/12

389

Therapeutic Effects of Lymphatic Pump Treatment on Lymphangiogenesis and Inflammatory Cytokines in Lymph Nodes of Rats with Adjuvant-Induced Arthritis
Blucher, K. M., Jain, S., Weber, D., Gober, C., Zanotti, B., Incrocci, R., Del Toro, R., Swanson-Mungerson, M., Volin, V. V.
Journal of Osteopathic Medicine, 2021/12

390

Effect of Self-Performed Osteopathic Manipulative Treatment (suboccipital release) on Heart Rate Recovery: A Pilot Study
Loquist, D. C., Wong, T., Warner, M., Cannumay, S., Singh, G., Nazarian, D., Saukhla, N., Hovsepian, T.
Journal of Osteopathic Medicine, 2021/12

391

Patient Perception of Clinical Trials With and Without Osteopathic Manipulative Treatment During the COVID-19 Pandemic
Nikakis, J., Singh Arora, U., Wang, L., Abramowitz, C., Malkov, D., Cohen, T. J.
Journal of Osteopathic Medicine, 2021/12

392

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text



395

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11

396

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11



399

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text



402

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10




406

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09


408




411

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, Dr C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09

412

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text

413

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09


415

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09

416

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09


418

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09

419

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08

420

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text


422

Ungleichgewicht von Produktion und Resorption des LCS
(Imbalance of production and absorption of the LCS.)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07

423

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07

424

Der Mensch und seine Mikroben
(Man and its microbes)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07



427

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text







434

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07

435

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07

436

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text

437

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06

438

Osteopathy: Italian professional profile. A professional commentary by a group of experts of the European community of practice
Cerritelli, F., Lunghi, C., Esteves, J. E., Vaucher, P., van Dun, P. L. S., Alvarez, G., Biberschick, M., Wagner, A., Merdy, O., Menard, M., Tavernier, P., Clouzeau, C., Risch, A., Ruffini, Nuria, Nunes, A., Santiago, R., Marett, P., Grech, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06





443

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text

444

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text

445

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05

446

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

447

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05

448

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text


450

Osteopathic manual therapy in heart failure patients: A randomized clinical trial
Thomaz, S. R., Teixeira, F. A., de Lima, Acgb, Cipriano Junior, G., Formiga, M. F., Cahalin, L. P.
Journal of Bodywork and Movement Therapies, 2021/04




454

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text

455

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04


457

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text

458

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text


460

Der Knochen aus osteopathischer Sicht
(The bone from an osteopathic point of view)
Junge, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03


462

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03


464

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03




468

Joining forces to administer COVID-19 vaccines
Johnson, K. H.
Journal of Osteopathic Medicine, 2021/03
Free full text







475

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text

476

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01


478

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01

479


480

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01

481

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text


483

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text

484

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text

485

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text

486

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text

487

Embryologische Wellenreiter
(Embryological surfers)
Keown, D.
Osteopathische Medizin, 2020/12



490

Readmission Risk Factors and Heart Failure With Preserved Ejection Fraction
Harmon, D., Rathousky, J., Choudhry, F., Grover, H., Patel, I., Jacobson, T., Boura, J., Crawford, J., Arnautovic, J.
The Journal of the American Osteopathic Association, 2020/12
Free full text





495

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12

496

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12




500

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text

501

The Battle Between Politics and Science Is Costing Us a Timely Victory Over the COVID-19 Pandemic
Hahn, M. B.
The Journal of the American Osteopathic Association, 2020/11
Free full text


503



505

Postoperative peritoneale Adhäsionen
(Postoperative peritoneal adhäsionen)
Liedler, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10

506

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text

507

Gonococcal Arthritis
Mills, K., Jadav, P.
The Journal of the American Osteopathic Association, 2020/10
Free full text

508

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text

509




512

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text


514

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09



517

Spinal Manipulation and Select Manual Therapies: Current Perspectives
Hinkeldey, N., Okamoto, C., Khan, J.
Physical medicine and rehabilitation clinics of North America, 2020/09

518






523

Opioid Use in the Postpartum Period: Are We Prescribing Too Much?
Prentice, D., Berry, A., Stewart, L., Wilkins, H., Ural, S., Deiter, R.
The Journal of the American Osteopathic Association, 2020/08
Free full text

524

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

525

48-Hour Hospice Home Immersion Encourages Osteopathic Medical Students to Broaden Their Views on Dying and Death
Gugliucci, M. R., Padmanabhan, D. L., Silberstein, E. B.
The Journal of the American Osteopathic Association, 2020/08
Free full text

526

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

527

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text


529

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07

530

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text


532

Novel Dual-Fluorescent Mitophagy Reporter Reveals a Reduced Mitophagy Flux in Type 1 Diabetic Mouse Heart
Kobayashi, S., Patel, J., Zhao, F., Huang, Y., Kobayashi, T., Liang, Q.
The Journal of the American Osteopathic Association, 2020/07
Free full text

533

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text


535

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06

536

(Corporeality of the heart)
Kozljanič, R. J., Scheuchl, F., Rösing, S.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06


538

A guide to writing a case report of an osteopathic patient
Vaughan, B., Fleischmann, M.
International Journal of Osteopathic Medicine, 2020/06

539

Neuro-Ocular Release: A New Osteopathic Technique For Resolving Somatic Dysfunction
Feely, R. A., Smith, J. A.
The AAO Journal, 2020/06
Free full text

540

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06

541

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text


543

Test der Faszienkompartimente
(Test for fascia compartments)
Lunghi, C.
Osteopathische Medizin, 2020/06


545

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text

546

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06










556

Graves Orbitopathy
Natali, S., Shogan, P.
The Journal of the American Osteopathic Association, 2020/06
Free full text

557

Partnering With Patients to Reduce Firearm-Related Death and Injury
Ozuna, L., Champion, C., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/06
Free full text



560

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

561

Antithrombotic Therapy for Patients With Atrial Fibrillation and Acute Coronary Syndrome or Percutaneous Coronary Intervention
Tseng, A. S., Shamoun, F. E., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/05
Free full text

562

Does the Halo Effect for Level 1 Trauma Centers Apply to High-Acuity Nonsurgical Admissions?
Hwalek, A. E., Kothari, A. N., Wood, E. H., Blanco, B. A., Brown, M., Plackett, T. P., Kuo, P. C., Posluszny, J.
The Journal of the American Osteopathic Association, 2020/05
Free full text

563

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05

564

Dermatofibrosarcoma Protuberans
Natali, S., Borelli, C., Shogan, P.
The Journal of the American Osteopathic Association, 2020/05
Free full text

565

Medizinischer Notfall in der Praxis: Ich packe meinen Koffer …
(Medical emergency in the practice: I pack my suitcase ...)
Merkt, P., Grasmück, J., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04



568

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04

569

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04

570

Academic Advising Using Theoretical Approaches for Medical Students Who Are Struggling in Preclinical Years
Tewary, S., Jordan, J. A., Rana, A. M., Mayi, B.
The Journal of the American Osteopathic Association, 2020/04
Free full text

571

Approach To Joint Pain In The Elderly For Osteopathic Providers
Daudfar, S., Nakajima, N., Faiss, K., Tegeler, L., Kuo, J., Dreibelbis, R., Goering, E., Katsaros, E., Pham, J. T.
Osteopathic Family Physician, 2020/04
Free full text

572

Osteopathic Primary Care Treatment Options for Ulcerative Colitis
Fernandez, A., Januchowski, R.
Osteopathic Family Physician, 2020/04
Free full text

573

Urticaria: Diagnosis and Treatment with Osteopathic Considerations
Stacey, S.., Burke, D., Brininger, T.
Osteopathic Family Physician, 2020/04
Free full text


575

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text

576

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text

577

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text

578

Skoliose und Osteopathie: Teil 1: Grundlagen
(Scoliosis and osteopathy. Part 1: Basics)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/03

579

Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research
Esteves, J. E., Zegarra-Parodi, R., van Dun, P., Cerritelli, F., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/03

580

The ICD-11 and opportunities for the osteopathy profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Orchard, D.
International Journal of Osteopathic Medicine, 2020/03

581

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text

582

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text



585

Antidepressant Discontinuation Syndrome: A Common but Underappreciated Clinical Problem
Rizkalla, M., Kowalkowski, B., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2020/02
Free full text

586

A Stepwise Approach to the Management of Heart Failure and its Comorbidities
Rogers, F. J., Saghir, Z.
The Journal of the American Osteopathic Association, 2020/02
Free full text


588

Shift Workers at Risk for Metabolic Syndrome
Kulkarni, K., Schow, M., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2020/02
Free full text

589

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text

590

Value of the Continuing Certification Modules and Challenging the Status Quo
Capoocia, A.
The Journal of the American Osteopathic Association, 2020/02
Free full text

591

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01




595

The Many Facets of Hypermobile Ehlers-Danlos Syndrome
Riley, B.
The Journal of the American Osteopathic Association, 2020/01
Free full text

596

Food Sensitivity Testing and Elimination Diets in the Management of Irritable Bowel Syndrome
Smith, E., Foxx-Orenstein, A., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/01
Free full text

597

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text

598

High-Velocity, Low-Amplitude Management of Posterior Rib Somatic Dysfunction
Kasten, K. M., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/01
Free full text


600

Preventing Premature Weaning: Management Options for Common Lactation Conditions, Including OMT
Sackett, D. R., Dajani, T., Shoup, D., Ikonne, U., Bombei, B.
Osteopathic Family Physician, 2020/01

601

Taxonomy of the Lateral Strain Patterns at the Sphenobasilar Synchondrosis for Osteopathic Cranial Manipulative Medicine
Capobianco, J. D., Shermon, S.
The Journal of the American Osteopathic Association, 2020/01
Free full text



604

Osteopathic Cranial Manipulative Medicine: Frontal and Parietal Lift Techniques
Mardini, D., Peña, N., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/12
Free full text









613

Role of Opioid Involved Drug Interactions in Chronic Pain Management
Bain, K. T., Knowlton, C. H.
The Journal of the American Osteopathic Association, 2019/12
Free full text

614

Review of Opioid Prescribing in the Osteopathic and Ambulatory Setting
Hussein, A. I., Bekampis, C. F., Jermyn, R. T.
The Journal of the American Osteopathic Association, 2019/12
Free full text

615

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text

616

An Osteopathic Physician's Approach to the Esports Athlete
Zwibel, H., DiFrancisco-Donoghue, J., DeFeo, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/11



619

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text


621

Visceral osteopathic manipulative treatment reduces patient reported digestive toxicities induced by adjuvant chemotherapy in breast cancer: A randomized controlled clinical study
Lagrange, A., Decoux, D., Briot, N., Hennequin, A., Coudert, B., Desmoulins, I., Bertaut, A.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2019/10



624

Awareness of axial spondyloarthritis among chiropractors and osteopaths: findings from a UK Web-based survey
Yong, C. Y., Hamilton, J., Benepal, J., Griffiths, K., Clark, Z. E., Rush, A., Sengupta, R., Martindale, J., Gaffney, K.
Rheumatology Advances in Practice, 2019/10
Free full text



627

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text

628

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text

629

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09

630

Osteopathic approach with a patient undergoing cardiac transplantation: the five diaphragms
Bordoni, B., Morabito, B., Simonelli, M., Nicoletti, L., Rinaldi, R., Tobbi, F., Caiazzo, P.
International medical case reports journal, 2019/09
Free full text

631

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

632

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09


634

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text



637

Die Schilddrüse
(The thyroid)
Stöckl, D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

638

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09

639

Fascial Nomenclature: An Update
Bordoni, B., Walkowski, S., Morabito, B., Varacallo, M. A.
Cureus, 2019/09
Free full text

640

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

641

Dynamic touch reduces physiological arousal in preterm infants: A role for c-tactile afferents?
Manzotti, A., Cerritelli, F., Esteves, J. E., Lista, G., Lombardi, E., La Rocca, S., Gallace, A., McGlone, F. P., Walker, S. C.
Developmental Cognitive Neuroscience, 2019/08
Free full text

642

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text

643

Kindlicher Kopfschmerz
(Child headache)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07

644

Körperarbeit als Zugang zum ganzen Menschen
(Bodywork as access to the whole person)
Petzold, T. D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07

645

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07




649

Нормы труда врача остеопата в учетом кодирования заболеваемости
(The labor standards of osteopath with regard to morbidity coding)
Shipova, V. M., Berseneva, E. A., Mikhailov, D. Y.
Problemy sotsial'noi gigieny, zdravookhraneniia i istorii meditsiny, 2019/07




653

Specific Adjusting Technique
(Specific Adjusting Technique)
Lamb, Gez, Schabel, Kai
Osteopathische Medizin, 2019/06

654

Osteopathic Cranial Manipulative Medicine and the Blood Brain Barrier: A Mechanistic Approach to Alzheimer Prevention
McAree, M., Dunn, A., Furtado, J., Timmerman, C., Winchell, Z., Rani, R., Farah, J., Crispino, L. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text

655

Pilot randomized single-blind clinical trial, craniosacral therapy vs control on physiological reaction to math task in male athletes
Wójcik, M., Dziembowska, I., Izdebski, P., Żekanowska, E.
International Journal of Osteopathic Medicine, 2019/06

656

Refining the biopsychosocial model for musculoskeletal practice by introducing religion and spirituality dimensions into the clinical scenario
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/06



659

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text

660

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text

661

Integrating Osteopathic Philosophy in Cancer Care
Brown, Z. J., Martin, S. P., Carman, R.
The Journal of the American Osteopathic Association, 2019/06
Free full text


663

Cranial Osteopathy: Obscurantism and Enlightenment
Bordoni, B., Morabito, B., Simonelli, M.
Cureus, 2019/05

664

The Other Side of the Fascia: Visceral Fascia, Part 2
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05

665

The Other Side of the Fascia: The Smooth Muscle Part 1
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
Free full text

666

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05


668

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text

669

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text

670

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text

671

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04

672

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text


674

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text

675

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text


677

The River of Life: Flüssigkeiten in der Osteopathie
(The river of life: fluids in osteopathy)
Mayer-Fally, E., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03

678

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03


680

Ist Asymmetrie Dysfunktion?
(Is asymmetry dysfunction?)
Robert, V.
Osteopathische Medizin, 2019/03


682

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03

683

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text

684

Manipulative Therapies: What Works
Smith, M. S., Olives, J., Smith, K.
American Family Physician, 2019/02
Free full text

685

The sacro-iliac joint: A potentially painful enigma. Update on the diagnosis and treatment of pain from micro-trauma
Le Huec, J. C., Tsoupras, A., Leglise, A., Heraudet, P., Celarier, G., Sturresson, B.
Orthopaedics & Traumatology: Surgery & Research, 2019/02

686

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text

687

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text

688

Der zervikothorakale Übergang
(The cervicothoracic junction)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

689

Welche Elemente charakterisieren die Osteopathie?
(Which elements characterize osteopathy?)
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

690

Back to the Roots: Palpation
(Back to the Roots: Palpation)
Eulenberg, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

691

Die Arbeit mit Diaphragmen im Zapchen
(Working with diaphragms through the Zapchen)
Weiß, B.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01


693

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text

694

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text

695

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text




699

Fundamental study of a visceral pericardial osteopathic protocol on heart physiology
Fatisson, J., Mullie, Y., Oswald, V., Gauthier, M., Lalonde, F., Comtois, A. S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

700

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text

701

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text





706

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

707

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text

708

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text

709

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text

710

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10

711

Changes on cervical range of motion in migraine patients after a strain counterstrain treatment
Giustino, V., Contrò, V., Brusa, J., Proia, P., Messina, G., Brighina, F.
The Journal of Headache and Pain, 2018/10

712

Die Kunst des Briefschreibens und der Korrespondenz
(The art of letter writing and correspondence)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
Free full text

713

The One Health Initiative as a Basis for Research Development in the Department of Pharmacology at Midwestern University
Prozialeck, W. C., Edwards, J. R.
The Journal of the American Osteopathic Association, 2018/09
Free full text

714

Hebammenarbeit und Osteopathie – Berührungspunkte
(Midwifery and osteopathy - points of contact)
Göggerle-Locher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09

715

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text

716

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09

717

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09


719

Anatomie am Lebenden
(Anatomy on the living object)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09


721

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09



724

Effect of gong’s mobilisation versus muscle energy technique on pain and functional ability of shoulder in phase II adhesive capsulitis
Gopinath, Y., Seenivasan, S. K., Veeraraghavan, S. N. C., Viswanathan, R., Govindaraj, M. K.
Journal of Clinical and Diagnostic Research, 2018/09

725

Was ist Schmerzpsychotherapie?
(What is pain psychotherapy?)
Butz, M., Braun, C., Böger, A.
Osteopathische Medizin, 2018/09

726

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text

727

Umgangsformen: Respektvolles und offenes Miteinander
(Manners: Respectful and open interaction)
Brandes, M., Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09



730

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
listed, , No authors
The Journal of the American Osteopathic Association, 2018/08
Free full text

731

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text

732

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text

733

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text


735

Mut zur Muße
(Dare to laze)
Lamersdorf, P. J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07


737

Still und das Geheimnis von Gesundheit
(Still and the secret of health)
Lewis, J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07


739

The Rule of the Artery Is Supreme. Or, Is It?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2018/07
Free full text

740

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text

741

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07

742

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07

743

Effect of HVLA on Chronic Neck Pain and Dysfunction
Cabahug, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text

744

Die Gesundheit in der Osteopathieausbildung
(Health in osteopathic education)
Bock, N.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07

745

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text

746

National Institutes of Health and Osteopathic Medicine: Another call for action and equality in a legal struggle won long ago
Peppers, B. P., Blumer, J. U., Hostofer, R. W., Rowane, M. P., Thomas, K. A., Byrnes, T. R.
The AAO Journal, 2018/06
Free full text

747

The challenges and opportunities of using patient reported outcome measures (PROMs) in clinical practice
Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2018/06

748

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text



751

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05

752

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text




756

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04

757

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text

758

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03


760

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03

761

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03

762

Rethinking Superior and Inferior Sacroiliac Shear: A New Approach to Diagnosis and Treatment
Goldman, S. I., van Buskirk, R. L.
The AAO Journal, 2018/03
Free full text


764

Die Zusammenarbeit von Hebamme und Osteopath
(The collaboration of midwife and osteopath)
Steinfurth, G., Böhringer, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03

765

Interdisziplinäre Zusammenarbeit
(Interdisciplinary collaboration)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03



768

Clinical versus radiological findings: A paradox in diagnosing minor hamstring injuries
Arumugam, A.
International Journal of Osteopathic Medicine, 2018/03

769

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text

770

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03

771

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text

772

Clinical reasoning for complex cervical spine conditions
Reid, D., Rebbeck, T., McCarthy, C.
International Journal of Osteopathic Medicine, 2018/03



775

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text

776

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

777

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text

778

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text

779

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text

780

Charlotte Weaver: Forschung zur Schädelwirbeltheorie
(Charlotte Weaver: Research on the cranial vertebra theory)
Engemann, K., Biermann, H.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

781

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

782

Beryl Arbuckle und die kraniale Osteopathie
(Beryl Arbuckle and cranial osteopathy)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01



785

Frauen in der osteopathischen Praxis
(Women in osteopathic practice)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

786

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text

787

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text

788

Anne Wales (1904 – 2005)
Dove, C.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

789

Wer war eigentlich Edna M. Lay?
(Who was Edna M. Lay?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

790




793

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12

794

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text

795

What are the risks of manual treatment of the spine? A scoping review for clinicians
Swait, G., Finch, R.
Chiropractic & Manual Therapies, 2017/12
Free full text

796

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text


798

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text

799

Lymphatic Pump Treatment of Inflammation in Rat Adjuvant-Induced Arthritis
Volin, M., McAuliffe, R., Zanotti, B.
The Journal of the American Osteopathic Association, 2017/11

800

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text

801

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text

802

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text

803

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text

804

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text

805

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10

806

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

807

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10



810

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text

811

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text

812

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09





817

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

818

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

819

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09


821

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09


823

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text

824

Scheinselbstständigkeit in der osteopathischen Praxis
(False self-employment in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
Free full text

825

Das Nichts zwischen den Dingen – oder was ist Raum?
(The nothingness between things - or what is space?)
Wallbrecht, C., Nehlsen, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09

826

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text


828

Raum und Weite im Lernfeld Osteopathie
(Space and width in the learning field of osteopathy)
Brown, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09



831

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09

832

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text

833

Functional Somatic Syndrome: Assessment and Management
Graver, C. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

834

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

835

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text


837

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text

838

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

839

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

840

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text





845

Reflexionen über Psyche und Geist in der Osteopathie
(Reflections on psyche and mind in osteopathy)
Turner, S., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text

846

Kraniozervikomandibulär bedingte Gleichgewichtsstörungen
(Vertigo caused by the cranio-cervico-mandibular complex)
Van Gorp, J., Stöcker, D.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06


848

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06

849

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text

850

Patienteninfo: Schwindel
(Patient information: Vertigo)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06

851

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text

852

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06

853

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text

854

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text

855

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text

856

An Osteopathic Approach to Chronic Pain Management
Jerome, J. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text

857

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text

858

Regulationsstörung
(Infantile colic)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04

859




862

Persistierende frühkindliche Reflexe
(Persistent early childhood reflexes)
Watrin, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04


864


865

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text



868

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text

869

The importance of pilot studies, how to write them and what they mean
Vogel, S., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2017/03

870

A process approach in osteopathy: beyond the structural model
Lederman, E.
International Journal of Osteopathic Medicine, 2017/03


872

Innovation in graduate medical education – using a competency based medical education curriculum
Riley, B. A., Riley, G.
International Journal of Osteopathic Medicine, 2017/03






878

Pectus Excavatum: A Review of Diagnosis and Current Treatment Options
Abid, I., Ewais, M. M., Marranca, J., Jaroszewski, D. E.
The Journal of the American Osteopathic Association, 2017/02
Free full text


880

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/




884

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text

885

Die Architektur der extrazellulären Matrix
(The architecture of the extracellular matrix)
Armstrong, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

886

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text

887

Osteopathie, Krankheit und Gesundheit
(Osteopathy, disease and health)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

888

Die therapeutische Potency
(Therapeutic potency)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01



891

John Martin Littlejohn: Leben und Werk
(John Martin Littlejohn: life and work)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

892

(Thinking, feeling and wanting as component of a treatment)
Krause, R.
Osteopathische Medizin, 2016/12







899

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text

900

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text

901

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text


903

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text

904

A model for radiating leg pain of endometriosis
Bove, G. M.
Journal of Bodywork and Movement Therapies, 2016/10

905

Requirements for Certification in Surgery: A Comparison of the American Board of Surgery and the American Osteopathic Board of Surgery
Termuhlen, P. M., AH, O. Yurvati, Stella, J. J.
The Journal of the American Osteopathic Association, 2016/10
Free full text


907

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text

908

Manual therapy and cervical artery dysfunction: Identification of potential risk factors in clinical encounters
Vaughan, B., Moran, R., Tehan, P., Fryer, G., Holmes, M., Vogel, S., Taylor, A.
International Journal of Osteopathic Medicine, 2016/09



911

Patienteninfo: Leben ist Bewegung
(Patient information: Life is movement)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09



914

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

915




918

(Skin cancer: What you should watch out for in your patients)
Schnopp, C., Mempel, M., Baumstark, J.
Osteopathische Medizin, 2016/09


920

Nuad Boran – die traditionelle thailändische Massage
(Nuad Boran - the traditional Thai massage)
Rouhani, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09


922

Haftungsfälle in der osteopathischen Praxis
(Cases of liability in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09


924

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

925

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text

926

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text

927

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text

928

Manual evaluation of the diaphragm muscle
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Journal of Chronic Obstructive Pulmonary Disease, 2016/08
Free full text





933

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text



936

Was macht die Psyche somatisch?
(What makes the psyche somatic?)
Vogt, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07

937

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text


939

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text


941

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06

942

(The polyvagal theory in osteopathy)
Porges, S. W., Liem, T.
Osteopathische Medizin, 2016/06


944

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06

945

Beliefs about back pain: The confluence of client, clinician and community
Darlow, B.
International Journal of Osteopathic Medicine, 2016/06

946

Time, space and form: Necessary for causation in health, disease and intervention?
Evans, D. W., Lucas, N., Kerry, R.
Medicine, Health Care and Philosophy, 2016/06

947

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text


949

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

950

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text

951

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

952

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

953

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03


955

Was ist eigentlich … Body-Mind-Centering®?
(What actually is Body-Mind-Centering®?)
Leinweber, D., Rustler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03



958

Anmerkungen zu Blechschmidt
(Comments on Blechschmidt)
Mildenberger, F. G.
Osteopathische Medizin, 2016/03

959

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text

960

Patienteninfo: Schilddrüsenunterfunktion
(Patient information: Hypothyroidism)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

961

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03


963

The Glymphatic-Lymphatic Continuum: Opportunities for Osteopathic Manipulative Medicine
Hitscherich, K., Smith, K., Cuoco, J. A., Ruvolo, K. E., Mancini, J. D., Leheste, J. R., Torres, G.
The Journal of the American Osteopathic Association, 2016/03
Free full text


965

Assessment of Australian osteopathic learners
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03



968

Assessment of Australian osteopathic learners' clinical competence during workplace learning
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03

969

Patients' experiences of living with persistent back pain
van Griensven, Hubert
International Journal of Osteopathic Medicine, 2016/03

970

Die Polyvagal-Theorie
(The Polyvagal Theory)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

971

Research Into Osteopathic Manipulative Medicine: Steps on the Evidence Pyramid
Ching, L. M.
The Journal of the American Osteopathic Association, 2016/03
Free full text


973

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text


975


976

Modern Still Life
Pennekamp, A.
The Journal of the American Osteopathic Association, 2016/01
Free full text




980

Die Faszien im Alter
(Fascia in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

981

Bluthochdruck im Alter
(Hypertension in old age)
Seidler, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

982

Philosophie der Unsterblichkeit
(Philosophy of immortality)
Still, A. T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01


984

Der lange Weg bis ins hohe Alter
(The long walk to old age)
Chandler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

985

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

986

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text

987

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text








995

Safeguarding children in osteopathic practice part 2: Managing concerns about children
Feld, A., Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2015/12


997

The anatomy, biological plausibility and efficacy of visceral mobilization in the treatment of pelvic floor dysfunction
Horton, R. C.
Journal of Pelvic, Obstetric Gynaecological Physiotherapy, 2015/12
Free full text

998

Scimitar syndrome: A rare explanation for a common symptom with an osteopathic approach
Rivera, N. T., Martin, R. B., Gordon, M.l B., Rajter, J.-J., Bray, N.
International Journal of Osteopathic Medicine, 2015/12


1000

Achilles Tendon Disorders
Saini, S. S., Reb, C. W., Chapter, M., Daniel, J. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text

1001

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text

1002

2015 Updated Method Guideline for Systematic Reviews in the Cochrane Back and Neck Group
Furlan, A. D., Malmivaara, A., Chou, R., Maher, C. G., Deyo, R. A., Schoene, M., Bronfort, G., van Tulder, M. W.
Spine (Phila Pa 1976), 2015/11

1003

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text

1004

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text


1006




1009

Osteopathie in Auroville
(Osteopathy in Auroville)
Kraus, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1010

Understanding Fibroblasts in Order to Comprehend the Osteopathic Treatment of the Fascia
Bordoni, B., Zanier, E.
Evidence-based Complementary and Alternative Medicine, 2015/09
Free full text




1014

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09


1016

Kinesiologisches Taping in der Osteopathie
(Kinesiology taping in osteopathy)
Seifert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
Free full text

1017

Rechtliches rund um die osteopathische Praxis: Abrechnung der Behandlung
(Billing of treatment)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09



1020

Patienteninfo: Anzeichen für einen Schlaganfall
(Patient information: Signs of a stroke)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1021

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1022

Im Westen was Neues
(News from the West)
Dick-Wallace, S. F.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1023

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09

1024

Der Zehengang
(Toe walking)
Guerassimiouk, D., Goussel, W., Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1025

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1026

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text

1027

Modeled Osteopathic Manipulative Treatments: A Review of Their in Vitro Effects on Fibroblast Tissue Preparations
Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1028

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1029

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1030

Das Schleimhaut-assoziierte lymphatische Gewebe (MALT)
(Mucosa Associated Lymphatic Tissue (MALT))
Höppner, J.P., Stark, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07

1031

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text


1033

Entzündungsreaktionen aus Sicht der Osteopathie
(Inflammatory reactions from an osteopathic point of view)
Sarzeaud, R., Thon, N., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
Free full text



1036


1037

Strömung
(Flow)
Geyer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07


1039

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07




1043

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text

1044

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

1045

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text


1047

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06



1050

Systematic Review Challenges Efficacy of Pediatric OMT
Martincik, L., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1051

High-Velocity Thrust to the Atlantoaxial Joint Does Not Increase Mechanical Stress on the Vertebral Artery
Guevarra, C. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1052

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1053

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1054

Wie können wir unsere Wahrnehmung verbessern?
(How can we improve our perception?)
Marris, T., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1055

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1056

Was nimmt mein Osteopath wahr?
(What does my osteopath perceive?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1057

Sutherland
Bordoni, B., Zanier, E.
Advances in Mind-Body Medicine, 2015/04

1058

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1059

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1060

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1061

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text



1064

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1065

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1066

Was ist eigentlich … Wahrnehmung?
(What actually is perception?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1067

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1068

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1069

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1070

Recognizing the Value of Manual Therapy Interventions in Women's Health: An Interim Report
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text

1071

Dramatic Reduction in Menstrual Pain After Osteopathic Manipulative Therapy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text

1072

OMT—and Placebo—Shown Effective in Reducing Pain During Pregnancy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text


1074

Chronic inflammatory disease and osteopathy: a systematic review
Cicchitti, L., Martelli, M., Cerritelli, F.
PLoS One, 2015/03
Free full text


1076

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03

1077

Osteopathic Considerations in the Management of Migraine in Pregnancy
Soshnick, S., Mezzone, C., Yao, S., Abu-Sbaih, R.
Osteopathic Family Physician, 2015/03
Free full text



1080

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text


1082

Osteopathic Manipulative Treatment Improves Clinical Response and Lowers Relapse Rates Among Patients With Chronic Low Back Pain
Brohard, J. N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01
Free full text

1083

Osteopathic Manipulative Treatment Is Effective for Nonspecific Low Back Pain
O'Donnell Rosendahl, N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01


1085

Osteopathische Sterbebegleitung
(Osteopathic terminal care)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
Free full text

1086

Alt geworden oder jung geblieben?
(Grown old or stayed young?)
von Studzinski, I.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

1087

Veränderungen im Alter
(Changes in old age)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

1088

Patienteninfo: Gute Ernährung für gesundes Altern
(Patient information: Good nutrition for healthy aging)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

1089

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01

1090

Durch Tanzen anders altern
(Aging differently through dancing)
Gierz, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

1091

Kann die Arbeit mit dem Liquor älteren Patienten helfen?
(Can working with cerebrospinal fluid help elderly patients?)
Grundberg, S., Höflehner-Schnürch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01



1094

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text

1095

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12

1096

Laser Doppler Flowmetry in Manual Medicine Research
Zegarra-Parodi, R., Snider, E. J., Park, P. Y. S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/12
Free full text




1100

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text



1103

Safeguarding children in osteopathic practice: Part 1: Identifying children at risk
Maddick, A. F., Feld, A., Laurent, S.
International Journal of Osteopathic Medicine, 2014/12

1104

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text








1112

Effect of myofascial techniques applied to the cranial region on autonomic Nervous System analyzed by Heart Rate Variability
Cantalino, J. L. R., Salgado, A. S. I., Santos, I. R., Oliveira, L. V. F., Oliveira, C. S., Ferreira, L. A. B., Da Silveira, N. J. F., Costa, M. S.
Manual Therapy, Posturology & Rehabilitation Journal, 2014/11
Free full text


1114

Die Bedeutung der Faszien im Hochleistungssport
(The importance of fascia in high-performance sports)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text


1116

Osteopathic Manipulative Treatment Induces Enhanced Intracellular Immune Response
Blumer, J.
The Journal of the American Osteopathic Association, 2014/10
Free full text


1118

Dose-Response Research in Chiropractic Care and Possible Comparisons With OMT
King, H. H.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1119

OMT Is Efficacious for Patients With High Baseline Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1120

How to Win the Match Against Tennis Elbow: A Comparison of Different Techniques
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1121

Als Osteopath bei den Olympischen Sommerspielen
(At the Summer Olympics as an Osteopath)
Maurer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10




1125

Hypnose in Leistungssport und Osteopathie
(Hypnosis in competitive sports and osteopathy)
von Fischern, I.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10

1126

Achillodynie
(Achillodynia)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text



1129

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1130

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1131

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09


1133

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text


1135

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text


1137

Osteopathic Primary Care of Patients With Inflammatory Bowel Disease: A Review
Bragg, J. D.
The Journal of the American Osteopathic Association, 2014/09
Free full text


1139

Osteopathic manipulative treatment for nonspecific low back pain: a systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
BMC Musculoskeletal Disorders, 2014/08
Free full text

1140

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text




1144

Osteopathische Annäherung an die Arteriosklerose
(Osteopathic approach to arteriosclerosis)
Elferink, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07

1145

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text

1146

Impact of the single accreditation agreement on GME governance and the physician workforce
Kelley, C. S.
The Journal of the American Osteopathic Association, 2014/07
Free full text


1148

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text

1149

Patienteninfo: Herzinfarkt bei Frauen
(Patient information; Heart attack in women)
Gräfin von Pfeil, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07

1150

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text


1152

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06


1154






1159

Reprint of: Elevating the quality of disability and rehabilitation research: Mandatory use of the reporting guidelines
collective, Authors
International Journal of Osteopathic Medicine, 2014/06
Free full text

1160

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06

1161

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text


1163

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text

1164

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text

1165

Manual Therapy Shown to Be Effective for Tension-Type Headache
King, H. H.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1166

OMT Improves Acute Hemodynamic Control in Pregnancy by Means of Improved Venous Return
Seffinger, M. A., Brohard, J. N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1167

G.I. Joe: Could Visceral Osteopathy Help Fight the War against IBS?
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1168

Two novel nonsurgical treatments of carpal tunnel syndrome
Schreiber, A. L., Sucher, B. M., Nazarian, L. N.
Physical Medicine and Rehabilitation Clinics of North America, 2014/05

1169

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1170

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1171

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text


1173

Schlafstörungen bei Säuglingen und Kindern
(Sleep disorders in infants and children)
Lim, K. W., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04

1174

Das fetale Alkoholsyndrom
(Fetal alcohol syndrome)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04

1175


1176

Hirnnerven und Dysfunktionen des Schädels
(Cranial nerves and dysfunctions of the skull)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04


1178

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text


1180

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text


1182

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03




1186

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text


1188

Preliminary findings on the use of osteopathic manipulative treatment: outcomes during the formation of the practice-based research network, DO-Touch.NET
Degenhardt, B. F., Johnson, J. C., Gross, S. R., Hagan, C., Lund, G., Curry, W. J.
The Journal of the American Osteopathic Association, 2014/03
Free full text

1189

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text

1190

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03

1191

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03


1193

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03

1194


1195

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly
Juhl, J. H.
The Journal of the American Osteopathic Association, 2014/02
Free full text


1197

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text

1198

Response to Letter Regarding “Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly“
Noll, D. R.
The Journal of the American Osteopathic Association, 2014/02
Free full text



1201

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1202

Abdominal Muscles Are the Front Side of the Low Back
King, H. H.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1203

Review of Severe Adverse Events From Spinal Manipulative Therapy of the Lumbopelvic Area
King, H. H.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1204

OMT Relieves Severe Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1205

Systematic Review Paints Incomplete Picture of OMT Research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1206

Manual Therapy or Exercise Effective for Hip or Knee Osteoarthritis
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1207

A Research Primer, Part 2: Guidelines for Developing a Research Project
Yens, D. P., Brannan, G. D, Dumsha, J. Z.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1208

Schuhe und chronische Fußschmerzen im Alter
(Shoes and chronic foot pain in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01


1210

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01


1212

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1213

Der lebendige Fuß des Menschen aus osteopathischer Sicht
(The living human foot from an osteopathic perspective)
Wales, A., Mitha, N., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

1214

Der Osteopath am Fuße des Patienten
(The osteopath at the foot of the patient)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

1215

Was ist Podo-Postural-Therapie?
(What's Podo-Postural Therapy?)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

1216

Die Mechanik des Fußes
(The mechanics of the foot)
Zwierzchowska, Z., Vieten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

1217


1218

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text




1222

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12

1223

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12

1224

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12

1225

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text

1226

Potential New Dimensions in Dermatology: The Osteopathic Approach to Cutaneous Disease
Michunovich, A. M., Stern, R.
The AAO Journal, 2013/12
Free full text





1231

Plagiozephalie – Ursachen und Hintergründe
(Plagiocephaly - Causes and background)
Künzel, K.H., Hoermann, R.
Osteopathische Medizin, 2013/11


1233

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text

1234

Effect of selected manual therapy interventions for mechanical neck pain on vertebral and internal carotid arterial blood flow and cerebral inflow
Thomas, L. C., Rivett, D. A., Bateman, G., Stanwell, P., Levi, C. R.
Physical Therapy, 2013/11
Free full text

1235

Swedenborgs Einfluss auf die Osteopathie
(Swedenborg's influence on osteopathy)
Fuller, D. B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10

1236

„Mein Andrew Taylor Still“
(“My Andrew Taylor Still“)
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10

1237

Don't Throw the Baby Out With the Bath Water
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1238

Systematic Review of OMTh for Lower Urinary Tract Symptoms in Women Shows Benefit
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1239

Systematic Review of CAM Approaches to Otitis Media: The Otolaryngology Perspective
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1240

Quantifying Lack of Interexaminer Reliability
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1241


1242




1245


1246

A. T. Still und die Wissenschaft
(A. T. Still and science)
Trowbridge, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10


1248

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1249

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text


1251

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly: An Observational Study
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text

1252

Markenstreit beendet
(Brand dispute settled)
Osteopathische Medizin, 2013/09

1253





1257

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text


1259

The effect of OMT on postoperative medical and functional recovery of coronary artery bypass graft patients
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/08
Free full text

1260

Demonstration of Increased Vascular Characteristics Using Bilateral, Multiparameter Sensors After Controlled Vertebral Osteopathic Manipulative Treatment
Heath, D. M., Makin, I. R. S., Pedapati, C., Mast, T. D.
The Journal of the American Osteopathic Association, 2013/08

1261

Further Demonstration of the Benefit of Osteopathic Manipulative Therapy in Pediatric Care
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1262

Visceral Manipulation Is Shown to Reduce Postoperative Ileus in an Animal Model
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1263

Osteopathic Manipulative Therapy Affects the Position of Internal Organs in Humans
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1264

Osteopathic Manipulative Treatment Is Efficacious for Management of Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1265

Multimodal Chest Physiotherapy Is Beneficial for Patients Receiving Ventilation
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1266

Manual Therapy Is Beneficial for Cervical Radiculopathy
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1267

Wer waren eigentlich …
(Who actually were ...)
Lewis, J. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1268



1270

Okulomotorik und visuelle Teilleistungsstörungen
(Oculomotor and partial visual impairment)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1271

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1272

Die frühkindliche Bewegungsentwicklung
(Early childhood movement development)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1273


1274

Oxytocingabe während der Geburt und ADHS
(Oxytocin during birth and ADHD)
Fleischer, F.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1275

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07






1281

Osteopathie als Kunst?
(Osteopathy as art?)
Novy, R., Sommerfeld, P.
Osteopathische Medizin, 2013/06


1283

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1284

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text


1286

The liquorodynamic model of the primary respiratory mechanism
Moskalenko, Y. E., Kravchenko, T. I., Weinstein, G. B., Vardy, T. C.
The AAO Journal, 2013/06
Free full text

1287

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1288

The effect of osteopathic manipulative treatment on postoperative medical and functional recovery of coronary artery bypass graft patients
Wieting, J. M., Beal, C., Roth, G. L., Gorbis, S., Dillard, L., Gilliland, D., Rowan, J.
The Journal of the American Osteopathic Association, 2013/05
Free full text

1289

Back to back: postnatal osteopathic care
Johnson, C.
The Practising Midwife, 2013/05


1291

Manual Therapy May Benefit Women With Primary Dysmenorrhea
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text


1293

Severity of Irritable Bowel Syndrome Symptoms Is Reduced by Osteopathy
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1294

Manual Therapy May Benefit Women With Interstitial Cystitis and Pelvic Floor Pain
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text



1297

Vaskularisierung der Lendenwirbelsäule
(Vascularization of the lumbar spine)
Rapprich, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04

1298

The use of placebo interventions in clinical practice
Linde, K.
Complementary Therapies in Medicine, 2013/04
Free full text


1300

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1301

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1302

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1303

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1304

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1305

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text

1306

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03

1307

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03


1309

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03

1310

The Biopsychosocial model: Redefining osteopathic philosophy?
Penney, J. N.
International Journal of Osteopathic Medicine, 2013/03

1311

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

1312

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03






1318

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text

1319

Exercise Shown Effective for Management of Neck Pain—Who Needs OMT?
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text

1320

Visceral Manipulation May Affect Pain Perception
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text

1321

Frozen Shoulder Treatment—Different Strokes for Different Folks
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text

1322

Trauma: Betrachtung aus osteopathischer Sicht
(Trauma: Viewed from an osteopathic perspective)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01

1323

Osteopathic Fascial Manipulation Reduces Low Back Pain and Increases Kidney Mobility
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/01
Free full text


1325

Abdominal Visceral Manipulation Prevents and Reduces Peritoneal Adhesions
Seffinger, M. A., Martin, A. J.
The Journal of the American Osteopathic Association, 2013/01
Free full text



1328

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text




1332

Die Gesundheit im Trauma entdecken
(Discovering health within trauma)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01

1333

A logical approach to complicated sacral and innominate dysfunction
Klock, G. B.
The AAO Journal, 2012/12
Free full text

1334

The stabilometric platform as a measuring instrument
Huard, Y.
The AAO Journal, 2012/12
Free full text

1335

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12

1336

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12



1339

Techniken der kardiovaskulären Osteopathie
(Techniques of cardiovascular osteopathy)
Van Den Heede, P., Danjon, J.L.
Osteopathische Medizin, 2012/12

1340

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12

1341

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1342

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1343

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1344


1345

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1346

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1347

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text


1349

Form-Funktion und die Sache mit der Embryologie
(Form-Function and the matter of embryology)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10




1353

Die hilflosen Helfer
(Helplessly helping)
Textor, R.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10

1354

Posture and chronic gonalgia in the elderly: contribution of osteopathic treatment
Huard, Y.
Computer Methods in Biomechanics and Biomedical Engineering, 2012/10

1355

Osteopathic manipulative treatment: novel application to dermatological disease
Campbell, S. M., Winkelmann, R. R., Walkowski, S.
Journal of Clinical and Aesthetic Dermatology, 2012/10

1356

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text

1357

Heterotaxien in der menschlichen Entwicklung
(Heterotaxies in human development)
Doll, S.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10



1360








1367

The eccentricities of osteopathy
Moore, W.
The BMJ, 2012/09


1369

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text

1370

Consent, competence and confidentiality for children and young people: Case problems from osteopathic practice
Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2012/09

1371

Vertebral and internal carotid artery flow during vascular premanipulative testing using duplex Doppler ultrasound measurements: A systematic review
Malo-Urriés, M., Tricás-Moreno, J. M., Lucha-López, O., Estébanez-de-Miguel, E., Hidalgo-García, C., Pérez-Guillén, S.
International Journal of Osteopathic Medicine, 2012/09

1372

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1373

Three-Dimensional Analysis of OMT in the Post–Total Arthroplasty Knee
Simela, A.
The Journal of the American Osteopathic Association, 2012/08

1374

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1375

Topografie des weiblichen Beckens
(Topography of the female pelvis)
Lütjen-Drecoll, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1376

Stressinkontinenz nach einer Geburt
(Stress incontinence after childbirth)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07


1378

Packende Fachartikel – So geht es
(Writing gripping professional articles - Here's how)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07


1380

Patienteninfo: Beckenbodenübungen
(Patient information: pelvic floor exercises)
Vleminckx, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1381

From clinical experience to a model for the human fascial system
Day, J. A., Copetti, L., Rucli, G.
Journal of Bodywork and Movement Therapies, 2012/07

1382

Trauma: Sexuelle Gewalt und ihre Folgen
(Trauma: Sexual Violence and its aftermath)
Dietrich, B.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1383

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1384

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1385

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text


1387

A consideration of the elbow as a tensegrity structure
Scarr, G.
International Journal of Osteopathic Medicine, 2012/06

1388

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06





1393

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text

1394

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text




1398

Kopfschmerzforschung – ein Update
(Headache research - an update)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04



1401

Zeitmanagement – Entschleunigen Sie Ihr Leben!
(Time management - slow down your life!)
Schopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04

1402

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text


1404

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text



1407

Osteopathie und Wissenschaft
(Osteopathy and science)
Liem, T., Hilbrecht, H., Schmidt, T.
Osteopathische Medizin, 2012/03



1410

Osteopathie in Belgien
(Osteopathy in Belgium)
van Dun, P. L. S.
Osteopathische Medizin, 2012/03

1411

Selected fascial aspects of osteopathic practice
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2012/03
Free full text

1412

Reflex Relationships of Paravertebral Muscles
Elbe, J. N.
The AAO Journal, 2012/03
Free full text

1413

The Ram of Reason Seal: Musings on its Origin and Meaning
Hruby, R. J.
The AAO Journal, 2012/03
Free full text

1414

Spontaneous Release by Positioning
Jones, L. H.
The AAO Journal, 2012/03
Free full text

1415

The Neural Basis of the Osteopathic Lesion
Korr, I. M.
The AAO Journal, 2012/03
Free full text

1416

Structural Pelvic Function
Mitchell, F. L.
The AAO Journal, 2012/03
Free full text

1417

The Role of the Fascae in the Maintenance of Structural Integrity
Page, L. E.
The AAO Journal, 2012/03
Free full text

1418

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text

1419

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text

1420

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03





1425

Osteopathie studieren – wieso, weshalb, warum?
(Why study osteopathy?)
Meyer, B., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02



1428

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text

1429

Keep it simple!
(Keep it simple!)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02

1430

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02


1432

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02

1433

Osteopathische Berührung im Spiegel der Supervision
(Osteopathic touch in the mirror of supervision)
Hähn-Jakobs, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02


1435

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text


1437

Effect of OMT on Heart Rate in Normotensive and Prehypertensive Individuals
Siu, V. N., Cooper, A., Rezk, M., Terzella, M., Yao, S. C., Gilliar, W.
The Journal of the American Osteopathic Association, 2012/01



1440

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text

1441

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12

1442

Manipulative Methods of Dr. A.T. Still
Archer, J.
The AAO Journal, 2011/12
Free full text

1443

What is health? What is disease? Thoughts on a complex issue
Flatscher, M., Liem, T.
The AAO Journal, 2011/12
Free full text

1444

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text



1447

Osteopathie in Österreich
(Osteopathy in Austria)
Schulmeyer, A.
Osteopathische Medizin, 2011/12


1449

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text

1450

Innenstrukturen des Thorax
(Internal structures of the thorax)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10

1451

Steuerungsorgan Zwerchfell
(Control organ diaphragm)
Büsser, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10


1453

Atmung und obere Thoraxöffnung
(Breathing and upper thoracic opening)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10

1454

Lungen: Form und Funktion in der osteopathischen Praxis
(Lungs: Form and function in osteopathic practice)
Kuhlmann, C., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10



1457

Lymphatic pump treatment enhances the lymphatic and immune systems
Hodge, L. M., Downey, H. F.
Experimental Biology and Medicine (Maywood, N.J.), 2011/10

1458

Patterns of chronic pain in the population
Carnes, D.
International Journal of Osteopathic Medicine, 2011/09

1459

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text

1460

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09

1461

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text


1463

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text





1468

Sutherland’s Signature
Stark, J.
The AAO Journal, 2011/09
Free full text


1470

Técnica articular para disfunción de malar en eversión
(Articular technique for zygoma in eversion dysfunction)
Antolinos Campillo, P. J., Baño Alcaraz, A., Pascual-Vaca, J. O.
Osteopatía Científica, 2011/09

1471

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09


1473

Effects of Osteopathic Cranial Manipulation on Biogenic Amine Levels, Heart Rate, and Blood Pressure in Adult Humans
Semeniken, K. R., Miller, P. A., Fuhrer, J. M., Farris, D.A., Parry, M. J., Petros, V., Corso, T.
The Journal of the American Osteopathic Association, 2011/08

1474

Lymphatic Pump Treatment of Rats With Adjuvant-Induced Arthritis
Shah, P., Zanotti, B., Woods, J. M., Volin, M.
The Journal of the American Osteopathic Association, 2011/08

1475

Der Wille des Patienten steht über allem
(The patient's will is above all else)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07


1477


1478


1479

Lymphsystem und osteopathische Forschung
(Lymphatic system and osteopathic research)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07

1480

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text



1483


1484

The Hawthorne effect: stronger than the placebo effect?
Berthelot, J. M., Le Goff, B., Maugars, Y.
Joint Bone Spine, 2011/07
Free full text


1486

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06

1487

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06

1488

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06

1489

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text






1495

Jenette “Nettie” Bolles: First woman to pioneer osteopathy
Blumer, J.
The AAO Journal, 2011/06
Free full text





1500

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text


1502

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1503

Tug technique de escafoides para escafoides en rotación externa
(The Tug navicular technique for externally rotated navicular bones)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05




1507

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text


1509

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1510

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1511

Was ist eigentlich …
(What actually is ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04

1512

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1513




1516

Das Urheberrecht (UrhG)
(Copyright law (UrhG))
Ulusal, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04

1517


1518

Is a postural-structural-biomechanical model, within manual therapies, viable?: A JBMT debate
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04

1519

Invited response: (without science, there must be art)
Hannon, J. C.
Journal of Bodywork and Movement Therapies, 2011/04

1520

Invited response (the postural structural model, with boundary conditions)
Irvin, R. E.
Journal of Bodywork and Movement Therapies, 2011/04


1522

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04

1523

Invited response
McGill, S.
Journal of Bodywork and Movement Therapies, 2011/04

1524

Helical tensegrity as a structural mechanism in human anatomy
Scarr, G.
International Journal of Osteopathic Medicine, 2011/03



1527

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text


1529

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03

1530

Manual therapy of the mandibular accessory ligaments for the management of temporomandibular joint disorders
Cuccia, A. M., Caradonna, C., Caradonna, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text






1536




1539

Wer war eigentlich …
(Who actually was ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02

1540

A randomized controlled trial investigating the effects of craniosacral therapy on pain and heart rate variability in fibromyalgia patients
Castro-Sánchez, A. M., Matarán-Peñarrocha, G. A., Sánchez-Labraca, N., Quesada-Rubio, J. M., Granero-Molina, J., Moreno-Lorenzo, C.
Clinical Rehabilitation, 2011/01

1541

Osteopathy and (hatha) yoga
Liem, T.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text




1545

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011



1548

An Osteopathic Approach to Hypothyroidism
Burns, D. K.
The AAO Journal, 2010/12
Free full text

1549

Restoration of a McManis Treatment Stool
Clark, R. C.
The AAO Journal, 2010/12
Free full text



1552

Atypical Pathologic Somatic Dysfunctions: Techniques Revisited
Miller, D. S.
The AAO Journal, 2010/12
Free full text


1554

Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways
Watson, L. A., Pizzari, T.
International Journal of Osteopathic Medicine, 2010/12

1555

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1556

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11

1557

Das Schädeldach als Tensegrity-Struktur
(The cranial roof as a tensegrity structure)
Scarr, G., Hinz, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1558

Hinweise auf eine fasziale Rhythmizität?
(Evidence of fascial rhythmicity?)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1559

Knochen wie Kontinentalschollen
(Bones like continental floes)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1560

Anatomische Gesichtspunkte zur harten Hirnhaut
(Anatomical viewpoints on the hard meninges)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1561



1563

Hirnschädel und Menschsein
(Neurocranium and being human)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1564

Auf der Suche nach der Mittellinie
(Searching for the midline)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1565

Suturen des Hirnschädels
(Sutures of the cranium)
Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1566

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text


1568

Placebo: Missverständnisse und Vorurteile
(Placebo: Misconceptions and prejudices)
Breidert, M., Hofbauer, K.
Osteopathische Medizin, 2010/09




1572

Dig on: A Case Study
Kolkhorst, A. B., Kary, D. J.
The AAO Journal, 2010/09
Free full text


1574

Tensegrity in der Osteopathie
(Tensegrity in osteopathy)
Pflüger, C.
Osteopathische Medizin, 2010/09

1575

Hamo-Study 3, Phase 1: Effects of sternotomy on the mobility of the heart under influence of respiration at 3-months postoperative
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2010/09


1577

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text

1578

Técnica de lift-off para dorsales medias (T4-T10)
(Lift off technique in medium dorsal vertebrae (T4-T10))
Iglesias, J. G., del Cerro, L. P., Rodríguez Blanco, C.
Osteopatía Científica, 2010/09

1579

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text

1580

A ‘system based’ approach to risk assessment of the cervical spine prior to manual therapy
Taylor, Alan J., Kerry, R.
International Journal of Osteopathic Medicine, 2010/09

1581

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07


1583

Differential Effects of Suboccipital Inhibition and Fourth Ventricle Compression On Heart Rate Variability: Evidence For Bi-Directional Modulation Of Autonomic Tone
Snider, E. J., Snider, K. T., Halma, K. D., Fossum, C., Fryer, G., Yang, Q., Mueller, G., Bluml, E. M., Purcell, E.
The Journal of the American Osteopathic Association, 2010/08

1584

Notes on visceral adhesions as fascial pathology
Hedley, G.
Journal of Bodywork and Movement Therapies, 2010/07

1585

Der Gesichtsschädel
(Patient information: The viscerocranium)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

1586

The Fickle finger of quackery in otology: the saga of Curtis H. Muncie, Osteopath
Swamy, R. S., Jackler, R. K.
Otology & Neurotology, 2010/07


1588

Was sind eigentlich... Viszera?
(What actually are viscera?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
Free full text


1590

Zum Aufbau des Gesichts
(Regarding the facial structure)
Fanghänel, J., Eigenwillig, P., Proff, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

1591



1593

Entwicklung des Viszerokraniums
(Development of the viscerocranium)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

1594

What is 'manipulation'? A reappraisal
Evans, D. W., Lucas, N.
Manual Therapy, 2010/06
Free full text

1595

The application of osteopathic treatments to pediatric sports injuries
Bolin, D. J.
Pediatric Clinics of North America, 2010/06
Free full text



1598

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text

1599

Principles of Osteopathy in the Battlefield
Kozminski, M.
The AAO Journal, 2010/06
Free full text

1600




1603

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06



1606

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05


1608

The challenges of primary care and innovative responses in osteopathic education
Shannon, S. C., Ferretti, S. M., Wood, D., Levitan, T.
Health Affairs, 2010/05

1609

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text

1610

Klinische Relevanz statt Placebo-Kontrolle
(Clinical relevance instead of placebo control)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

1611

Morbus Sudeck und Osteopathie?
(Complex Regional Pain Syndrome and Osteopathy?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04


1613

Störungsketten im Bindegewebe
(Patient information: Disruptive chains in the fascia)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04


1615

Was ist eigentlich... intrinsische Bewegung?
(What actually is intrinsic movement?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

1616

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

1617

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text

1618

Kontraktilität von Faszien
(Contractility of Fascias – How is This Behavior Possible?)
Brand, E.M.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04




1622

Osteopathic Manipulative Treatment In the Emergency Department: A Two-Dimensional Curriculum
Mesisca, M., Hoffman, K., Fenati, G., Hruby, R. J.
The AAO Journal, 2010/03
Free full text



1625

Composite sacroiliac joint pain provocation tests: A question of clinical significance
McGrath, M. C.
International Journal of Osteopathic Medicine, 2010/03

1626

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1627

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1628

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1629

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1630

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text

1631

Performing arts medicine--instrumentalist musicians, Part II--examination
Dommerholt, J.
Journal of Bodywork and Movement Therapies, 2010/01


1633

Fascia: A missing link in our understanding of the pathology of fibromyalgia
Liptan, G. L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text

1634

Ist das Bindegewebe ein Organ?
(Patient information: Is fascia an organ?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01


1636

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01


1638

Das Fasziendistorsionsmodell nach Stephen Typaldos
(The Fascial Distortion Model According to Stephen Typaldos)
Fischer, T., Rossmy, C., Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01

1639

Gary Fryer –”...there is not much that we can say without any doubt.”
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01



1642



1644

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12



1647

Dr. A. T. Still’s Treating Chair
Archer, J.
The AAO Journal, 2009/12
Free full text

1648

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text

1649

There Are More Things in Heaven and Earth…
Ching, L. M.G.
The AAO Journal, 2009/12
Free full text


1651

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text



1654

Leben ist Bewegung
(Life is movement)
Gillemot, B., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1655

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1656

Osteopathie für Pferd und Reiter
(Osteopathy for Horse and Rider)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10


1658

Manipulation vor dem Wettkampf?
(Manipulative treatment before the competition?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1659

Osteopathie im Sport
(Osteopathy in sports)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1660

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1661

Leistung optimieren: Osteopathie und Sport
(Optimizing performance: Osteopathy and sports)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1662

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

1663

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09

1664

The functions of breathing and its dysfunctions and their relationship to breathing therapy
Courtney, R.
International Journal of Osteopathic Medicine, 2009/09




1668


1669

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

1670

Understanding the Process of Fascial Unwinding
Minasny, B.
International Journal of Therapeutic Massage and Bodywork, 2009/09
Free full text

1671

La langue : déglutition, fonctions oro-faciales, croissance crânio-faciale
(The tongue: deglutition, orofacial functions and craniofacial growth)
Landouzy, J.M., Sergent Delattre, A., Fenart, R., Delattre, B., Claire, J., Biecq, M.
International Orthodontics, 2009/09

1672

Human Volume Tissue Investigation Method
Mokhov, D. E., Chashchin, A. V., Erofeev, N. P., Vcherashny, D. B.
The AAO Journal, 2009/09
Free full text

1673


1674

Análisis de la fiabilidad palpatoria del pulso en la arteria radial mediante sonografía Doppler
(Analysis of the reliability of radial artery pulse palpation through Doppler sonography)
Cortés Vega, M. D., Rodríguez Blanco, C., González García, P., Ribelles Mayo, J., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09


1676

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text

1677

Time for the osteopathic profession to take the lead in musculoskeletal research
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/07
Free full text


1679

Osteopathische Behandlung akuter Erkrankungen
(Osteopathic Treatment of Acute Diseases)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1680

Magenulkus
(Gastric ulcer)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1681

Vincent Benedetto – Die Basis der Osteopathie
(Vincent Benedetto - The basis of osteopathy)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07


1683

Aufruf Arbeitskreis klinische Osteopathie
(Appeal for a Working Group Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1684

Osteopathie bei akuten Erkrankungen
(Osteopathy for acute diseases)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1685

Grundlagen der Entzündungspathologie
(Basics of the Pathology of Inflammation)
Siegert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1686



1688

Die gewollte Spaltung
(Deliberate division)
Gröbmüller, J.
Osteopathische Medizin, 2009/06


1690

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text

1691

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text

1692

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text

1693

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text

1694