Advanced search



 
 80.2% of the records
 
 19.8 % of the records
 
 57.9 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal hemodynamic maneuverabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabdominopelvic regionabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic detailingacademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute careacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute generalized exanthematous pustulosisacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadherenceadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadversityadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimers diseaseAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangiogramangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior scaleneanterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic enlargementaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial rulearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrographyarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical diabetesatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybicuspid aortic valvebifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanical responsebiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipartate patellabipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblackblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringblistersbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood oxygen saturationblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasebone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone metastasisbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachiocephalic vesselsbrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous emphysemabullous lesionsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcar accidentcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac apex anglecardiac arrestcardiac cirrhosiscardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabiliationcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCBTCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectionCECScecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular accidentcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic exertional compartment syndromechronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic orchialgiachronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccidioidomycosiscoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive latencycognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecold therapycold water exposurecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscolostomycomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconference registrationconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantscryotherapyCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademodex folliculitisdemographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentoalveolar systemdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic ketoacidosisdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary habitsdietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscolorationdiscontinued trialsdiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisembarkment syndromedisengagement-techniquedisinfectiondisinfection protocoldisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal kyphosisdorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug approvaldrug combinationdrug industrydrug legislationdrug prescriptionsdrug reactiondrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenal perforationduodenojejunal junctionduodenumdupilumabduplex scanningDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadysrhythmiadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaeczema herpeticumedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRejection fractionelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiogramselectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendoscopyendothelial dysfunctionendothelial functionendovascular retrievalenduranceendurance sportsenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophiliaeosinophilic fasciitiseosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal auditory canal exostosisexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubationextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyelidseyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfaceface masksfacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial neuropathyfacial painfacial paralysisfacial structurefacial swellingfacial tapingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfebrile neutrophilic dermatosisfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow rateflu testingfluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood attitudesfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenforamen magnumFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiant cell arteritisgiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonadal veingonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgoutgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegritgroingroin injurygroin paingroove signgross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth failuregrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaglund deformityhair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhand surgeryhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth motivationhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionalhealth professionalshealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemochromatosishemodialysishemodynamichemodynamic controlhemodynamicshemoglobinhemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehereditary spherocytosisHermansky-Pudlak syndromehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanicHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghorseshospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxemiahypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincident painincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury recoveryinjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinstrumentationinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview selectioninterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintimate partner violenceintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischemic strokeischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseisotretinoinITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. BockJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournal policyjournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansaskaposi varicelliform eruptionKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney diseasekidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage disorderslanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngeal cancerlaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTlead exposureleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukodermaleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelichen planus pigmentosus inversuslidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung cancerlung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmaltreatmentmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmaskmask mandatemasksMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMay-Thurner syndromeMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedical writingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetatarsophalangeal jointmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrosurgerymicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle scalenemiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal change diseaseminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymitral valve prolapsemix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonoclonal antibodiesmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular latencyneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnevus spilusnevus unius lateralisnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluonchocerciasisoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisonyxopen arteryopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen oval windowopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid usageopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan mobilityorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational behaviororganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic exerciseosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen supplyoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillary fibroelastomapapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepatent ductus arteriosuspatent foramen ovalepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatient-reported outcomespatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer recoverypeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceived weightperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferencepercutaneous coronary interventionperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericarditispericardiumperichondritisperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languageperson-first languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepolitical advocacypoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepositivismpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cortical atrophyposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprehabilitationprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature epiphyseal closurepremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbycusispresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional sportsprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurigo nodularisprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric distresspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary abscesspulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSpyoderma gangrenosumQ angleq-testQEEGqi gongqigongQLQ-C30qtc intervalquackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesracismradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrashrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreaction timereactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundrealismreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared blood cellsred flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulationsregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of liferiverboardingRL1-803rlq painRLSRobert Fulfordrobotic surgeryroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff intervalrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsscent detectionscent dogsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerodermasclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescrambler therapyscreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch interestsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-harmself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsseroprevalenceserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice dogsservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36SGLT2 inhibitorsshadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortageshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromeShulman syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin rashskin temperatureskin testsskin toneskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialtyspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatic cordspermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervespinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainsspringing techniquesprintsprintingSQOR-V questionnainnairesquamous cell carcinomasquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysterilizationsternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain injurystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous emphysemasubcutaneous hemorrhagesubjective cognitive declinesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital muscle inhibition techniquesuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden cardiac deathsudden infant death syndromeSudeck syndromeSufismsugarsuicidal ideationsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial heatsuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperior vena cava syndromesuperoxide anion radicalssupervised exercisesupervised injection sitessupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgSweets syndromeswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandswollen earsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic inertiatherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic surgerythoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthromboembolismthrombolytic therapythrombosisthrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocilizumabtocilizumab therapytocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatracheobronchial casttrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment algorithmstreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment tacticstreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrial qualitytrialstriamcinolone acetonidetriathletestribal healthcaretrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUgandaUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract diseaseurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccination statusvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvalvular heart diseasevancomycinvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular physiologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena cava filtervena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitamin deficienciesvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noisewhitewater kayakingWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework hourswork schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysxeroderma pigmentosumyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

1176 results (please see below)  Sort:    



4

From guidelines to practice: collective learning through clinical audit of the IFOMPT cervical framework
Bailey, D., Fawkes, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2026/03




8

Effect of osteopathic vs sham treatment and test-retest improvements on smooth pursuit eye movements
Wogue, R., Paire, A., Cornille, C., Pillevesse, I., Demoury, L., Gharmaoui, M., Paeye, C.
Complementary Therapies in Medicine, 2026/03

9

Clinical evolution of atypical pyoderma gangrenosum in a patient with hemochromatosis
Lo, N., Dazé, R.
Journal of Osteopathic Medicine, 2026/03
Free full text

10

Different letters, same results: a comparison of milestones among US allopathic and osteopathic residents
Langhan, M. L., Ngo, T. L., Yamazaki, K., Nesiama, J.A. O., Pence, L., Hogan, S. O.
Journal of Osteopathic Medicine, 2026/02
Free full text

11

Evaluating Laparoscopic Simulation Training for Preclinical Osteopathic Medical Students
Muchard, R. D., Jacobsen, N. D., Sypula, T., Longley, S., Hurrinus, N., Barefield, N. S., Patel, P. G.
Cureus, 2026/02
Free full text


13

Profiling Osteopathy in New Zealand: Insights into Practitioner Engagement with Accident Compensation Corporation (ACC) and Musculoskeletal (MSK) Care
Sampath, K. K., Berg, N., Paine, J. L., Orrock, P., Standen, C.
International Journal of Osteopathic Medicine, 2025/12

14

Nailing the diagnosis
Fang, M. M., Susla, L., Rich, P.
Journal of Osteopathic Medicine, 2025/12
Free full text

15

Utilizing Osteopathic Manipulative Technique to Alleviate Restriction at the Hip from the Tibio-Fibular Joint
Barros, M., Fotopoulos, T. J., Kochno, T., Bennett, A., Salehi, J., Tehrani, N.
Journal of Osteopathic Medicine, 2025/12



18

The Effect of Spencer Technique of the Shoulder on Glenohumeral Joint Range of Motion: A Comparison of Athletes and Non-Athletes
Oar, D. P., Zarilla, A., DiSilvestro, D., Buchman, Z. J., Abouafech, A., Boesler, D.
Journal of Osteopathic Medicine, 2025/12


20

A swell case
Fill, L., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2025/11
Free full text

21

Assessing fundamental clinical skills of osteopathic medical students
Boulet, J. R., Sandella, J. M., Gimpel, J., LaBaere, R.
Journal of Osteopathic Medicine, 2025/10
Free full text

22

Evaluation of Craniosacral Therapy Effects on Brain Wave Patterns in Children with Mild Autism Spectrum Disorder Using the QEEG Method
Kopańska, M., Szczygielski, J., Batrman, P., Banaś-Ząbczyk, A.
Acta Neuropsychologica, 2025/10
Free full text

23

Painful and exophytic tumor on the thigh
Fang, M. M., White, K. P., Ortega-Loayza, A. G.
Journal of Osteopathic Medicine, 2025/10
Free full text

24

Cutaneous manifestations of Addison’s disease
Lu, C., Jacobs, D., Blannett, S., Kuryan, R. E., Swink, S. M.
Journal of Osteopathic Medicine, 2025/10
Free full text

25

Seatbelt sign
Nichols, E., Daniel, A., Ganti, L., Wallen, M.
Journal of Osteopathic Medicine, 2025/10
Free full text

26

Preceptor-Ranked Competencies in Osteopathic Medical Students: A Comparison of General Surgery and Surgical Subspecialties
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Garg, R., Thacker, R. R., Roach, S. L.
Cureus, 2025/10
Free full text

27

Why don't more physicians use osteopathic manipulative medicine? A cross-sectional study of utilization and referral barriers
Stacey, S. K., Furlano, A., Genewick, J., Westfall, E., Gordon, B., Toor, J.
Journal of Osteopathic Medicine, 2025/09
Free full text


29

Effect of the Spencer Technique on Glenohumeral Joint Range of Motion: A Comparative Analysis of Athletes Versus Non-athletes
Oar, D. P., Zarilla, A., DiSilvestro, D., Buchman, Z. J., Abouafech, A., Boesler, D.
Cureus, 2025/09
Free full text

30

Attitudes, Beliefs, and Values of Italian Osteopaths Toward the Management of Patients With Tension-Type Headache: A Categorical Content Analysis
Iacopini, A., Esteves, J. E., Consorti, G., Lunghi, C., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2025/09

31

Erythromelalgia: a cutaneous manifestation of polycythemia vera
Saad, M., Dazé, R.
Journal of Osteopathic Medicine, 2025/09
Free full text

32

TIF1-gamma associated dermatomyositis with extensive cutaneous involvement
Geric, K. M., Khan, H. S., Dazé, R.
Journal of Osteopathic Medicine, 2025/09
Free full text

33

Profiling Osteopathy in New Zealand: Insights into Practitioner Engagement with Accident Compensation Corporation (ACC) and Musculoskeletal (MSK) Care
Kovanur Sampath, K., Berg, N., Paine, J. L., Orrock, P., Standen, C.
International Journal of Osteopathic Medicine, 2025/09




37

The effect of osteopathic manipulative treatment on length of stay and pain relief in pediatric appendectomy: a pilot non-randomized time-controlled clinical trial
Lo Piccolo, R., Cantagalli, M. M., Ferroni, T., Fracchiolla, F., Morabito, A.
Frontiers in Pediatrics, 2025/08
Free full text

38

Clinical Reasoning and Practices in the Osteopathic Management of Visceral Disorders: A Grounded Theory Study in the Italian Context
Camonico, T., Lippi, F., Rizzo, N., Barusso, A., Rossettini, G., Villafañe, J. H., Cerritelli, F., Papa, L., Esteves, J. E.
Healthcare, 2025/08
Free full text


40

Pityriasis lichenoides chronica presenting in skin of color
Cook, B., Bindernagel, R., Dazé, R., Miller, R.
Journal of Osteopathic Medicine, 2025/07
Free full text

41

Impact of a clinician-directed educational program on communicating with patients regarding gun violence at two community urban healthcare centers
Langenau, E., Kaminsky, A. M., Roberts, M. B.
Journal of Osteopathic Medicine, 2025/07
Free full text

42

Exploring the Characteristics and Competencies of Successful Osteopathic Medical Students on General Surgery Clerkship
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Thacker, R. R., Roach, S. L.
Cureus, 2025/07
Free full text

43

Development of a national osteopathic Practice-Based Research Network (PBRN): the NCOR Research Network
Draper-Rodi, J., Fawkes, C., Bailey, D.
Scientific Reports, 2025/07
Free full text

44

Improving vascular access knowledge and assessment skill of hemodialysis staff
Smith, K., Ayars, C.
Journal of Osteopathic Medicine, 2025/06
Free full text


46

The effect of osteopathic manipulative treatment on chronic rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kalkat, A., Hammes, C., Kohli, E., Callahan, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2025/06
Free full text

47

Osteopathic practitioner´s considerations on infertility treatment
Triay Salamanca, S.
Unpublished MSc thesis, 2025/06
Free full text

48

Advancing Equitable Osteopathic Practice: Integrating Person-Centredness & Addressing Racial Biases Through the Lens of Critical Theory
Mhadhbi, H., MacMillan, A., Draper-Rodi, J., Ménard, M., Sinderholm Sposato, N.
International Journal of Osteopathic Medicine, 2025/03

49

A national survey of osteopaths' conceptions of practice in France: structural validity of the Osteo-TAQfr and the tendency toward technical rationality
Thomson, O. P., Treffel, L., Wagner, A., Jacquot, E., Draper-Rodi, J., Morin, C., Vaughan, B.
BMC Health Services Research, 2025/03

50

Comparing cranial suture interdigitation in humans and non-human primates: unearthing links to osteopathic cranial concept
Blumer, J., Arney, I., Hardin, A., Nichols, M., Arsenault, L., Petrucci, J.
Journal of Osteopathic Medicine, 2025/02
Free full text

51

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text

52

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text


54

The value of the osteopathic approach in supporting women suffering from endometriosis
Metzmacker, P., Bengoetxea, A., Mellier, J.
European Journal of Pain, 2025 Nov 01 2025–11–21
Free full text

55

The Effect of Osteopathic Manipulative Treatment in Chronic Rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kallat, A., Callahan, M., Kohli, E., Hammes, C., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/12


57

Third-year medical students' perceptions of confidence and readiness to perform EFAST after training
Rocic, P., Garrison, R., Stitle, K., Reynolds, A., Andrews-Dickert, R.
BMC Medical Education, 2024/12
Free full text

58

Osteopathie in der Rehabilitation von Patienten mit rezidivierenden muskuloskeletalen Verletzungen: eine experimentelle Studie
(Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study)
Sankova, M. V., Nikolenko, V. N., Vovkogon, A. D., Oganesyan, M. V., Trishina, A., Babarzai, L., Antonyan, S. Z., Babarzai, F., Pontes-Silva, A., Zharikov, Y. O.
Manuelle Medizin, 2024/11

59

Davener’s dermatosis: a unique presentation of frictional hypermelanosis
Kowalski, A., Dazé, R.
Journal of Osteopathic Medicine, 2024/10
Free full text

60

Evaluating the Impact of Direct, Direct Video, and Indirect Video Laryngoscopy Training on the Proficiency of Medical Students in Performing Direct Laryngoscopy: A High-Fidelity Manikin-Based Assessment
Moriarty, S. E., Perera, I. R., Sabbagh, M., Yeckley, M., Carpio, P., Hoodfar, A., LePera, A., Anandakrishnan, R., Daniels, T., Martin, R., Looney, J., Gittings, K., Edwards, W., Rawlins, F.
Cureus, 2024/10
Free full text

61

Perceived benefits and limitations of game-based simulation education by osteopathy students in early clinical training: A preliminary mixed methods study
Mhadhbi, H., Horta, L. M., Ims, J., Draper-Rodi, J., Mansfield, H., Shaw, R., Rinne, S., Cleland Silva, T., Metsälä, E., Ménard, M.
International Journal of Osteopathic Medicine, 2024/09




65

Effects of Osteopathic Manipulative Treatment (OMT) on Lower Extremity Muscle Characteristics in Parkinson's disease (PD) Patients
Radigan, R., Finkelstein, A., Mehra, M., Bhushan, P., Lombardo, T., Yao, S.
Movement Disorders, 2024/09

66

Professional skill priorities: Comparison views of osteopathy industry professionals and osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2024/09
Free full text

67

A masquerading presentation of dermatofibrosarcoma protuberans
Berg, E., Khan, N., Dazé, R.
Journal of Osteopathic Medicine, 2024/07
Free full text

68

Leitlinien in der Osteopathie: Pro und Kontra
(Guidelines in osteopathy: Pros and cons)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07

69

Leitlinien in der Osteopathie: Pro und Kontra
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07

70

Tumid lupus masquerading as rosacea
Ambur, A. B., Khalid, M., Ambur, A. B., Kaya, K., Nathoo, R.
Journal of Osteopathic Medicine, 2024/06
Free full text


72

Calciphylaxis
Salupo, N., Norris, M., Taliercio, J. J.
Journal of Osteopathic Medicine, 2024/05
Free full text


74

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text

75

The myofascial release as neuromotor support to improve the ineffective sucking ability in term infants: a preliminary study
Arcusio, A., Villa, M. C., Felloni, F., Migliori, C.
Italian Journal of Pediatrics, 2024/04
Free full text

76

The 7 Elements Communication Rating Form for Teaching and Assessing Medical Communication Competency
Wise, C. M., Lovett, G. D., Swarm, G. M., Nazar, A.
Cureus, 2024/04
Free full text



79

The inter- and intra-rater reliability of the manual diaphragm assessment scale in healthy participants
Viegas, I., Francisco, C., Farinha, E., Nunes, A.
International Journal of Osteopathic Medicine, 2024/03


81

Green nail syndrome in a teenager
Perz, C., Swink, S. M., Khurana, M.
Journal of Osteopathic Medicine, 2024/03
Free full text

82

A tailored training based on students’ and teachers’ needs to improve palpation skills: A quantitative part of a mixed-method study
Lavazza, C., Zangoni, G., Sozzi, F., Abenavoli, A., Barenghi, M.
International Journal of Osteopathic Medicine, 2024/03

83

Is Craniosacral Therapy Effective? A Systematic Review and Meta-Analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Cabanillas-Barea, S., Esteban-Pérez, J., Jiménez-del-Barrio, S.
Healthcare, 2024/03
Free full text

84

Effects of osteopathic manipulative treatment on maternal-fetal hemodynamics in third trimester pregnant women: A prospective study
Arruda Correia, M. L., Peixoto Filho, F. M., Gomes Júnior, S. C., de Jesus, G. R.
PLoS One, 2024/03
Free full text


86

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text


88

Raynaud’s phenomenon
Humpel, O., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/01
Free full text

89

Delayed discovery: the COVID-19 pandemic’s influence on osteoarthritis clinical trials
Sajjadi, N. B., Anderson, J. M., Hughes, G. K., Abraham, C. E., Malik, J., Hartwell, M., Vassar, M.
Journal of Osteopathic Medicine, 2024/01
Free full text



92

(Gender competence in medicine and osteopathy)
Wikus, P., Wimpissinger, A.
Osteopathische Medizin, 2023/12

93

Construct validity and reliability of a test for sacroiliac dysfunction: Downing test
Ribeiro, R. P., Guerrero, F. G., Camargo, E. N., Pivotto, L. R., Aimi, M. A., Candotti, C. T., Loss, J. F.
International Journal of Osteopathic Medicine, 2023/12


95

Preliminary Evaluation of an Osteopathic Manipulative Treatment to Prevent Motion Sickness
Thomas, V. A., Kelley, A. M., Lee, A., Fotopoulos, T., Boggs, J., Campbell, J.
Aerospace Medicine and Human Performance, 2023/12

96

Lichen planus pigmentosus inversus: a rare clinical variant
Obeng-Nyarko, C. N., Dazé, R., Dorton, D.
Journal of Osteopathic Medicine, 2023/12
Free full text

97

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/12
Free full text

98

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12

99

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12

100

Quantifying the Effect of Thoracic Myofascial Release on Muscle Tone, Stiffness, and Elasticity
Spicer, S. J., Averell, N., Gawash, A., Goodwin, B., Mahmud, R., St. John, R., Lo, D., King, A.
Journal of Osteopathic Medicine, 2023/12


102

Emerging treatment of prurigo nodularis with dupilumab
Humpel, O., Fill, L., Hostoffer, R.
Journal of Osteopathic Medicine, 2023/11
Free full text

103

Acute generalized exanthematous pustulosis with systemic involvement
Alazawi, S.
Journal of Osteopathic Medicine, 2023/10
Free full text

104

Effects of a focused training on first-year osteopathic medical students' ability to incorporate point-of-care ultrasound in assessment of the anterior knee
Weaver, C., Heath, D. M., Makin, I. R. S., Hanamaika'i, K., Kanumalla, R., Matsushita, S., Chatta, P., Adhikari, S.
Journal of Osteopathic Medicine, 2023/10
Free full text


106

Quantitative ultrasound to assess efficacy of treatment for neck somatic dysfunctions: a feasibility study
Tran, A., Ngo, T., Roberts, T., Ko, E., Holmgren, J. G., Edwards, C., Coleman, M., Gao, J.
Journal of Osteopathic Medicine, 2023/09
Free full text

107

Drug reaction with eosinophilia and systemic symptoms (DRESS) syndrome
Cho, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2023/09
Free full text

108


109

The Effectiveness of a Mobile Health Clinic Delivering Mandatory and Elective Middle School Immunizations: A Descriptive Analysis
LaGattuta, N. R., Wilson, T. C., Failla, J. A., Stoner, A. M., Fradua, K., Brown, J., Byrd, S. C., Wilson, A., Jones, D., Carroll, L.
Cureus, 2023/09
Free full text

110

Associations of clinical personnel characteristics and controlled substance prescribing practices
Millhollon, R., Elenwo, C., Lundberg, A., Roberts, W., Beaman, J., Bray, N., Hartwell, M.
Journal of Osteopathic Medicine, 2023/09
Free full text

111

Rotator cuff injuries: improving identification with bedside ultrasound
McGillicuddy, C., Haus, D.
Journal of Osteopathic Medicine, 2023/08
Free full text

112

Superior-medial pole of the bipartate patella
Tu, P. Y., Huang, C. H., Chou, P. P.
Journal of Osteopathic Medicine, 2023/08
Free full text

113

Surgical simulation in osteopathic medical schools
Seely, K. D., Hansen, M., Paluri, S. N., Rasmussen, K., Carter, S., Nigh, A.
Journal of Osteopathic Medicine, 2023/07
Free full text

114

Modifying functional brain networks in focal epilepsy by manual visceral-osteopathic stimulation of the vagus nerve at the abdomen
Lehnertz, H., Broehl, T., Rings, T., von Wrede, R., Lehnertz, K.
Frontiers in Network Physiology, 2023/07
Free full text

115

Haglund deformity of the posterior heel
Pargeon, M., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2023/07
Free full text

116

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text

117

Effect of Objective Training Programs on Symmetry and Accuracy of Passive Motion Force Application
Hajicek, J., Huhn, M., Starks, Z., Wang, Y.F., Degenhardt, B.
The AAO Journal, 2023/06
Free full text

118

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
Free full text



121

Somatic Dysfunction. Clinical Guidelines 2023
(Соматическая дисфункция. Клинические рекомендации 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
Free full text


123

Rosacea with pustules and papules
Saab, R., Hostoffer, R.
Journal of Osteopathic Medicine, 2023/06
Free full text

124

Assessing Clinical Reasoning in Medical Students Using a Virtual Patient Simulator
Abdulnour, R., O'Rourke, M., Smith, T.
Diagnosis, 2023/05

125

Virtual Deliberate Practice: Assessing Clinical Reasoning Using an Illness Script-based Simulator
Abdulnour, R. E., Furfaro, D., Sternschein, R., Smith, T. M., Drazen, J. M.
American Journal of Respiratory and Critical Care Medicine, 2023/05

126

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05


128

Superficial spreading melanoma within a nevus spilus
Racanelli, J., Moloney, M., Siegel, L.
Journal of Osteopathic Medicine, 2023/04
Free full text

129

Validation of subjective manual palpation using objective physiological recordings of the cranial rhythmic impulse during osteopathic manipulative intervention
Pelz, H., Müller, G., Keller, M., Mathiak, K., Mayer, J., Borik, S., Perlitz, V.
Scientific Reports, 2023/04
Free full text


131

Right Shoulder Deformity: Clavicle Fracture
Pargeon, M., Tjiattas-Saleski, L.
Osteopathic Family Physician, 2023/03



134

Annular bullous lesions in a child from Uganda: chronic bullous disease of childhood
Ambur, A. B., Nyckowski, T. A., Bhukhan, A.
Journal of Osteopathic Medicine, 2023/03
Free full text









143

Isolated nevus unius lateralis in a patient from Uganda
Ambur, A. B., Nyckowski, T. A.
Journal of Osteopathic Medicine, 2023/02
Free full text

144

Perichondritis: a case of swollen ear
Mordach, V., Little, A.
Journal of Osteopathic Medicine, 2023/02
Free full text

145

Reconceptualizing Somatic Dysfunction in the Light of a Neuroaesthetic Enactive Paradigm
Consorti, G., Castagna, C., Tramontano, M., Longobardi, M., Castagna, P., Di Lernia, D., Lunghi, C.
Healthcare, 2023/02
Free full text

146

Leukoderma with perifollicular sparing: a diagnostic clue of cutaneous onchocerciasis
Ambur, A. B., Nyckowski, T. A.
Journal of Osteopathic Medicine, 2023/01
Free full text

147

Posterior cortical atrophy
Parasram, M., Roytman, M., Lee, A., Ivanidze, J.
Journal of Osteopathic Medicine, 2023/01
Free full text

148

Dynamic touch induces autonomic changes in preterm infants as measured by changes in heart rate variability
Manzotti, A., Cerritelli, F., Monzani, E., Savioli, L., Esteves, J. E., Lista, G., Lombardi, E., Rocca, S. L., Biasi, P., Galli, M., Chiera, M., McGlone, F. P.
Brain Research, 2023/01

149

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12

150

Subcutaneous Sweet's syndrome: a rare subtype of acute febrile neutrophilic dermatosis
Ambur, A. B., Nyckowski, T. A.
Journal of Osteopathic Medicine, 2022/12
Free full text

151

The groove sign
Cook, S. G., Bartholomew, A. J.
Journal of Osteopathic Medicine, 2022/12
Free full text

152

Acute pericarditis confirmed by coronary computed tomography angiogram
Prasad, R. M., Hanson, C. A.
Journal of Osteopathic Medicine, 2022/12
Free full text






158

Evaluation of Osteopathic Principles in Cadaveric Specimens Using Radiological Assessment
Siddiqi, I., Wang, A., Marino, M., Bowen, I., Miulli, D. E.
Cureus, 2022/12
Free full text

159

The Effects of Upper Trapezius Muscle Energy Technique on Pain, Muscle Tension, and Cervical Range of Motion Using the MyotonPRO
Clark, L., Joshi, J., Khalid, A., Jose, R., Furmann, M., Syed, F., Jung, M.K., Yao, S. C., Noto, P.
Journal of Osteopathic Medicine, 2022/12

160

An exploration of the clinical reasoning used by registered osteopaths in their choice of therapeutic approach
Clifford, A., Segal, A., Guterres, A., Orrock, P. J.
International Journal of Osteopathic Medicine, 2022/12

161

Hermansky-Pudlak syndrome
Ambur, A. B., Nyckowski, T. A.
Journal of Osteopathic Medicine, 2022/11
Free full text

162

Recurrent bronchiolitis and stridor in an infant
Byrne, A., Tung, P.
Journal of Osteopathic Medicine, 2022/10
Free full text

163

Xeroderma pigmentosum presenting in two siblings from Uganda
Ambur, A. B., Nyckowski, T. A.
Journal of Osteopathic Medicine, 2022/09
Free full text

164

Effectiveness of Mulligan's Two-Leg Rotation Versus Muscle Energy Technique in Subjects With Hamstring Tightness
Jaiswal, P. R., Qureshi, I., Phansopkar, P. A.
Cureus, 2022/09
Free full text

165

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text




169

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/09

170

Exploring lumbo-pelvic functional behaviour patterns during osteopathic motion tests: A biomechanical (en)active inference approach to movement analysis
Ménard, M., Couvertier, M., Awai, L., Esteves, J. E., Bideau, B., Vaucher, P.
International Journal of Osteopathic Medicine, 2022/09

171

Effect of MET training on pain and activities of daily living in COPD patients
Mihçioǧlu, S., Malkoç, M., Özalevli, S., Tüzün, E. H., Yatar, I.
European Respiratory Journal, 2022/09

172

Intraoperative appearance of gonadal vein embolization coil
Griebel, L., Knuttinen, G., Wasson, M.
Journal of Osteopathic Medicine, 2022/08
Free full text

173

Investigating the safety and feasibility of osteopathic medicine in the pediatric oncology outpatient setting
Belsky, J. A., Stanek, J. R., Rose, M. J.
Journal of Osteopathic Medicine, 2022/08
Free full text

174

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text

175

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07


177

4 M's to make sense of evidence – Avoiding the propagation of mistakes, misinterpretation, misrepresentation and misinformation
Draper-Rodi, J., Vaucher, P., Hohenschurz-Schmidt, D., Morin, C., Thomson, O. P.
International Journal of Osteopathic Medicine, 2022/06

178

Does the inter-osseous membrane fascial dysfunction exist ? An observational study comparing palpation to ultrasound measurements
Lecardonnel, T., Salmon, M., Merdy, O., Sarzeaud, R., Matthew, T.
International Journal of Osteopathic Medicine, 2022/06

179

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text

180

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

181

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

182

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text


184

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/05

185

Effects of Muscle Energy Technique versus Bruegger's Relief Exercise on the Forward Head Posture among electronic gadget users - A Pilot study
Dalawar, A., Afzal, H., Dalawar, I., Murtaza, A., Ghafoor, A., Fiaz, S.
Pakistan Journal of Medical and Health Sciences, 2022/05
Free full text

186


187

Osteopathic student training on preventing domestic violence
Downing-Larick, C., Moore, M., Dreher, M., Stoner, A., Fadel, N., Cheng, N.
Osteopathic Family Physician, 2022/05
Free full text

188

The Effect of Clinical Anatomy Integration on Medical Student Academic Performance and Learning Approach
Stoudemire, Claire, Terrell, Mark, McCarthy, Sarah, Gulati, Raj, Fonner, Christopher, Kulesza, Randy
FASEB journal, 2022/05
Free full text




192

Comparative assessment of osteopathy technique with manual therapy associated with biofeedback in patients with the lumbar spine pain.
Mańko, G., Jekiełek, M., Sosulska, A., Pieniążek, M., Jaszczur-Nowicki, J.
Medical Rehabilitation, 2022/04
Free full text

193

Demodex folliculitis: a masquerading entity
Guraya, A., Dazé, R., Chavda, K.
Journal of Osteopathic Medicine, 2022/03
Free full text




197

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03

198

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text


200

Tracheobronchial cast
Offerman, E., Mahon, S., Golden, B. M.
Journal of Osteopathic Medicine, 2022/02
Free full text

201

Primary care providers' experiences treating low back pain
Al Sad, S., Start, A. R.
Journal of Osteopathic Medicine, 2022/02
Free full text


203

Neurogenic Bowel Dysfunction Changes after Osteopathic Care in Individuals with Spinal Cord Injuries: A Preliminary Randomized Controlled Trial
Tamburella, F., Princi, A. A., Piermaria, J., Lorusso, M., Scivoletto, G., Masciullo, M., Cardilli, G., Argentieri, P., Tramontano, M.
Healthcare, 2022/01
Free full text

204

Cranial manipulation affects cholinergic pathway gene expression in aged rats
Anandakrishnan, R., Tobey, H., Nguyen, S., Sandoval, O., Klein, B. G., Costa, B. M.
Journal of Osteopathic Medicine, 2022/01
Free full text

205

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05

206

Erratum to “The legacy and implications of the body-mind-spirit osteopathic tenet: A discussion paper evaluating its clinical relevance in contemporary osteopathic care” [Int J Osteopath Med 41 (2021) 57–65]
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/12
Free full text

207

Parkinson's Disease Medication Administration During a Care Transition: The Impact of Interprofessional Team Simulation on Student Competency, Comfort, and Knowledge
Ellis, D. M., Hickey, S., Prieto, P., McLaughlin, C., Felgoise, S. H., Becker, M., O'Connor, M., Puleo, M., Reddy, T., Markey, D., Kim, L., Bernhardt, P. W.
Nursing Education Perspectives, 2021/12

208

Adaptation and validation of the SEGUE checklist to assess osteopathy students' clinical communication skills
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2021/12

209

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12

210

Disseminated peritoneal coccidioidomycosis
Villafuerte, D. B.
Journal of Osteopathic Medicine, 2021/12








218

The Effect of Counterstrain Technique on Muscle Stiffness and Pain on Trapezius Tender Points in Medical Students
Liang, R., Wong, S., Song, K., Clark, L., Joshi, J., Khalid, A., Jung, M.K., Yao, S. C., Noto, P.
Journal of Osteopathic Medicine, 2021/12

219

Assessing usage and perceptions of osteopathic manipulative treatment (OMT) and self-identity among osteopathic physicians
Mangla, M., Asif, S., Asif, S., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

220

Improving Upon Osteopathic Palpatory Skills using a 3D Printed Rotational Lumbar Spine Model
Rey, T., Thomas, A., Nolin, J., Sanders, J. G., Cedoz, K., Berwick, R.
Journal of Osteopathic Medicine, 2021/12

221

Effects of Compression of the 4th Ventricle (CV4) Treatment on Medical Student Anxiety
Goering, E., Herner, M., Smith, M., Galka, M., Kammerzell, S., Best, K., Anderson, P., Steinauer, M.
The AAO Journal, 2021/12
Free full text

222

Epiglottic squamous cell carcinoma
Carter, J., Ball, J., McKean, G., Patel, S.
Journal of Osteopathic Medicine, 2021/11
Free full text

223

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11

224

Kaposi varicelliform eruption in a patient with atopic dermatitis
Dazé, R., Canales, J., Ross, R.
Journal of Osteopathic Medicine, 2021/10
Free full text

225

Evaluating for a correlation between osteopathic examination and ultrasonography on thoracic spine asymmetry
Chang, S., Maddox, J., Berg, E., Kim, K., Messier, S., Swanson, L., Dobrusin, R., Stein, A. B., Nakken, G. N., Noble, J., Nydam, R.
Journal of Osteopathic Medicine, 2021/10
Free full text



228

Osteopathic Treatment and Evaluation in the Clinical Setting of Childhood Hematological Malignancies
Barbieri, M., Zardo, W., Frittoli, C., Rivolta, C., Valdata, V., Bouquin, F., Passignani, G., Maggiani, A., Jankovic, M., Cossio, A., Biondi, A., Balduzzi, A., Lanfranconi, F.
Cancers, 2021/10
Free full text


230

Scimitar syndrome
Dennehy, W., Neverman, E. M.
Journal of Osteopathic Medicine, 2021/09
Free full text

231

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09




235

Multiple thrombotic events in a patient with coronavirus 2019
Shah, V., Meng, S., Vest, M.
Journal of Osteopathic Medicine, 2021/08
Free full text



238

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07

239

Orange palpebral spots
Blannett, S., Swink, S. M., Purcell, S. M.
Journal of Osteopathic Medicine, 2021/07
Free full text




243

Efficacy of implementing intermittent STOP THE BLEED® reviews on long term retention of hemorrhage control skills of first year medical students
Sainbayar, E., Holt, N., Jacobson, A., Bhatia, S., Weaver, C.
Journal of Osteopathic Medicine, 2021/06
Free full text

244

Efficacy of Stretching vs Muscle Energy Technique in Postoperative Elbow Stiffness: A Research Protocol
Shende, G., Deshmukh, M. P., Jain, D. K., Phansopkar, P.
Indian Journal of Forensic Medicine and Toxicology, 2021/06

245

Polyarticular, ulcerated tophaceous gout
Borelli, C. M., Doherty, B. T.
Journal of Osteopathic Medicine, 2021/06
Free full text

246

‘Don’t focus on the finger, look at the moon’ - The importance of contextual factors for clinical practice and research
Thomson, O. P., Rossettini, G.
International Journal of Osteopathic Medicine, 2021/06
Free full text


248

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text

249

May-Thurner syndrome with left iliofemoral deep venous thrombosis
Ellis, N. C., McCarthy, M. T., Nikolla, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

250

Acute fracture of extensive Achilles tendon calcific tendinopathy
Sullivan, D., Thurston, M.
Journal of Osteopathic Medicine, 2021/05
Free full text

251

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

252

Obstructed defecation syndrome associated with paradoxical puborectalis contraction: osteopathic treatment versus anal biofeedback. Results of a pilot study
Ascanelli, S., Portinari, M., Canella, M., Solari, S., Dall&rsquo, Omo, F., Danese, S., De Troia, A., Carcoforo, P.
Techniques in Coloproctology, 2021/05

253

Giant cell arteritis of the uterus
Adeyemi, O. A., Backous, C. A.
Journal of Osteopathic Medicine, 2021/04
Free full text

254

Animal-derived medications: cultural considerations and available alternatives
Babos, M. B., Perry, J. D., Reed, S. A., Bugariu, S., Hill-Norby, S., Allen, M. J., Corwell, T. K., Funck, J. E., Kabir, K. F., Sullivan, K. A., Watson, A. L., Wethington, K. K.
Journal of Osteopathic Medicine, 2021/04
Free full text


256

Using contact-based education to destigmatize opioid use disorder among medical students
Mort, S. C., Díaz, S. R., Beverly, E. A.
Teaching and Learning in Medicine, 2021/04

257

Actions Speak Louder Than Words: Exploring Pragmatism in Osteopathy
Macfarlane, C.
Unpublished PhD thesis, 2021/03
Free full text

258

Papillary fibroelastoma: an unexpected finding on the aortic valve
Chahin, M., Zoltowska, D., Roemer, A., Alkhasawneh, A., Percy, R.
Journal of Osteopathic Medicine, 2021/03
Free full text

259

The Philadelphia surgery conference: a value analysis of a hands-on surgical skill-building event
DiPasquale, L., Libera, R., Do-Nguyen, C. C., Brehman, E., Tatagari, V., Waring, H., Appelt, D., Sesso, A.
Journal of Osteopathic Medicine, 2021/03
Free full text

260

An analysis of research quality underlying IDSA clinical practice guidelines: a cross-sectional study
Greiner, B., Essex, R., Wheeler, D.
Journal of Osteopathic Medicine, 2021/03
Free full text

261

Moderate to Substantial Inter-Rater Reliability in the Assessment of Cranial Bone Mobility Restrictions
Demers, K., Morin, C., Collette, L., DeMont, R.
The Journal of Alternative and Complementary Medicine, 2021/03

262

Superior vena cava syndrome from extensive lung cancer
Prasad, R., Kemnic, T.
Journal of Osteopathic Medicine, 2021/03
Free full text

263

Objectivation of an Educational Model in Cranial Osteopathy Based on Experience
Requena-García, J., García-Nieto, E., Varillas-Delgado, D.
Medicina (Kaunas), 2021/03

264

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text

265

Evaluating disease outbreaks with syndromic surveillance using medical student clinical rotation patient encounter logs
Bruzda, G., Rawlins, F., Sumpter, C., Garner, H. R.
Journal of Osteopathic Medicine, 2021/02
Free full text


267

Pediatric Osteopathic Manipulative Medicine: A Scoping Review
DeMarsh, S., Huntzinger, A., Gehred, A., Stanek, J. R., Kemper, K. J., Belsky, J. A.
Pediatrics, 2021/02

268

Retained colon in the subcutaneous fat after colostomy reversal
Arndts, M. K.
Journal of Osteopathic Medicine, 2021/02
Free full text

269

The role of touch in osteopathic practice: A narrative review and integrative hypothesis
Baroni, F., Ruffini, N., D'Alessandro, G., Consorti, G., Lunghi, C.
Complementary Therapies in Clinical Practice, 2021/02

270

Gonococcal arthritis
Mills, K., Jadav, P.
Journal of Osteopathic Medicine, 2021/02
Free full text

271

Gut Microbiome Changes with Osteopathic Treatment of Constipation in Parkinson's Disease: A Pilot Study
Mancini, J. D., Yao, S., Martinez, L. R., Shakil, H., Li, T. S.
Neurology (ECronicon), 2021/01
Free full text

272

Adherence to the RIGHT statement in Society of Interventional Radiology guidelines
Khattab, M., Howard, B., Al-Rifai, S., Torgerson, T., Vassar, M.
Journal of Osteopathic Medicine, 2021/01
Free full text

273

Pilot study assessing the effect of osteopathic manipulative treatment (OMT) on length of stay in neonates after therapeutic hypothermia
Bendixen, K., Beinlich, A., Beck, B., Hashmi, N., Craig, A.
Journal of Osteopathic Medicine, 2021/01

274

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text

275

Effects of Craniosacral Osteopathy in Patients with Peripheral Vestibular Pathology
Atay, F., Bayramlar, K., Sarac, E. T.
ORL - Journal for Oto-Rhino-Laryngology and its Related Specialties, 2021/01

276

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text

277

An Evaluation of Reporting Guidelines and Clinical Trial Registry Requirements Among Addiction Medicine Journals
Cooper, C. M., Gray, H., Barcenas, L., Torgerson, T., Checketts, J. X., Vassar, M.
The Journal of the American Osteopathic Association, 2020/12
Free full text

278

Sister Mary Joseph Nodule
Desai, P., Yamani, N.
The Journal of the American Osteopathic Association, 2020/12
Free full text


280

Efficacy of Muscle Energy Technique and Myofascial Release in Nonspecific Low Back Pain—A Comparative Study
Das, A., Bhattacharya, U., Chauhan, V.
Alternative and Complementary Therapies, 2020/12

281

Septic Pulmonary Emboli With Feeding Vessel Sign
Kemnic, T., Prasad, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text

282

Effects of the COVID-19 Pandemic on Osteopathic Medical Students’ Screen Time
Edimo, C. O., Espares, J. K., Falus, N. A., Bupathi, S. K., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12

283

Prevalence of Computer Vision Syndrome (CVS) Symptoms on Osteopathic Medical Students
Espares, J. K., Edimo, C. O., Bupathi, S. K., Falus, N. A., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12


285

Acute Suppurative Thyroiditis
Desai, P., Mbachi, C., Singh, A.
The Journal of the American Osteopathic Association, 2020/11
Free full text

286

Ultrasonography to Assess the Efficacy of Osteopathic Manipulative Treatment for Lumbar Spine Asymmetry
Winter, J., Kimber, A., Montenegro, S., Gao, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text



289

Recurrent Condylomata Acuminata in a Transplant Patient
Delara, R., Chen, L., Young-Fadok, T., Wasson, M.
The Journal of the American Osteopathic Association, 2020/10
Free full text

290

“I do it my way” - Italian osteopaths’ beliefs and attitudes about five osteopathic models: A qualitative study
Bettelli, L., Pisa, V., Formica, A.
International Journal of Osteopathic Medicine, 2020/10

291

Cerebral tissue oxygenation during cranial osteopathic CV4 procedure in newborns
Malak, R., Kozłowska, Z., Owsiańska, Z., Sikorska, D., Andrusiewicz, M., Szymankiewicz-Bręborowicz, M., Samborski, W., Szczapa, T.
Advances in Clinical and Experimental Medicine, 2020/10
Free full text


293

A Pilot Study of Jugular Compression (Queckenstedt maneuver) for Cranial Movement Perception
Abenavoli, A., Pisa, S., Maggiani, A.
The Journal of the American Osteopathic Association, 2020/10

294

Dysphagia Lusoria
Andersen, K., Hoff, R., Silas, D.
The Journal of the American Osteopathic Association, 2020/10
Free full text


296

Evaluation of “Spin“ in the Abstracts of Randomized Controlled Trial Reports in Cardiology
Roberts, W. B., Cooper, C. M., Khattab, M., Neff, P., Wildes, D., Wayant, C., Vassar, M.
The Journal of the American Osteopathic Association, 2020/09
Free full text

297

Cranial Strain Patterns Associated With Concussions
Schwartzberg, L., Aslanyan, L., Angelo, N., Mancini, J., Kooyman, P. S., Abu-Sbaih, R., Zwibel, H., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/09
Free full text

298

The development and exploratory analysis of the Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ)
Thomson, O. P., Anstiss, V.
International Journal of Osteopathic Medicine, 2020/09

299

Portable Ultrasonography to Assess Adult Hepatosteatosis in Rural Ecuador
Joutovsky, B., Ortiz, A., Bentley, C., Gao, J.
The Journal of the American Osteopathic Association, 2020/09
Free full text

300

Aquatic Osteopathy Treatment Assessment by Infrared Thermography on Healthy Subjects After Thermoneutral Water Immersion
Maxel, X., Girollet, F., Stubbe, L., Boudot, E., Darraillans, L., Bodnar, J. L.
Journal of Chiropractic Medicine, 2020/09
Free full text


302

Mindfulness-Based Stress Reduction in the Management of Chronic Pain and Its Comorbid Depression
Marske, C., Shah, S., Chavira, A., Hedberg, C., Fullmer, R., Clark, C. J., Pipitone, O., Kaiser, P.
The Journal of the American Osteopathic Association, 2020/09
Free full text


304

Undifferentiated Pleomorphic Sarcoma
Ferry, M. J., Lewis, T.
The Journal of the American Osteopathic Association, 2020/08

305

Ultrasound Shear Wave Elastography to Assess Tissue Mechanical Properties in Somatic Dysfunction: A Feasibility Study
Gao, J., Caldwell, J., Wells, M., Park, D.
The Journal of the American Osteopathic Association, 2020/08
Free full text

306

Effect of Hydration on Doppler Velocity of Renal Arteries
Lee, J., Gao, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text

307

Trichoepithelioma
Skorin, L., Bauer, S. A.
The Journal of the American Osteopathic Association, 2020/08
Free full text

308

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

309

Effects of Osteopathic Manipulative Treatment on Sleep Quality in Student Athletes After Concussion: A Pilot Study
Mazzeo, S., Silverberg, C., Oommen, T., Moya, D., Angelo, N., Zwibel, H., Mancini, J., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/08
Free full text

310

Primary familial brain calcification
Parasram, M., Levi Chazen, J., Sarva, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

311

Effect of Opioid Prescribing Education for Obstetrics and Gynecology Residents in a Safety-Net Hospital
Evans, C., McCullough, D., Best, K., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/07
Free full text

312

Eosinopenia and COVID-19
Tanni, F., Akker, E., Zaman, M. M., Figueroa, N., Tharian, B., Hupart, K. H.
The Journal of the American Osteopathic Association, 2020/07
Free full text

313

Evaluating Financial Conflicts of Interest Among Contributors to Clinical Practice Guidelines of the American College of Obstetricians and Gynecologists
Wright, M. R., Frye, L., Vo Solis, L., Checketts, J. X., Guevara, C., Smith, L., Vassar, M.
The Journal of the American Osteopathic Association, 2020/07
Free full text

314

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07

315

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text

316

Straight Back Syndrome
Perez-Downes, J. C., Leon, A., Reddy, P.
The Journal of the American Osteopathic Association, 2020/07
Free full text

317

Lumbar Diagnosis and Pressure Difference Variance
Voleti, N., Gaspari, M. A., George, E., Angelo, N., Yao, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text


319

The Spanish Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross-sectional survey
Alvarez, G., Roura, S., Cerritelli, F., Esteves, J. E., Verbeeck, J., van Dun, P. L. S.
PLoS ONE, 2020/06
Free full text

320

Use of manual therapy applied to the viscera: Secondary analysis of a nationally representative sample of Australian osteopaths
Fleischmann, M., Vaughan, B., Fitzgerald, K., Grace, S.
International Journal of Osteopathic Medicine, 2020/06

321

Inter-examiner agreement of musculoskeletal and visceral tests to assess the pelvic region in women with stress urinary incontinence
Arcanjo, G. N., Mendes, M. R., Cavalcante, A., Lima, . O., Vilaça-Alves, J., Rocha, M.
Motricidade, 2020/06
Free full text

322

Neurophysiological aspects of enuresis in children
(Нейрофизиологические аспекты энуреза у детей)
Safiullina, G. I., Yakupov, R. A., Safiullina, A. A.
Russian Osteopathic Journal, 2020/06
Free full text


324

Daily Integrated Care Conferences to Reduce Length of Hospital Stay for Patients With Chronic Obstructive Pulmonary Disease
Shilian, R., Abraham, T., Wynbrandt, J., Jhaveri, D., Hostoffer, R. W., Peppers, B. P.
The Journal of the American Osteopathic Association, 2020/05
Free full text

325

Osteopathic Manipulative Medicine Practice Patterns of Third-Year and Fourth-Year Osteopathic Medical Students: An Educational Research Project
Snider, K. T., Couch, R., Bhatia, S.
The Journal of the American Osteopathic Association, 2020/05
Free full text

326

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text

327

Academic Advising Using Theoretical Approaches for Medical Students Who Are Struggling in Preclinical Years
Tewary, S., Jordan, J. A., Rana, A. M., Mayi, B.
The Journal of the American Osteopathic Association, 2020/04
Free full text

328

“Soccer-Ball“ Lymphocytosis
Utz, J. L., Bell, H., Wright, W. F., George, T. I.
The Journal of the American Osteopathic Association, 2020/04
Free full text

329

Developing Neuraxial and Regional Pain Procedural Skills Through Innovative 3-Dimensional Printing Technology
Headman, Z. C., Matson, M. C., Schneider, R. P., Potter, J. L., Loguda-Summers, D. L., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2020/04
Free full text

330

Effect of Osteopathic Manipulative Therapy on Generalized Anxiety Disorder
Dixon, L., Fotinos, K., Sherifi, E., Lokuge, S., Fine, A., Furtado, M., Anand, L., Liberatore, K., Katzman, M. A.
The Journal of the American Osteopathic Association, 2020/03
Free full text

331

‘Tell me your story’ - How osteopaths apply the BPS model when managing low back pain - A qualitative study
Abrosimoff, M., Rajendran, D.
International Journal of Osteopathic Medicine, 2020/03

332

Success Predictors For Third-Year Osteopathic Medical Students on National Standardized Examinations: A Family Medicine Clerkship Course Study
Glaser, K., Sackett, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2020/03
Free full text



335

Rectal Tubulovillous Adenoma
Hoff, R. T., Lakha, A.
The Journal of the American Osteopathic Association, 2020/02
Free full text

336

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01


338

Neural and visceral manipulation in infants with congenital muscular torticollis: a feasibility study
Zollars, J. A., Burtner, P. A., Stockman, G., Werbelow, P., Swartzentruber, J., Lowe, J. R.
Journal of Physical Therapy Science, 2020/01
Free full text

339

Determinants of health, health behaviours and demographic profile of patients attending an Australian university student-led osteopathy clinic
Vaughan, B., Fitzgerald, K., Fleischmann, M., Mulcahy, J.
Chiropractic & Manual Therapies, 2020/01
Free full text


341

Fitz-Hugh-Curtis Syndrome
Mersch, M., Martingano, D.
The Journal of the American Osteopathic Association, 2020/01
Free full text

342

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020

343

Impact of osteopathic manipulative treatment on range of motion of the pelvis during the one-sided tilt test: a pilot study
Menard, M., Ferrari, M., Bouchet, A., Puchaud, P., Vaucher, P., Sutre, F., Bideau, B., Bourgin, M.
HAL CCSD Taylor & Francis, 2019/12
Free full text


345

Implementing a clinical-educator curriculum to enrich internal medicine residents' teaching capacity
Habboush, Y., Stoner, A., Torres, C., Beidas, S.
BMC Medical Education, 2019/12
Free full text

346

Complaint risk among mental health practitioners compared with physical health practitioners: A retrospective cohort study of complaints to health regulators in Australia
Veness, B. G., Tibble, H., Grenyer, B. F., Morris, J. M., Spittal, M. J., Nash, L., Studdert, D. M., Bismark, M. M.
BMJ Open, 2019/12
Free full text



349

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12

350

Osteopathic Manipulative Medicine Vs Counseling in the Treatment of Sports-Related Concussion: Comparative Balance Assessment
Morris, J. Z., Shah, J., Zwibel, H., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12

351

The Efficacy of Osteopathic Manipulative Treatment on Decreasing the Severity of Migraine Headaches
Rhoads, A., Metzgar, M. M., Donovan, P.
The Journal of the American Osteopathic Association, 2019/12

352

The Efficacy of Treating Thoracic Cage Counterstrain Tender Points With Varied Mobile Point Time Durations in a Classroom Setting
Smith, J. M., Docherty, J., Kooyman, P., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12


354

Myofascial Release for Vulvar Pain and Pubic Shear After a Straddle Injury in a 3-Year-Old Girl
Dade, M. M., Broecker, J. D.
The Journal of the American Osteopathic Association, 2019/11
Free full text

355

Effectiveness of the muscle energy technique on respiratory muscle strength and endurance in patients with fibromyalgia
Uysal, S. C., Tuzun, E. H., Eker, L., Angin, E.
Journal of Back and Musculoskeletal Rehabilitation, 2019/11
Free full text

356

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11

357

The Effect of Osteopathic Manual Treatment on Concussion Injury Rehabilitation
Henderson, L. D.
Unpublished MSc thesis, 2019/11
Free full text

358

A comprehensive physical therapy evaluation for Male Chronic Pelvic Pain Syndrome: A case series exploring common findings
Archambault-Ezenwa, L., Markowski, A., Barral, J-P.
Journal of Bodywork and Movement Therapies, 2019/10






364

Osteopathic Manipulative Treatment for Allostatic Load Lowering
Nuno, V., Siu, A., Deol, N., Juster, R. P.
The Journal of the American Osteopathic Association, 2019/10
Free full text

365

Engaging with evidence-based practice in the osteopathy clinical learning environment: A mixed methods pilot study
Vaughan, B., Grace, S., Gray, B., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2019/09

366

Effects of muscle energy technique for quadratus lumborum on respiratory muscle strength in patients with breast cancer
Espinosa, L., Andrea, M., Daza, A., Jorge, E., Pinzón, S., Lina, M., Perdomo-Quiroga, Y., Ruiz, J., Jhoana, P.
Revista de la Facultad de Medicina, 2019/09

367

Osteopathic Manipulation Treatment Improves Cerebro-splanchnic Oximetry in Late Preterm Infants
Marinelli, B., Pluchinotta, F., Cozzolino, V., Barlafante, G., Strozzi, M. C., Marinelli, E., Franchini, S., Gazzolo, D.
Molecules, 2019/09
Free full text

368

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text


370

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text

371

Assessment of shoulder pain and somatic dysfunction in young competitive swimmers: Preventive Osteopathic Manipulative Treatment
Granger, F., Etevenard, M., Kily, J. P., Garet, M.
Journal of Sports Medicine and Therapy, 2019/08
Free full text

372

OMT for the Prevention and Management of Chronic Constipation and Distal Intestinal Obstructive Syndrome in Cystic Fibrosis: A Pilot Study
Modlin, S. E., Borofka, K., Franzini, D., Klene-Bowns, A. C., Nuño, V. A.
The Journal of the American Osteopathic Association, 2019/07
Free full text

373

Effect of muscle energy technique on pain pressure threshold in sacroiliac joint dysfunction
Srivastava, S., U., Dhanesh K. K., Mittal, H.
International Journal of Research in Pharmaceutical Sciences, 2019/07
Free full text

374

Mets and oscillating energy manual therapy in chronic lateral epicondylosis: A comparative study
Unnisa, R., Sivajyothi, N., G., Yatheendra K., Ur Rahman, M. A. W., Ahmed, I.
International Journal of Research in Pharmaceutical Sciences, 2019/07
Free full text

375

Simulation can offer a sustainable contribution to clinical education in osteopathy
Fitzgerald, K. M., Denning, T., Vaughan, B., Fleischmann, M. J., Jolly, B. C.
Chiropractic & Manual Therapies, 2019/07
Free full text

376

Reflective practice enhances osteopathic clinical reasoning
McIntyre, C., Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2019/07



379

Correlation between otitis media with effusion and cranial deformation in children
Orlando, M. P., Bonanno, M. A., Russo, F. Y., Ralli, M., Turchetta, R., Passali, F. M., Minni, A., Greco, A., De Vincentiis, M., Tattoli, M.
European Review for Medical and Pharmacological Sciences, 2019/06
Free full text

380

To Compare the Effect of Muscle Energy Technique and Ultrasound on Jaw Range of Motion in Subjects with Temporomandibular Joint Dysfunction
Jaspinder, K., Shilpy, J.
International Journal of Trend in Scientific Research and Development, 2019/06
Free full text

381

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06

382

Integrated pilot medical study on 40 patients affected by open angle glaucoma undergoing topical therapy with additional osteopathic manipulation
Paoli, D., Brusini, P., Michelin, L., Vassallo, F., Ciullo, L., Torelli, L.
Acta Ophthalmologica, 2019/06

383

The inter-rater reliability of the mobility tests of the cranial bones as assessed through manual therapy
Demers, K., Morin, C., Collette, L., DeMont, M. R.
Advances in Integrative Medicine, 2019/06

384

Active Visceral Manipulation Associated With Conventional Physiotherapy in People With Chronic Low Back Pain and Visceral Dysfunction: A Preliminary, Randomized, Controlled, Double-Blind Clinical Trial
Villalta Santos, L., Lisboa Cordoba, L., Benite Palma Lopes, J., Santos Oliveira, C., Andre Collange Grecco, L., Bovi Nunes Andrade, A. C., Pasin Neto, H.
Journal of Chiropractic Medicine, 2019/06
Free full text

385

Identifying a need and knowledge gap of osteopathic medicine in pediatric oncology providers
Belsky, J., Stanek, J., Gerhardt, C., Rose, M.
Pediatric Blood & Cancer, 2019/06


387

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06

388

The role of osteopathic complementary treatment in high frequency paediatric headache: a randomised controlled study
Rossi, R., Versace, A., Lauria, B., Grasso, G., Bagagiolo, D., Cappitella, E., Altieri, R., Delli Santi, M., Scarinzi, C., Urbino, A. F.
Neurological Sciences, 2019/06

389

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06


391

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text


393

Can Osteopathic Medical Students Accurately Measure Abdominal Aortic Dimensions Using Handheld Ultrasonography Devices in the Primary Care Setting?
Hower, K., Young, C. F., Wagner, A., Thorsen, D., Dugan, J.
The Journal of the American Osteopathic Association, 2019/05
Free full text

394

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text

395

Effects of osteopathic manipulative treatment on patients with multiple sclerosis: A pilot study
Porcari, B., Russo, M., Naro, A., La Via, C., Pullia, M., Accorinti, M., De Luca, R., Calabro, R. S.
Complementary Therapies in Medicine, 2019/04

396

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text

397

Osteopathic Structural Findings in Women During Menstruation
Cabrera, K. L., Darwish, A. M., Lurz, K. L., L., McClain. R., McClain, E., Cox, J., Segars, L.
The AAO Journal, 2019/03
Free full text


399

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text

400

Reflecting on new models for osteopathy – it's time for change
Smith, D.
International Journal of Osteopathic Medicine, 2019/03

401

Point-of-Care Ultrasonography Integration in Undergraduate Medical Education: A Student-Driven Approach
Goodcoff, A., Keane, D., Bialczak, A., Ziner, E., Hanna, J. B.
The Journal of the American Osteopathic Association, 2019/03
Free full text

402

Magnetic Resonance Imaging Parameters Selected for Optimal Visualization of the Occipitoatlantal Interspace
Hallgren, R. C., Rowan, J. J.
The Journal of the American Osteopathic Association, 2019/03
Free full text

403

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text

404

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text


406

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text

407

Effectiveness of manual therapy in COPD: A systematic review of randomised controlled trials
Simonelli, C., Vitacca, M., Vignoni, M., Ambrosino, N., Paneroni, M.
Pulmonology, 2019/02


409

Fascial manipulation vs. standard physical therapy practice for low back pain diagnoses: A pragmatic study
Harper, B., Steinbeck, L., Aron, A.
Journal of Bodywork and Movement Therapies, 2019/01

410

Effectiveness of Combined General Rehabilitation Gymnastics and Muscle Energy Techniques in Older Women with Chronic Low Back Pain
Wendt, M., Cieslik, K., Lewandowski, J., Waszak, M.
BioMed Research International, 2019/01
Free full text


412

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01

413

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text

414

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12

415

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text

416

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text

417

Attitudes, skills and use of evidence-based practice among UK osteopaths: a national cross-sectional survey
Sundberg, T., Leach, M. J., Thomson, O. P., Austin, P., Fryer, G., Adams, J.
BMC Musculoskeletal Disorders, 2018/12
Free full text

418

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

419

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text


421

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text

422

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
The Journal of the American Osteopathic Association, 2018/11



425

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

426

Managing Tremor in Parkinson Disease Using Osteopathic Manipulative Medicine
Li, R., Docherty, J., Koo, S. L., Shinners, J., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

427

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11

428

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text

429

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10

430

Association Between Performance on COMLEX-USA and the American College of Osteopathic Family Physicians In-Service Examination
Hudson, K. M., Feinberg, G., Hempstead, L., Zipp, C., Gimpel, J. R., Wang, Y.
Journal of Graduate Medical Education, 2018/10
Free full text

431

Changes on cervical range of motion in migraine patients after a strain counterstrain treatment
Giustino, V., Contrò, V., Brusa, J., Proia, P., Messina, G., Brighina, F.
The Journal of Headache and Pain, 2018/10

432


433

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text

434

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text

435

Effect of gong’s mobilisation versus muscle energy technique on pain and functional ability of shoulder in phase II adhesive capsulitis
Gopinath, Y., Seenivasan, S. K., Veeraraghavan, S. N. C., Viswanathan, R., Govindaraj, M. K.
Journal of Clinical and Diagnostic Research, 2018/09

436

Is digital image correlation able to detect any mechanical effect of cranial osteopathic manipulation? – A preliminary study
Pellet, M., Chenel, A., Behr, M., Thollon, L.
International Journal of Osteopathic Medicine, 2018/09

437

Osteopathic Manipulative Therapy and Multiple Sclerosis: A Proof-of-Concept Study
Cordano, C., Armezzani, A., Veroni, J., Pardini, M., Sassos, D., Infante, M. T., Tacchino, A., Lapucci, C., Cellerino, M., Calabro, V., Ciullo, L., Nourbakhsh, B.
The Journal of the American Osteopathic Association, 2018/08
Free full text

438

Diabetes Fellowship in Primary Care: A Survey of Graduates
Healy, A. M., Tanenberg, R. J., Schwartz, F. L., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2018/08
Free full text

439

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text

440

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07

441

Role of osteopathic manipulative treatment in cystic fibrosis: A pilot study
Fainardi, V., Benecchi, S., Longo, F., Tripodi, M. C., Villani, M. L., Teopompi, E., Chetta, A. A., Pisi, G.
Journal of Cystic Fibrosis, 2018/07

442

UK trained osteopaths' relationship to evidence based practice - An analysis of influencing factors
Weber, V., Rajendran, D.
International Journal of Osteopathic Medicine, 2018/07

443

A case for the International Classification of Disease (ICD)
Vaughan, B., Fleischmann, M., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2018/06

444

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text

445

First-Year Osteopathic Medical Students' Knowledge of and Attitudes Toward Physical Activity
Guseman, E. H., Whipps, J., Howe, C. A., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/06
Free full text

446

Clinical reasoning in osteopathy: Experiences of novice and experienced practitioners
King, L., Kremser, S., Deam, P., Henry, J., Reid, D., Orrock, P., Grace, S.
International Journal of Osteopathic Medicine, 2018/06

447

Osteopathic clinical reasoning: An ethnographic study of perceptual diagnostic judgments, and metacognition
McIntyre, C, Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/06

448

Attitudes and self-reported practices of New Zealand osteopaths to exercise consultation
Mistry, R. A., Bacon, C. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2018/06



451

Profile of osteopathic practice in Spain: Results from a standardized data collection study
Alvarez Bustins, G., López Plaza, P. V., Carvajal, S. R.
BMC Complementary and Alternative Medicine, 2018/04
Free full text

452

Assessment Considerations for Core Entrustable Professional Activities for Entering Residency
Linsenmeyer, M., Wimsatt, L., Speicher, M., Powers, J., Miller, S., Katsaros, E.
The Journal of the American Osteopathic Association, 2018/04
Free full text




456

Influence of Transverse Process Landmark Localization on Palpation Accuracy of Lumbar Spine Models
Snider, E. J., Pamperin, K., Pazdernik, V., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text

457

Clinical versus radiological findings: A paradox in diagnosing minor hamstring injuries
Arumugam, A.
International Journal of Osteopathic Medicine, 2018/03

458

A Mokken scale analysis of the peer physical examination questionnaire
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2018/03
Free full text


460

Clinical reasoning for complex cervical spine conditions
Reid, D., Rebbeck, T., McCarthy, C.
International Journal of Osteopathic Medicine, 2018/03


462

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text

463

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

464

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text

465

Effect of Ultrasonography on Student Learning of Shoulder Anatomy and Landmarks
de Vries, K. D., Brown, R., Mazzie, J., Jung, M. K., Yao, S. C., Terzella, M. J.
The Journal of the American Osteopathic Association, 2018/01
Free full text

466

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text

467

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text

468

Postural and autonomic modifications following osteopathic manipulative treatment (OMT): Comparison between two techniques. A pilot study
Scoppa, F., Pirino, A., Belloni, G., Gallamini, M., Messina, G., Iovane, A.
Acta Medica Mediterranea, 2018/01
Free full text

469

The Validity and Reliability of Provocation Tests in the Diagnosis of Sacroiliac Joint Dysfunction
Telli, H., Telli, S., Topal, M.
Pain Physician, 2018/01
Free full text

470

Medical Student Decision-Making: Standard Surgical Excision or Mohs Micrographic Surgery to Manage Basal Cell Carcinoma
Mancuso, C., Morris, J. B., Hernandez, N., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2018/01
Free full text

471

Palpatory and Ultrasound Assessment of Cervical Dysfunctions and the Effect of Cervical High-Velocity, Low-Amplitude (HVLA) Technique
Flaum, T. B., Mirza, A., Rusnack, F. M-A., Apoznanski, T. E., Munarova, A., Mazzie, J., Terzella, M. J., Yao, S. C.
The AAO Journal, 2017/12
Free full text

472

Compression of the Fourth Ventricle Using a Craniosacral Osteopathic Technique: A Systematic Review of the Clinical Evidence
Zurowska, A., Malak, R., Kolcz-Trzesicka, A., Samborski, W., Paprocka-Borowicz, M.
Evidence-based Complementary and Alternative Medicine, 2017/12
Free full text

473

Simulated learning activities as part replacement of clinical placements in osteopathy: A case study
Fitzgerald, K., Denning, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2017/12

474

Influence of perceived difficulty of cases on student osteopaths' diagnostic reasoning: a cross sectional study
Noyer, A. L., Esteves, J. E., Thomson, O. P.
Chiropractic & Manual Therapies, 2017/12
Free full text



477

Effects of Group Fitness Classes on Stress and Quality of Life of Medical Students
Yorks, D. M., Frothingham, C. A., Schuenke, M. D.
The Journal of the American Osteopathic Association, 2017/11
Free full text

478

Effect of Pedal Pump Lymphatic Technique on Exercise Recovery After Maximal Exercise
Docherty, J., Schatz, A., Grohman, R., de Vries, K., Chan, T., Yao, S. C., DiFrancisco-Donoghue, J.
The Journal of the American Osteopathic Association, 2017/11

479

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11

480

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text

481

Assessment of Nutrition Knowledge and Attitudes in Preclinical Osteopathic Medical Students
Hargrove, E. J., Berryman, D. E., Yoder, J. M., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/10
Free full text

482

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

483

A comparison of the effect of the active release and muscle energy techniques on the latent trigger points of the upper trapezius
Sadria, G., Hosseini, M., Rezasoltani, A., Akbarzadeh Bagheban, A., Davari, A., Seifolahi, A.
Journal of Bodywork and Movement Therapies, 2017/10

484

Osteopathic management of chronic constipation in women patients. Results of a pilot study
Belvaux, A., Bouchoucha, M., Benamouzig, R.
Clinics and Research in Hepatology and Gastroenterology, 2017/10


486

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09


488

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text

489

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

490

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text

491

Sensitivity for palpating lumbopelvic soft- tissues and bony landmarks and its associated factors: A single-blinded diagnostic accuracy study
Ferreira, A. P. A., Póvoa, L. C., Zanier, J. F. C., Machado, D. C., Ferreira, A. S.
Journal of Back and Musculoskeletal Rehabilitation, 2017/08

492

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text

493

Interexaminer reliability study of a standardized myofascial diagnostic technique of the superior thoracic inlet
Hutchinson, D., Hines, S., Vijayaraghavan, N., Sammond, A., Metzler-Wilson, K., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2017/07

494

Osteopathic manipulative treatment in soccer players with chronic groin pain: a pilot study
Nolli, L., Baraggiolo, S., PaganiI, M, Origo, D., Bergna, A., Vismara, L.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2017/06

495

A pilot study to develop a tool for the assessment of students' clinical record keeping
Moore, K., Vaughan, B., Cox, A.
International Journal of Osteopathic Medicine, 2017/06


497

Osteopathic manipulation of the ankle improves spinal flexibility in elite alpine skiers: a pilot study
Parisio, C., Vismara, L., Micotti, V., Cimolin, V., Aprile, D., Cavigioli, M., Panzeri, A., Manzotti, A., Galli, M., Capodaglio, P.
Gazzetta Medica Italiana Archivio Per Le Scienze Mediche, 2017/05


499

Clinical classification in low back pain: best-evidence diagnostic rules based on systematic reviews
Petersen, T., Laslett, M., Juhl, C.
BMC Musculoskeletal Disorders, 2017/05
Free full text

500

Evidence-Based Redesign of the COMLEX-USA Series
Gimpel, J. R., Horber, D., Sandella, J. M., Knebl, J. A., Thornburg, J. E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

501

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

502

Non-pharmacological therapies for primary open angle glaucoma: A quasi-experimental pilot study
Pandey, R., Samuel, A. J., Aranha, V. P., Pandey, A., Narkeesh, K.
Saudi Journal of Ophthalmology, 2017/04
Free full text


504

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

505

Response to the Editorial “The enigmatic case of cranial osteopathy: Evidence vs clinical practice”
Monro, M., Farwell, S., Downes, W., Wilson, M., Carter, P. V.l, Douglas-Mort, D., Möckel, E., Zwierzchowska, Z., Apeztegia, J.
International Journal of Osteopathic Medicine, 2017/03

506

Enhancing clinical education in the private practice setting: A case study in osteopathy
Moore, K., Field, B. J.
International Journal of Osteopathic Medicine, 2017/03



509

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text



512

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text


514

How Osteopathy Could Help Obstetrics in Diagnosis and Therapy. Preliminary Report About Safety and Efficacy of Osteopathy in an Obstetrics Department in Italy
Siccardi, M., Valle, C., Di Matteo, F., Perlo, B., Pratticò, M., Angius, V., Bianco, G., Damonte, V., Giusto, S., Palezzato, E., Tabò, M., Brichetto, C., Valle, P., Zolezzi, A., Parodi, G., Airaudi, G.
Journal of Perinatal Medicine, 2017/01


516

Effectiveness of osteopathic manipulative treatment versus osteopathy in the cranial field in temporomandibular disorders - a pilot study
Gesslbauer, C., Vavti, N., Keilani, M., Mickel, M., Crevenna, R.
Disability and Rehabilitation, 2016/12


518

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text





523

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text

524

Multimodal compared to pharmacologic treatments for chronic tension-type headache in adolescents
Przekop, P., Przekop, A., Haviland, M. G.
Journal of Bodywork and Movement Therapies, 2016/10



527

The enigmatic case of cranial osteopathy: Evidence versus clinical practice
Zegarra-Parodi, R., Cerritelli, F.
International Journal of Osteopathic Medicine, 2016/09
Free full text

528

Does Using a Shim Improve the Diagnostic Reliability of the Standing Flexion Test? A Pilot Study
Marquez, A. P., Yim, M., Zelimkhanian, B., Quiamas, J., Davidge, R. E., Siri, M., Hruby, R. J.
The AAO Journal, 2016/09

529

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

530

Osteopathy for Endometriosis and Chronic Pelvic Pain - a Pilot Study
Sillem, M., Juhasz-Boss, I., Klausmeier, I., Mechsner, S., Siedentopf, F., Solomayer, E.
Geburtshilfe Frauenheilkunde, 2016/09

531

Preliminary development of a complex intervention for osteopathic management of dysfunctional breathing
Benjamin, J. G., Bacon, C. J., Verhoeff, W. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/09

532

R18 - Osteopathy for Post-Mastectomy Pain Syndrome (PMPS) in early breast cancer (EBC) patients: a pilot study in an Italian Oncology Unit
Putignano, F., Bidin, L., Belfiglio, B., Bordoni, F., Seghini, P., Cavanna, L.
Annals of Oncology, 2016/09

533

Tensegrity and manual therapy practice: a qualitative study
Hohenschurz-Schmidt, D. J., Esteves, J. E., Thomson, O. P.
International Journal of Osteopathic Medicine, 2016/09

534

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text

535

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text

536

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text

537

Exploration of clinical changes following a novel mobilisation technique for treatment of chronic low back pain: A single cohort design
Hanson, G. C., Jones, B., Bacon, C. J., Moran, R. W.
Journal of Bodywork and Movement Therapies, 2016/07

538

Targeted Pressure on Abductor Hallucis and Flexor Hallucis Brevis Muscles to Manage Moderate to Severe Primary Restless Legs Syndrome
Kuhn, P. J., Olson, D. J., Sullivan, J. P.
The Journal of the American Osteopathic Association, 2016/07
Free full text

539

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text

540

Osteopathic medical students' perception of teaching effectiveness of their primary care clinical preceptors
Ojano Sheehan, O., Brannan, G., Dogbey, G.
International Journal of Osteopathic Medicine, 2016/06

541

Masterclasses – integrating research evidence with expertise into clinical practice
Thomson, O. P., Evans, D. W.
International Journal of Osteopathic Medicine, 2016/06




545

Osteopathic Manipulative Treatment improves gait pattern and posture in adult patients with Prader–Willi syndrome
Vismara, L., Cimolin, V., Galli, M., Grugni, G., Ancillao, A., Capodaglio, P.
International Journal of Osteopathic Medicine, 2016/03




549

Understanding clinical reasoning in osteopathy: a qualitative research approach
Grace, S., Orrock, P., Vaughan, B., Blaich, R., Coutts, R.
Chiropractic & Manual Therapies, 2016/03
Free full text


551

Assessment of Australian osteopathic learners
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03

552

Comparative assessment of tactile sensitivity between undergraduate and postgraduate health sciences students
Nascimento, L. P., Oliva-Pascual-Vaca, A., Renan-Ordine, R., Riquelme, I., Ricard, F., Rodriguez-Blanco, C.
International Journal of Osteopathic Medicine, 2016/03

553

Osteopaths' clinical reasoning during consultation with patients experiencing acute low back pain: A qualitative case study approach
Roots, S. A., Niven, E., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/03

554

Assessment of Australian osteopathic learners' clinical competence during workplace learning
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03

555

Osteopathic manipulative treatment for older patients: A national survey of osteopathic physicians
Channell, M. K., Wang, Y., McLaughlin, M. H., Ciesielski, J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2016/03
Free full text



558

Evaluating medical student engagement during virtual patient simulations: a sequential, mixed methods study
McCoy, L., Pettit, R. K., Lewis, J. H., Allgood, J. A., Bay, C., Schwartz, F. N.
BMC Medical Education, 2016/01
Free full text

559

Assessment in the final year clinical practicum of an Australian osteopathy program
Vaughan, B., Morrison, T.
International Journal of Osteopathic Medicine, 2015/12

560

The Osteopathic Clinical Practice Assessment – a pilot study to develop a new workplace-based assessment tool
Vaughan, B., Moore, K.
International Journal of Osteopathic Medicine, 2015/12

561

A National Study of Primary Care Provided by Osteopathic Physicians
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2015/12
Free full text

562

Reassessing the accuracy and reproducibility of Diers formetric measurements in healthy volunteers
Lason, G., Peeters, L., Vandenberghe, K., Byttebier, G., Comhaire, F.
International Journal of Osteopathic Medicine, 2015/12

563

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text

564

Incidence of Somatic Dysfunction in Healthy Newborns
Waddington, E. L., Snider, K. T., Lockwood, M. D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2015/11
Free full text


566

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text


568

Feasibility of Using Ultrasonography to Establish Relationships Among Sacral Base Position, Sacral Sulcus Depth, Body Mass Index, and Sex
Lockwood, M. D., Kondrashova, T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/11
Free full text

569

Quantification of Motion Palpation
Kasparian, H., Signoret, G., Kasparian, J.
The Journal of the American Osteopathic Association, 2015/10
Free full text







576

Impact of forefoot varus on standing and gait kinematics in children
Villarroya-Aparicio, A., Franco-Sierra, M. A., García-Muñoz, I., Marcén-Román, Y., Alonso-Vázquez, A., Rodriguez-Blanco, C.
International Journal of Osteopathic Medicine, 2015/09

577




580

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09

581

Improving our impact and developing high-level clinical expertise
Moran, R.
International Journal of Osteopathic Medicine, 2015/09
Free full text

582

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09


584

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text

585

Accuracy of Anterior Superior Iliac Spine Symmetry Assessment by Routine Structural Examination
Lee, A. S., Pyle, C. W., Redding, D.
The Journal of the American Osteopathic Association, 2015/08
Free full text

586

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text

587

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text

588

Immediate changes in electroencephalography activity in individuals with nonspecific chronic low back pain after cranial osteopathic manipulative treatment: study protocol of a randomized, controlled crossover trial
Martins, W. R., Diniz, L. R., Blasczyk, J. C., Lagoa, K. F., Thomaz, S., Rodrigues, M. E., de Oliveira, R. J., Bonini-Rocha, A. C.
BMC Complementary and Alternative Medicine, 2015/07
Free full text

589

Oral cancer knowledge, behavior, and attitude among osteopathic medical students
McCready, Z. R., Kanjirath, P., Jham, B. C.
Journal of Cancer Education, 2015/06

590

Relationship between somatic dysfunction of the lumbosacral joint and changes in the gait pattern
Croonenborghs, H., Peeters, L., De Schepper, J.
International Journal of Osteopathic Medicine, 2015/06

591

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06

592

A global view of osteopathic practice – mirror or echo chamber?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2015/06



595

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05

596

Lymphatic pump treatment as an adjunct to antibiotics for pneumonia in a rat model
Hodge, L. M., Creasy, C., Carter, K., Orlowski, A., Schander, A., King, H. H.
The Journal of the American Osteopathic Association, 2015/05
Free full text

597

Relationship between residency placement and clerkship site enrollment: a retrospective analysis
Elliott, S. P., Goldstein, L. B., Meinberg, D., Jeger, A. M.
The Journal of the American Osteopathic Association, 2015/04
Free full text


599

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

600

Osteopathic manipulative treatment and pain in preterms: study protocol for a randomised controlled trial
Cerritelli, F., Cicchitti, L., Martelli, M., Barlafante, G., Renzetti, C., Pizzolorusso, G., Lupacchini, M., D'Orazio, M., Marinelli, B., Cozzolino, V., Fusilli, P., D'Incecco, C.
Trials, 2015/04
Free full text

601



603

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text




607

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03


609

Effectiveness of osteopathic manipulative treatment for carpal tunnel syndrome: a pilot project
Burnham, T., Higgins, D. C., Burnham, R. S., Heath, D. M.
The Journal of the American Osteopathic Association, 2015/03
Free full text


611

Osteopathic graduates perceptions of stress and competence – A longitudinal study
Subramaniam, P., Eaton, S.A., Cranfield, J., Mulcahy, J., McLaughlin, P., Morrison, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2015/03

612

Osteopathic manipulative treatment for self-reported fatigue, stress, and depression in first-year osteopathic medical students
Wiegand, S., Bianchi, W., Quinn, T. A., Best, M., Fotopoulos, T.
The Journal of the American Osteopathic Association, 2015/02
Free full text

613

A pilot study on spatial changes in the maxilla caused by osteopathic therapy
Walter, C., Lechner, K. H., Karl, M.
Quintessence International, 2015/01

614

Use of a novel assay to measure pre- to posttraining palpatory skills of first-year osteopathic medical students
Loh, M. S., Gevitz, N., Gilliar, W. G., Iacono, L. M., Jung, M. K., Krishnamachari, B., Amsler, K.
The Journal of the American Osteopathic Association, 2015/01
Free full text




618

The role of clinicians in osteopathic research
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/12








626




629

Effekt von Lebermobilisation
(Effects of liver mobilization)
March, S.
Unpublished MSc thesis, 2014/10
Free full text

630

Benchmarking the strategies for assessing clinical reasoning in osteopathic curricula
Moore, K., Grace, S., Orrock, P., Coutts, R., Blaich, R., Vaughan, B.
International Journal of Osteopathic Medicine, 2014/09

631

Osteopaths' professional views, identities and conceptions – A qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/09

632

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09

633

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09

634

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text

635

H-reflex responses to High-Velocity Low-Amplitude manipulation in asymptomatic adults
Groisman, S., Silva, L., Rocha, N., Hoff, F., Rodrigues, M. E., Ehlers, J. A., Diniz, L. R.
International Journal of Osteopathic Medicine, 2014/09


637

Diagnostic reasoning in osteopathy – A qualitative study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/06


639

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06

640

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text

641

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text

642

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text

643

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text


645

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text


647

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text

648

Concurrent validity of the Osteopathic General Surgery In-Service Examination
Falcone, J. L., Rosen, M. E.
The Journal of the American Osteopathic Association, 2014/04
Free full text

649

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text

650

Relationship between COMLEX-USA scores and performance on the American Osteopathic Board of Emergency Medicine Part I certifying examination
Li, F., Gimpel, J. R., Arenson, E., Song, H., Bates, B. P., Ludwin, F.
The Journal of the American Osteopathic Association, 2014/04
Free full text


652

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text

653

Clinical effectiveness of manual therapy for the management of musculoskeletal and non-musculoskeletal conditions: systematic review and update of UK evidence report
Clar, C., Tsertsvadze, A., Court, R., Hundt, G. L., Clarke, A., Sutcliffe, P.
Chiropractic & Manual Therapies, 2014/03
Free full text


655

Osteopathic manipulative therapy induces early plasma cytokine release and mobilization of a population of blood dendritic cells
Walkowski, S., Singh, M., Puertas, J., Pate, M., Goodrum, K., Benencia, F.
PLoS One, 2014/03
Free full text




659

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01

660

Patterns of misrepresentation of clinical findings on patient notes during the COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Gallagher, L. A., Langenau, E. E.
The Journal of the American Osteopathic Association, 2014/01
Free full text


662

Script concordance test: Insights from the literature and early stages of its implementation in osteopathy
Esteves, J. E., Bennison, M., Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12


664

Assessing undergraduate osteopaths in the identification of patients' excess body weight
Bright, P., Wasik, C.
International Journal of Osteopathic Medicine, 2013/12


666

Effect of selected manual therapy interventions for mechanical neck pain on vertebral and internal carotid arterial blood flow and cerebral inflow
Thomas, L. C., Rivett, D. A., Bateman, G., Stanwell, P., Levi, C. R.
Physical Therapy, 2013/11
Free full text

667


668

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text

669

High-velocity low-amplitude thrust manipulation of the lumbar spine immediately modifies soleus T reflex in asymptomatic adults
Boët, C., Fugier, S., Marsault, J., Toublan, D., Valot, M.E., Cheval, A., Amyot d'Inville, G., Niel, S., Guihéneuc, P., Guihard, G.
International Journal of Osteopathic Medicine, 2013/09


671

Changes in alpha band activity associated with application of the compression of fourth ventricular (CV-4) osteopathic procedure: A qEEG pilot study
Miana, L., Hugo do Vale Bastos, V., Machado, S., Arias-Carrión, O., Nardi, Antonio E., Almeida, L., Ribeiro, P., Machado, D., King, H., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2013/07
Free full text

672

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07

673

Ruling out other causes than chest wall syndrome for patients with chest pain
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/06


675

Osteopathie und Unfruchtbarkeit
(Osteopathy and infertility)
Kermorgant, G.
Osteopathische Medizin, 2013/06

676

Osteopathic treatment of patients with long-term sequelae of whiplash injury: effect on neck pain disability and quality of life
Schwerla, F., Kaiser, A. K., Gietz, R., Kastner, R.
The Journal of Alternative and Complementary Medicine, 2013/06

677

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text

678

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

679

Use of the SMART Balance Master to quantify the effects of osteopathic manipulative treatment in patients with dizziness
Fraix, M., Gordon, A., Graham, V., Hurwitz, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text

680

Sham manual medicine protocol for cervical strain-counterstrain research
Brose, S. W., Jennings, D. C., Kwok, J., Stuart, C. L., O', Connell, S. M., Pauli, H. A., Liu, B.
PM&R: The Journal of Injury, Function and Rehabilitation, 2013/05

681

Osteopathic intervention in chronic non-specific low back pain: a systematic review
Orrock, P. J., Myers, S. P.
BMC Musculoskeletal Disorders, 2013/04
Free full text

682

The use of placebo interventions in clinical practice
Linde, K.
Complementary Therapies in Medicine, 2013/04
Free full text

683

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

684

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text

685

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

686

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

687

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

688


689

The effects of experience on the inter-reliability of osteopaths to detect changes in posterior superior iliac spine levels using a hidden heel wedge
Sutton, C., Nono, L., Johnston, R. G., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2013/04


691

Clinical decision making and therapeutic approaches of experienced osteopaths
Thomson, O.
Unpublished PhD thesis, 2013/04
Free full text

692

Evaluation of behavioural and gastrointestinal symptoms in autistic children after visceral osteopathic treatment
Castellarin, I. B., Drysdale, I. P., Patel, V.
International Journal of Osteopathic Medicine, 2013/03


694

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

695

Clinical reasoning and therapeutic approaches of experienced osteopaths
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

696

Electromyographic responses of deep thoracic transversospinalis muscles to osteopathic manipulative interventions
Fryer, G., Bird, M., Robbins, B., Johnson, J. C.
International Journal of Osteopathic Medicine, 2013/03

697

Lumbosacral Muscle Energy Technique produces immediate decreases in corticospinal and spinal reflex excitability in asymptomatic participants
Fryer, G., Glynn, B., Masin, K., Wroe, M., Pearce, A. J.
International Journal of Osteopathic Medicine, 2013/03

698

Stabilometric platform as a diagnosis support for pain? Example of chronic low back pain
Huard, Y., Bertucci, W.
The AAO Journal, 2013/03
Free full text







705

A systematic review to evaluate the clinical benefits of craniosacral therapy
Jäkel, A., von Hauenschild, P.
Complementary Therapies in Medicine, 2012/12

706

OCC: will it never end?
Sylvara, J. T.
The Journal of the American Osteopathic Association, 2012/12
Free full text

707

Establishing the content validity of palpatory examination for the assessment of the lumbar spine using ultrasonography: a pilot study
Shaw, K. A., Dougherty, J. J., Treffer, K. D., Glaros, A. G.
The Journal of the American Osteopathic Association, 2012/12
Free full text







714

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text

715

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text

716

Assessing the effectiveness of OMT provided by predoctoral teaching fellows as measured by a visual analog pain scale
Sarkaria, J. A., Render, R. M., Lerma, C. M., Henley, N., Seffinger, M. A., Hruby, R. J.
The AAO Journal, 2012/09
Free full text

717

Three-Dimensional Analysis of OMT in the Post–Total Arthroplasty Knee
Simela, A.
The Journal of the American Osteopathic Association, 2012/08

718

Assessing Palpation Thresholds Using Static Lumbar Spine Models
Snider, E. J., Pamperin, K. L., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2012/08

719

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text

720

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text

721

Assessment of the influence of osteopathic myofascial techniques on normalization of the vocal tract functions in patients with occupational dysphonia
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Malinska, J., Golusinski, W., Sliwinska-Kowalska, M.
International Journal of Occupational Medicine and Environmental Health, 2012/06

722

Iliacus tender points in young adults: a pilot study
Liu, Y., Palmer, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text

723

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text


725

Osteopathic medical student learning competency
Bell, H., Donohue, W., Liang, Y. J., Kim, J., Cettin, M.
Family Medicine, 2012/03

726

Stress reduction with osteopathy assessed with GDV electrophotonic imaging: effects of osteopathy treatment
Korotkov, K., Shelkov, O., Shevtsov, A., Mohov, D., Paoletti, S., Mirosnichenko, D., Labkovskaya, E., Robertson, L.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text

727

Osteopathic manipulative treatment effectiveness in severe chronic obstructive pulmonary disease: a pilot study
Zanotti, E., Berardinelli, P., Bizzarri, C., Civardi, A., Manstretta, A., Rossetti, S., Fracchia, C.
Complementary Therapies in Medicine, 2012/02-04
Free full text



730

Effect of OMT on Heart Rate in Normotensive and Prehypertensive Individuals
Siu, V. N., Cooper, A., Rezk, M., Terzella, M., Yao, S. C., Gilliar, W.
The Journal of the American Osteopathic Association, 2012/01

731

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12


733

Exploring the impact of osteopathic treatment on cranial asymmetries associated with nonsynostotic plagiocephaly in infants
Lessard, S., Gagnon, I., Trottier, N.
Complementary Therapies in Clinical Practice, 2011/11
Free full text

734

Comparative Analysis of Muscle Energy Technique and Conventional Physiotherapy in Treatment of Sacroiliac Joint Dysfunction
Dhinkaran, M., Sareen, A., Arora, T.
Indian Journal of Physiotherapy & Occupational Therapy, 2011/10

735

Muscle fatigue in chronic fatigue syndrome/myalgic encephalomyelitis (CFS/ME) and its response to a manual therapeutic approach: A pilot study
Perrin, R. N., Richards, J. D., Pentreath, V., Percy, D. F.
International Journal of Osteopathic Medicine, 2011/09






741

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?
Shaw, H. H.
The Journal of the American Osteopathic Association, 2011/08
Free full text

742

Effects of Osteopathic Cranial Manipulation on Biogenic Amine Levels, Heart Rate, and Blood Pressure in Adult Humans
Semeniken, K. R., Miller, P. A., Fuhrer, J. M., Farris, D.A., Parry, M. J., Petros, V., Corso, T.
The Journal of the American Osteopathic Association, 2011/08

743

Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes
Langenau, E. E., Sandella, J. M.
The Journal of the American Osteopathic Association, 2011/07
Free full text

744

The Hawthorne effect: stronger than the placebo effect?
Berthelot, J. M., Le Goff, B., Maugars, Y.
Joint Bone Spine, 2011/07
Free full text

745


746

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06

747

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06

748

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text

749

Effects of comprehensive osteopathic manipulative treatment on balance in elderly patients: a pilot study
Lopez, D., King, H. H., Knebl, J. A., Kosmopoulos, V., Collins, D., Patterson, R. M.
The Journal of the American Osteopathic Association, 2011/06
Free full text

750

Effect of osteopathic manipulative treatment on gastrointestinal function and length of stay of preterm infants: an exploratory study
Pizzolorusso, F., Turi, P., Barlafante, G., Cerritelli, F., Renzetti, C., Cozzolino, V., D'Orazio, M., Fusilli, P., Carinci, F., D'Incecco, C.
Chiropractic & Manual Therapies, 2011/06
Free full text




754

The effectiveness of osteopathic treatment in women with endometriosis-related pain
Schneider-Milo, U.
Unpublished MSc thesis, 2011/06
Free full text


756

Palpatory accuracy of lumbar spinous processes using multiple bony landmarks
Snider, K. T., Snider, E. J., Degenhardt, B. F., Johnson, J. C., Kribs, J. W.
Journal of Manipulative and Physiological Therapeutics, 2011/06
Free full text

757

Diagnostic Palpation in Osteopathic Medicine: A Putative Neurocognitive Model of Expertise
Esteves, J. E. d. J.
Unpublished PhD thesis, 2011/06
Free full text



760

Are clinical protocols for osteopathic manipulative procedures truly “osteopathic“?
Kirsch, J. R.
The Journal of the American Osteopathic Association, 2011/05
Free full text

761

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

762

Interprofessional education: cooperation among osteopathic medicine, pharmacy, and physician assistant students to recognize medical errors
Meszaros, K., Lopes, I. C., Goldsmith, P. C., Knapp, K. K.
The Journal of the American Osteopathic Association, 2011/04
Free full text

763

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text

764

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

765

An Osteopathic Approach to Chronic Sinusitis
Lee-Wong, M., Karagic, M., Doshi, A., Gomez, S., Resnick, D.
Journal of Allergy & Therapy, 2011/04
Free full text

766

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03

767

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text


769

Osteopathie an Kliniken (Interviews)
(Osteopathy in hospitals)
Hogrefe, H.C., Graf, A., Bockius, D.
Osteopathische Medizin, 2011/03


771

New COMLEX-USA-to-USMLE conversion formula needed
Burmeister, J. D.
The Journal of the American Osteopathic Association, 2011/02
Free full text

772

Low back pain, somatic dysfunction, and segmental bone mineral density T-score variation in the lumbar spine
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J.
The Journal of the American Osteopathic Association, 2011/02
Free full text

773

Relationship between encounter time and candidate performance on COMLEX-USA Level 2-PE
Sandella, J. M., Roberts, W. L., Langenau, E. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text

774

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text

775

Osteopathic manipulation as a complementary treatment for the prevention of cardiac complications: 12-Months follow-up of intima media and blood pressure on a cohort affected by hypertension
Cerritelli, F., Carinci, F., Pizzolorusso, G., Turi, P., Renzetti, C., Pizzolorusso, F., Orlando, F., Cozzolino, V., Barlafante, G.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text

776

Objective Measure of Effect of Osteopathic Manipulative Treatment on Balance
Gordon, A. N., Graham, V., Hurwitz, E., Fraix, M. P., Seffinger, M.
The Journal of the American Osteopathic Association, 2011/01


778

What are the factors that guide an osteopath during the process of technique choice?
Albertson, P.
Unpublished MSc thesis, 2011/01
Free full text

779




782

Osteopathic Medicine's Holistic Approach Is More Important Than Ever
Goldberg, P. M.
The Journal of the American Osteopathic Association, 2010/12
Free full text


784

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text






790

Test-dependent osteopathic treatment of patients with tinnitus and craniomandibular dysfunctions (CMD): A pre-post pilot trial
Salomon, J., Kronau, S., Moshövel, N., Niggemeier, H., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09/


792

Effect of osteopathic treatment on the gastrointestinal system function of autistic children
Castellarin, I. B., Hucklebridge, F., Patel, V. B., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2010/09

793

Osteopathic treatment of patients with lower urinary tract symptoms and benign prostatic hyperplasia: A pre-post pilot trial
Conrad, U., Scheuer, K., Hebgen, E., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09

794

Somatic dysfunctions in newborns: prevalence and interoperator correlation
Cozzolino, V., Boccuzzi, M., Evangelista, S., Germinario, G., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09

795

Investigating the role of vision and touch in the diagnosis of somatic dysfunction
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2010/09

796


797

Hamo-Study 3, Phase 1: Effects of sternotomy on the mobility of the heart under influence of respiration at 3-months postoperative
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2010/09


799

Osteopathic manipulative treatment and vertigo: a pilot study
Fraix, M.
PM&R: The Journal of Injury, Function and Rehabilitation, 2010/07

800

Anterior superior iliac spine asymmetry assessment on a novel pelvic model: an investigation of accuracy and reliability
Stovall, B. A., Bae, S., Kumar, S.
Journal of Manipulative and Physiological Therapeutics, 2010/06
Free full text



803

Relating a manual medicine diagnostic test of cervical motion function to specific three-dimensional kinematic variables
Bush, T. R., Vorro, J., Alderink, G., Gorbis, S., Li, M., Leitkam, S.
International Journal of Osteopathic Medicine, 2010/06

804

Brief report of a clinical trial on the duration of middle ear effusion in young children using a standardized osteopathic manipulative medicine protocol
Steele, K. M., Viola, J., Burns, E., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text

805

Effect of pedal pump and thoracic pump techniques on intracranial pressure in patients with traumatic brain injuries
Cramer, D., Miulli, D. E., Valcore, J. C., Taveau, J. W., Do, N., Hutton, D. S., Sonti, G., Wogu, E., Boorman, C. F., Panchal, R. R.
The Journal of the American Osteopathic Association, 2010/04
Free full text

806

Biomechanical Disorders in the Patients with Lumbar Discal Hernias and Their Osteopathic Correction
Novoseltsev, S. V., Vcherashny, D. B.
The AAO Journal, 2010/03
Free full text


808

The effect of Osteopathic Treatment on Chronic Constipation – A Pilot Study
Brugman, R., Fitzgerald, K., Fryer, G.
International Journal of Osteopathic Medicine, 2010/03

809

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text

810

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text


812

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text

813

Accreditation standards of DO- and MD-granting medical schools: an incomplete comparison
Hunt, D., Barzansky, B., Sabalis, R.
Academic Medicine, 2010/01
Free full text





818

Perception of osteopathic medicine among allopathic physicians in the deep central southern United States
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text

819


820

NICE clinical guidelines. Low back pain: The early management of persistent non-specific back pain
Vogel, S.
International Journal of Osteopathic Medicine, 2009/12
Free full text






826

Can intraocular pressure be influenced by osteopathic treatment?
van de Kraats, A.
Unpublished MSc thesis, 2009/12
Free full text

827

Discrimination against DOs alive and well
Hoegerl, C.
The Journal of the American Osteopathic Association, 2009/12
Free full text








835

The effects of osteopathic treatment on constipation in children with cerebral palsy: a pilot study
Tarsuslu, T., Bol, H., Simsek, I. E., Toylan, I. E., Cam, S.
Journal of Manipulative and Physiological Therapeutics, 2009/10
Free full text

836

Curricular analysis of competency-based osteopathic medical education: application of a matrix for quality enhancement to a standardized patient encounter example
Lockwood, M. D., Tucker-Potter, S., Sargentini, N. J.
The Journal of the American Osteopathic Association, 2009/09
Free full text



839

Measurement of Cranial Palpation Pressures used by Professional Osteopaths
Zegarra-Parodi, R., De Chauvigny De Blot, P., Rickards, L., Naili, S., Renard, E.
European Journal of Pain, 2009/09
Free full text


841

Inter-examiner reliability of palpation for tissue texture abnormality in the thoracic paraspinal region
Paulet, T., Fryer, G.
International Journal of Osteopathic Medicine, 2009/09





846

The road to becoming an osteopathic physician is long for a good reason
Zubcevik, N.
The Journal of the American Osteopathic Association, 2009/07
Free full text


848

Aufruf Arbeitskreis klinische Osteopathie
(Appeal for a Working Group Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

849

Osteopathie bei akuten Erkrankungen
(Osteopathy for acute diseases)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

850

The appropriate amount of force used must always be individualized for each patient during each treatment session
Abu-Sbaih, R.
The Journal of the American Osteopathic Association, 2009/07
Free full text

851

Comments on cranio-sacral method and efficacy
Blacklaw-Jones, R. D.
International Journal of Osteopathic Medicine, 2009/06

852

Clinical guidelines, adverse events and SQUID
Lucas, N. P., Moran, R.
International Journal of Osteopathic Medicine, 2009/06


854

Monitoring self-reported adverse events: A prospective, pilot study in a UK osteopathic teaching clinic
Rajendran, D., Mullinger, B., Fossum, C., Collins, P., Froud, R.
International Journal of Osteopathic Medicine, 2009/06


856

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text

857

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text

858

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text

859

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text


861

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text

862

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text




866

O efeito imediato da manipulação talocrural na estabilidade unipodal de tornozelo
(Immediate effects of talocrural manipulation on ankle monopodalic stability)
Xavier, M., Pires, V. A., Albertini, R. A., Arrieiro, A. N., Manuard, P., Almeida, L. C., de, Souza R. A.
Revista terapia manual, 2009/05-06

867

The three leaves of Glénard- An examination of a functional aspect
Wolke, N.
Unpublished MSc thesis, 2009/05
Free full text


869

Dual and parallel postdoctoral training programs: implications for the osteopathic medical profession
Burkhart, D. N., Lischka, T. A.
The Journal of the American Osteopathic Association, 2009/03
Free full text

870

Treatment of the monosymptomatic Nocturnal enuresis
Scheible, B.
Unpublished MSc thesis, 2009/03
Free full text


872

What do patients expect, who come to an osteopathic clinic?
Meuser, A.
Unpublished MSc thesis, 2009/02
Free full text



875

Performing Preclerkship Pelvic Examinations Improves Student Perceptions of Clerkship Preparedness
Lievens, A. M., May, L. E.
The Journal of the American Osteopathic Association, 2009/01


877

The effects of lumbar spine high velocity low amplitude thrust (HVLAT) manipulation on upper limb cutaneous blood supply
Sugrue, N., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12

878

Hamo-study ii: effects of sternotomy on the mobility of the heart under influence of respiration
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2008/12

879

The standing flexion test is reproducible but fails to reveal sacroiliac joint ankylosis
Mandara, A., Sosio, S., Di Mattia, C.
International Journal of Osteopathic Medicine, 2008/12


881

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12

882

Multisensory integration in an osteopathic clinical examination setting
Esteves, J. E., Geake, J., Spence, C.
International Journal of Osteopathic Medicine, 2008/12

883

Pilot clinical study of osteopathic manipulative treatment in pregnant patients with acute low back pain
Caragan, C., Tang, P.Y., Slack, M., Leiber, J. D., Koskinen, J., Zust, D., Cragun, T.
International Journal of Osteopathic Medicine, 2008/12


885

COMLEX-USA and in-service examination scores: tools for evaluating medical knowledge among residents
Sevensma, S. C., Navarre, G., Richards, R. K.
The Journal of the American Osteopathic Association, 2008/12
Free full text

886

Investigation of an electromyographic normalization task for the deep thoracic paraspinal muscles
Fryer, G., Bird, M., Robbins, B., Johnson, J. C.
International Journal of Osteopathic Medicine, 2008/12




890




893

End-of-life care curricula in undergraduate medical education: a comparison of allopathic and osteopathic medical schools
Rothman, M. D., Gugliucci, M. R.
American Journal of Hospice and Palliative Care, 2008/10-11

894

Osteopathie bei chronischem Schmerz
(Osteopathy applied to chronic pain patients)
Deichmeier, A., von Fischern, F., Heinbücher, I.
Unpublished D.O. thesis, 2008/10



897

Echinacea purpurea and osteopathic manipulative treatment in children with recurrent otitis media: a randomized controlled trial
Wahl, R. A., Aldous, M. B., Worden, K. A., Grant, K. L.
BMC Complementary and Alternative Medicine, 2008/10
Free full text




901

Osteopathy with Enuresis
Kargl, D.
Unpublished MSc thesis, 2008/09
Free full text

902

Osteopathic Prevention Study in Achievement-orientaded Young Soccer Players
Angleitner, C.
Unpublished MSc thesis, 2008/09
Free full text

903

Intraobserver reliability of cranial strain patterns as evaluated by osteopathic physicians: a pilot study
Halma, K. D., Degenhardt, B. F., Snider, K. T., Johnson, J. C., Flaim, M. S., Bradshaw, D.
The Journal of the American Osteopathic Association, 2008/09
Free full text

904

Clinical and research protocol for osteopathic manipulative treatment of elderly patients with pneumonia
Noll, D. R., Degenhardt, B. F., Fossum, C., Hensel, K.
The Journal of the American Osteopathic Association, 2008/09
Free full text


906

The osteopathic research center will remain key to osteopathic medical profession
Licciardone, J. C., King, H. H., Kearns, C. M.
The Journal of the American Osteopathic Association, 2008/07
Free full text

907

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text

908

Osteopathische Diaphragmen und Wandlungsphasen
(Osteopathic diaphragms and transformation phases)
Wendling, D.
KIM - Komplementare und Integrative Medizin, Ärtztezeitschrift fur Naturheilverfahren, 2008/04

909

The virtual haptic back: a simulation for training in palpatory diagnosis
Howell, J. N., Conatser, R. R., Williams II., R. L., Burns, J. M., Eland, D. C.
BMC Medical Education, 2008/04


911

About the ligaments of the pleural dome
Scheiterbauer, F.
Unpublished MSc thesis, 2008/02
Free full text


913

Growing pains in children- can osteopathy improve the clinical picture?
Kramer, B.
Unpublished MSc thesis, 2008/02
Free full text

914

The Integration of Clinical Reasoning in Osteopathy
Fink-Koller, B.
Unpublished MSc thesis, 2008/02
Free full text

915

OMM education vs “real world“ medicine
Davidson, S. M.
The Journal of the American Osteopathic Association, 2008/02
Free full text

916

Revisiting Castlio and Ferris-Swift's experiments on direct splenic stimulation in patients with acute infectious disease
Noll, D. R., Johnson, J. C., Brooks, J. E.
The Journal of the American Osteopathic Association, 2008/02
Free full text

917

Colleges of osteopathic McMedicine?
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2008/02
Free full text


919

Palpatory diagnosis training on the virtual haptic back: performance improvement and user evaluations
Howell, J. N., Conatser, R. R., Williams, R. L., Burns, J. M., Eland, D. C.
The Journal of the American Osteopathic Association, 2008/01
Free full text

920

Intertester reliability and validity of motion assessments during lumbar spine accessory motion testing
Landel, R., Kulig, K., Fredericson, M., Li, B., Powers, C. M.
Physical Therapy & Rehabilitation Journal, 2008/01
Free full text

921

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text


923

An investigation into the side of joint cavitation associated with cervical spine manipulation
Bolton, A., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/12


925

The influence of osteopathic treatment on the lung function of COPD patients
Grabner, A.
Unpublished MSc thesis, 2007/10
Free full text

926

Examining the Somatic Dysfunction: Lessons Learned in Practice
Danto, J. B., Danto, D. Z., Burns, A. T.
The AAO Journal, 2007/09
Free full text


928

Prolonged Effects of Maximal Effort Exercise (with Valsalva) and Osteopathic Manipulative Treatment in Women with Multiple Sclerosis
Kuchera, M. L., Vardy, T., Yates, H., Stouch, B., Johnson, J. C.
The Journal of the American Osteopathic Association, 2007/08


930

Developing clinical guidelines for the physiotherapy management of whiplash associated disorder (WAD)
Mercer, C., Jackson, A., Moore, A.
International Journal of Osteopathic Medicine, 2007/06

931

Attitudes to back pain amongst musculoskeletal practitioners: a comparison of professional groups and practice settings using the ABS-mp
Pincus, T., Foster, N. E., Vogel, S., Santos, R., Breen, A., Underwood, M.
Manual Therapy, 2007/05

932

Competence levels in musculoskeletal medicine: a call to action
Ruane, J. J.
The Journal of the American Osteopathic Association, 2007/05
Free full text

933

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text


935

Unexplained Subfertility and Osteopathic Treatment
Kapper, A.
Unpublished MSc thesis, 2007/03
Free full text

936

Dysgnathia as a correlative to an SBS – Lesion?
Krenner, E.
Unpublished MSc thesis, 2007/03
Free full text

937

Temporomandibular- and Hip Joint - an Osteopathic Relation?
Brenner, E.
Unpublished MSc thesis, 2007/03
Free full text


939





943

The Effectiveness of Osteopathic Treatment in Perimenopause
Zanon, B.
Unpublished MSc thesis, 2007/03
Free full text


945

Examination of Refraction in Myopia - An Osteopathic Treatment Approach
Bayer, C.
Unpublished MSc thesis, 2007/03
Free full text

946

The Influence of osteopathy on the vegetative nervous system in chronic pain patients
Fürpaß, E.
Unpublished MSc thesis, 2007/03
Free full text



949

Does an osteopathic treatment influence the human voice?
Hempel, G.
Unpublished MSc thesis, 2007/03
Free full text

950

Osteopathy in idiopathic sudden hearing loss
Staffa, U.
Unpublished MSc thesis, 2007/03
Free full text






956

Comparison between CV4 and EV4 via Biofeedback-measurement
Grill, M.
Unpublished MSc thesis, 2007/01
Free full text

957

Does Osteopathy Influence Diabetes Mellitus Type II?
Kiegerl, G.
Unpublished MSc thesis, 2007/01
Free full text

958

Status post abortus - Usefulness of osteopathic treatment after miscarriage
Krasser, E.
Unpublished MSc thesis, 2007/01
Free full text

959

Osteopathic Treatment During Transition of Perimenopause
Mückler, A.
Unpublished MSc thesis, 2007/01
Free full text

960

Influence of Osteopathic Treatment on Congestive Menstrual Disorders and Premenstrual Syndrome
Riepler-Reisecker, I.
Unpublished MSc thesis, 2007/01
Free full text

961

Observation Cv4-technique - Hypertension Hypertension - Osteopathic Disfunctions
Schögler, M.
Unpublished MSc thesis, 2007/01
Free full text

962

Touching Reliability
Sommerfeld, P.
Unpublished MSc thesis, 2007/01
Free full text



965

Osteopathy and the Breech Presentation after 30 Weeks of Gestation
Georgiades, O.
Unpublished MSc thesis, 2007/01
Free full text

966

The influence of sitting position on (ventro-) dorsal head translation
Hoffmann, F.
Unpublished MSc thesis, 2007/01
Free full text

967

Along The Dura Mater in Patients with Multiple Sclerosis
Toth, A.
Unpublished MSc thesis, 2007/01
Free full text


969

Osteopathy and Tinnitus
Plamberger, M.
Unpublished MSc thesis, 2007
Free full text



972

Stretch reflex and Hoffmann reflex responses to osteopathic manipulative treatment in subjects with Achilles tendinitis
Howell, J. N., Cabell, K. S., Chila, A. G., Eland, D. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text

973

Interexaminer reliability of three methods of combining test results to determine side of sacral restriction, sacral base position, and innominate bone position
Tong, H. C., Heyman, O. G., Lado, D. A., Isser, M. M.
The Journal of the American Osteopathic Association, 2006/08
Free full text

974

The Effect of CV-4 Upon Cutaneous Bloodflow Velocity
Nelson, K. E., Sergueef, N., Glonek, T.
The Journal of the American Osteopathic Association, 2006/08

975

The Role of Osteopathic Manipulative Treatment in the Treatment of Fibromyalgia Syndrome
Yahnert, J. L., Hartman, R. J., Stewart, P. E., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/08


977

Future of osteopathic medicine depends on investing in graduate medical education
Tosca, M.
The Journal of the American Osteopathic Association, 2006/07
Free full text

978

OMT: evidence, research, and practice
McCombs, T. M.
The Journal of the American Osteopathic Association, 2006/07
Free full text

979

Maintaining competence and leadership in manual medicine
Beal, M. C.
The Journal of the American Osteopathic Association, 2006/06
Free full text

980

Competence levels in musculoskeletal medicine: comparison of osteopathic and allopathic medical graduates
Stockard, A. R., Allen, T. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text


982

Survey on the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, J. R., Weidner, A. C.
The Journal of the American Osteopathic Association, 2006/05
Free full text

983

Investigation into the affectivity on cutaneous blood perfusion of different application time lengths of cold hydrotherapy
Crossland, S., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2006/03

984

Recurring Limitations in OMT Research
Cardarelli, R.
The Journal of the American Osteopathic Association, 2006/03
Free full text

985

Trunk and limb muscle activity during the application of a mobilisation type force to the vertebral column
Blaich, R., Ginn, K., Cathers, I., Lee, M.
International Journal of Osteopathic Medicine, 2006/03

986

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain: A pilot study
Alvizatos, J., Lamaro, J., Fryer, G.
International Journal of Osteopathic Medicine, 2006/03

987

Reliability of visual assessment for lumbar curves in standing: Does clinical experience matter?
Moran, R. W., Ljubotenski, E.
International Journal of Osteopathic Medicine, 2006/03


989

The electromyographic activity of thoracic paraspinal muscles identified as abnormal with palpation
Fryer, G., Morris, T., Gibbons, P., Briggs, A.
International Journal of Osteopathic Medicine, 2006/03

990

Electromyographic characteristics of deep, thoracic paraspinal musculature
Fryer, G., Morris, T., Gibbons, P., Briggs, A.
International Journal of Osteopathic Medicine, 2006/03

991

(Osteopathic treatment of newborns with sucking dysfunction)
Mahdi, S.
Osteopathische Medizin, 2006/02
Free full text

992

Osteopathic Preparation of Birth
Reiter-Horngacher, M.
Unpublished MSc thesis, 2006/01
Free full text


994

Revisiting Castlio and Ferris-Swift's experiments testing the effects of splenic pump in normal individuals
Noll, D. R., Johnson, J. C.
International Journal of Osteopathic Medicine, 2005/12




998

Interobserver reliability of osteopathic palpatory diagnostic tests of the lumbar spine: improvements from consensus training
Degenhardt, B. F., Snider, K. T., Snider, E. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2005/10
Free full text



1001

Hemodynamic effects of osteopathic manipulative treatment immediately after coronary artery bypass graft surgery
Olivencia-Yurvati, A. H., Carnes, M. S., Clearfield, M. B., Stoll, S. T., McConathy, W. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text




1005

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1006

The active knee extension test and Slump test in subjects with perceived hamstring tightness
Kuilart, K. E., Woollam, M., Barling, E., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09

1007

Effects of CV4 manipulation on oxidative stress biomarkers
Campomanes, C., Bixby, M., Shore, K., Larkin, J., Binkerd, J., Menini, T.
The Journal of the American Osteopathic Association, 2005/07

1008

CV4 technique as a tool to decrease psychological stress in osteopathic medical students
Shah, A., Donaldson, N., Campomanes, C., Barragan, H., Menini, T., Binkerd, J.
The Journal of the American Osteopathic Association, 2005/07

1009

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain: A pilot study
Fryer, G., Alvizatos, J., Lamaro, J.
International Journal of Osteopathic Medicine, 2005/06

1010

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text

1011

Outpatient Osteopathic SOAP Note Form: preliminary results in osteopathic outcomes-based research
Sleszynski, S. L., Glonek, T.
The Journal of the American Osteopathic Association, 2005/04
Free full text

1012

AOA's position against use of placebos for pain management in end-of-life care
Nichols, K. J., Galluzzi, K. E., Bates, B., Husted, B. A., Leleszi, J. P., Simon, K., Lavery, D., Cass, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1013

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament: part 2. Effect of sex differences and manipulative “priming“
Sucher, B. M., Hinrichs, R. N., Welcher, R. L., Quiroz, L. D., St Laurent, B. F., Morrison, B. J.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1014

Expanded Spinal Flexion Test: A New Palpatory Tool for LBP Analysis or an Old Test Revisited?
McTurk, P. T., Harding, H. H.
The AAO Journal, 2005/03
Free full text

1015

The relationship between palpation of thoracic tissues and deep paraspinal muscle thickness
Fryer, G., Morris, T., Gibbons, P.
International Journal of Osteopathic Medicine, 2005/03

1016

Hysteresis as a measure of ankle dysfunction
Cohen, A. M., Mertz, J., Stewart, P., Warner, M. J., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/01
Free full text








1024

Cranial Manipulation Induces Sequential Changes in Blood Flow Velocity on Demand
Nelson, K. E., Sergueef, N., Glonek, T.
The AAO Journal, 2004/09
Free full text


1026

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text



1029

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

1030

Assessing the ability of medical students to perform osteopathic manipulative treatment techniques
Boulet, J. R., Gimpel, J. R., Dowling, D. J., Finley, M.
The Journal of the American Osteopathic Association, 2004/05
Free full text

1031

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text

1032



1034

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text


1036

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text

1037

Accuracy of the OMRON M4 automatic sphygmomanometer
Clarke, A.
Unpublished MSc thesis, 2004/01
Free full text



1040

Neuromusculoskeletal Medicine/ OMM: Useful to ALL DOs
van Buskirk, R. L.
The AAO Journal, 2003/12
Free full text


1042

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11







1049

Lumbar Rotation Range of Motion with Lumbar Osteopathic Manipulative Treatment
Shamus, E., Patterson, M. M., Carter, K.
The Journal of the American Osteopathic Association, 2003/08

1050

Emergency medicine resident work productivity and procedural accomplishment
Deveau, J. P., Lorenz, J. E., Hughes, M. J.
The Journal of the American Osteopathic Association, 2003/06
Free full text

1051

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text

1052


1053

Using National Medical Care Survey data to validate examination content on a performance-based clinical skills assessment for osteopathic physicians
Boulet, J. R., Gimpel, J. R., Errichetti, A. M., Meoli, F. G.
The Journal of the American Osteopathic Association, 2003/05
Free full text

1054

Osteopatia in neonatologia
(Osteopathy in neonatology)
Colli, R., Biagiotti, I., Sterpa, A.
La Pediatria medica e chirurgica : Medical and surgical pediatrics, 2003/03

1055

Failure to convince osteopathic medical students of OMT's worth increases risk of subspecialization
Corbett, R. M.
The Journal of the American Osteopathic Association, 2003/02
Free full text

1056

Clinical thinking: does your choice of university make a difference?
Harris, M.
Unpublished MSc thesis, 2003/01
Free full text

1057

The effect of prophylactic ankle braces on postural sway
Hellyer, D.
Unpublished MSc thesis, 2003/01
Free full text

1058

Peak pressure under the forefoot in classical ballet
Mamone, A.
Unpublished MSc thesis, 2003/01
Free full text

1059


1060

Sacroiliac joint assessment within the Australian osteopathic profession
Peace, S.
Unpublished MSc thesis, 2003/01
Free full text

1061

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

1062

Improving the oral health knowledge of osteopathic medical students
Skelton, J., Smith, T. A., Betz, W. T., Heaton, L. J., Lillich, T. T.
Journal of Dental Education, 2002/11

1063

State of the art in standardized patient programs: a survey of osteopathic medical schools
Errichetti, A. M., Gimpel, J. R., Boulet, J. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1064

The effect of cranial manipulation on the Traube-Hering-Mayer oscillation as measured by laser-Doppler flowmetry
Sergueef, N., Nelson, K. E., Glonek, T.
Alternative Therapies in Health and Medicine, 2002/11

1065

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text



1068

Common Mother-Infant Treatment. A Way to Attachment Security
Kreutz, M.
Unpublished MSc thesis, 2002/10






1074

Osteopathy for Back- and Pelvic Pain in Pregnancy
Kofler, G.
Unpublished MSc thesis, 2002/09
Free full text

1075

Understanding the Combined Motions of the C3/C4 Vertebral Unit: A Further Look at Fryette's Model of Cervical Biomechanics
Capobianco, J. D., Protopapas, M. G., Rivera-Martinez, S.
The AAO Journal, 2002/09
Free full text

1076

Students', Interns' and Residents' Comfort and Confidence With Their OMT Skills
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2002/09

1077

Student performance on the Comprehensive Osteopathic Medical Licensing Examination-USA level 2 following a clinical evaluation, feedback, and intervention program
Agostini, D. E., Stano, A. S., Parente, D. H.
The Journal of the American Osteopathic Association, 2002/09
Free full text

1078

Joint Kinetic Parameters as Indicators of Osteopathic Manipulative Treatment Effect in Osteoarthritis of the Knee
Kilbury Nason, L. L., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
The Journal of the American Osteopathic Association, 2002/08


1080

Effects of osteopathic manipulative treatment and concentric and eccentric maximal-effort exercise on women with multiple sclerosis: a pilot study
Yates, H. A., Vardy, T. C., Kuchera, M. L., Ripley, B. D., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text


1082

The Impact of Osteopathic Manipulative Medicine On Inpatient Outcomes
Klock, G. B.
The AAO Journal, 2002/03
Free full text

1083

Improved Pain Score Outcomes Achieved Through The Cooperative And Cost-Effective Use Of Physical (Osteopathic Manipulative) Medicine In The Treatment Of Outpatient Musculoskeletal Complaints
Lipton, J. A., Meneses, P., Martin, J. B., Mizera, A. C., Kappler, R. E., Brooks, J. S., Parr, C.
The AAO Journal, 2002/03
Free full text

1084

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text

1085

Identifying competencies for effective osteopathic physicians in the 21st century
Walrod, S.
Unpublished PhD thesis, 2002/01
Free full text




1089

Leukemia immune changes following massage therapy
Field, T., Cullen, C., Diego, M., Hernandez-Reif, M., Sprinz, P., Beebe, K., Kissell, B., Bango-Sanchez, V.
Journal of Osteopathic Medicine, 2001/10

1090

Examining diagnostic tests: An evidence-based perspective
Fritz, J., Wainner, R.
Journal of Osteopathic Medicine, 2001/10


1092

The effective forces transmitted by high-speed, low-amplitude thoracic manipulation
Herzog, W., Kats, M., Symons, B.
Journal of Osteopathic Medicine, 2001/10

1093



1095

Intra-examiner and inter-examiner reliability of a positional diagnostic screen for the lumbar spine
Spring, F., Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10

1096

Pain and muscular responses to a neural tissue provocation test in the upper limb
van der Heide, B., Allison, G. T., Zusman, M.
Journal of Osteopathic Medicine, 2001/10


1098

Osteopathic treatment in rehabilitation of whiplash injury
Stockinger, V.
Unpublished MSc thesis, 2001/10

1099

Decline in structural examination compliance in the hospital medical record with advancing level of training
Essig-Beatty, D. R., Klebba, G. E., LaPointe, N. G., Miller, E. D., Strong, R. E.
The Journal of the American Osteopathic Association, 2001/09
Free full text

1100

Effect of Lymphatic Pump Techniques On The Immune Response to Influenza Vaccine
Dugan, E. P., Lemley, W. W., Roberts, C. A., Wager, M., Jacksen, K. M.
The Journal of the American Osteopathic Association, 2001/08

1101

The Evaluation of the Effect of Osteopathic Manipulative Techniques (OMT) on Headache Pain
Flotildes, K. L.
The Journal of the American Osteopathic Association, 2001/08

1102

Signifying what?
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1103

Sixty-five pieces of silver
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text


1105

The concept of function in osteopathy and conventional medicine: a comparative study
Tyreman, S. J.
Unpublished PhD thesis, 2001/06
Free full text

1106

Inter-examiner reliability of the Johnson and Friedman percussion scan of the thoracic spine
Ghoukassian, M., Nicholls, B., McLaughlin, B.
Journal of Osteopathic Medicine, 2001/04




1110

Centralization phenomenon as a prognostic factor for chronic low back pain and disability
Werneke, M., Hart, D. L.
Journal of Osteopathic Medicine, 2001/04


1112

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text

1113

Electromyographic studies of structural abnormalities. 1941
Denslow, J. S., Clough, G. H.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1114

On becoming a doctor
Kelly, M.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1115

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1116

Collaboration on research picks up steam
Dyer, M. J., Wood, D. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text

1117

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1118

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1119

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1120

The clinical spectrum of acute coronary syndromes
Rogers, F. J.
The Journal of the American Osteopathic Association, 2000/11
Free full text



1123

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text

1124

Objectivity and accuracy of mammogram interpretation using the BI-RADS final assessment categories in 40- to 49-year-old women
McKay, C., Hart, C. L., Erbacher, G.
The Journal of the American Osteopathic Association, 2000/10
Free full text


1126

Standing flexion test study
Kappler, R. E.
The AAO Journal, 2000/09
Free full text

1127

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1128



1130

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09

1131

Osteopathic Manipulation in the Management of Parkinson's Disease
Wells, M. R., McCarty, C. L., Smutny, C. J., Scandalis, T. A., Dittrich, F., Fazzini, E. A.
The Journal of the American Osteopathic Association, 2000/08

1132

Comparison of osteopathic and allopathic results in dementia praecox. 1933
Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text

1133

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05

1134

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02


1136

Benign prostatic hyperplasia treated with saw palmetto: a literature search and an experimental case study
McPartland, J. M., Pruitt, P. L.
The Journal of the American Osteopathic Association, 2000/02
Free full text

1137

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02

1138

Pilot study relating pulmonary function to leg length inequality
Crosby, C. J.
The AAO Journal, 1999/12
Free full text



1141

New England Journal of Medicine article may be misleading about OMT
Coughlin, P., Kriebel, R., Fogel, R.
Journal of Osteopathic Medicine, 1999/11
Free full text



1144

Making a difference: the osteopathic approach lecture series
Danto, J. B., Kavieff, T. R.
Journal of Osteopathic Medicine, 1999/03
Free full text

1145

Standard osteopathic manipulative treatment acutely improves gait performance in patients with Parkinson's disease
Wells, M. R., Giantinoto, S., D'Agate, D., Areman, R. D., Fazzini, E. A., Dowling, D., Bosak, A.
Journal of Osteopathic Medicine, 1999/02
Free full text


1147



1149

Musculoskeletal examination needs to be a matter of habit
Richardson, M. E.
Journal of Osteopathic Medicine, 1997/06
Free full text

1150

Variables influencing the use of osteopathic manipulative treatment in family practice
Johnson, S. M., Kurtz, M. E., Kurtz, J. C.
Journal of Osteopathic Medicine, 1997/02
Free full text

1151

Osteopathic manipulative treatment: student attitudes before and after intensive clinical exposure
Magnus, W. W., Gamber, R. G.
Journal of Osteopathic Medicine, 1997/02
Free full text

1152

Late-life depression in primary care. How well are we doing?
Banazak, D. A.
Journal of General Internal Medicine, 1996/03

1153

Curriculum goals for the training of osteopathic family practice residents for the year 2000
Dickerman, J., Rich, P.
The Journal of the American Osteopathic Association, 1996/03
Free full text

1154

The safety of manipulative treatment: review of the literature from 1925 to 1993
Vick, D. A., McKay, C., Zengerle, C. R.
The Journal of the American Osteopathic Association, 1996/02
Free full text

1155

Hospital guidelines for diagnosis-related groups/osteopathic manipulative treatment
Feely, R. A.
The Journal of the American Osteopathic Association, 1995/09
Free full text

1156

The Effect of Osteopathic Manipulative Treatment in the Post Abdominal Surgical Patient (A Preliminary Study)
Pratt-Harrington, D., Neptune-Ceran, R.
The AAO Journal, 1995/09
Free full text

1157

A standardized form for DSM-IV review of symptoms and mental status examination for students and residents
Reeves, R. R., Bullen, J. A.
The Journal of the American Osteopathic Association, 1995/06
Free full text

1158

Palpatory diagnosis and manipulative management of carpal tunnel syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 1994/08
Free full text


1160

Effect of clerkship training at rural sites on students' clinical skills
Brandau, D., Heun, L.
Academic Medicine, 1994/08
Free full text

1161

Effects of osteopathic manipulative treatment in patients with cervicothoracic pain: pilot study using thermography
Walko, E. J., Janouschek, C.
The Journal of the American Osteopathic Association, 1994/02
Free full text

1162

Outcomes assessment: 'buzz words' in medical education whose time has come
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/03
Free full text

1163

Efficacy of high-velocity low-amplitude manipulative technique in subjects with low-back pain during menstrual cramping
Boesler, D., Warner, M., Alpers, A., Finnerty, E. P., Kilmore, M. A.
The Journal of the American Osteopathic Association, 1993/02
Free full text


1165

Four approaches to using patients to teach and evaluate clinical skills of residents, interns, and students
Medio, F. J., Morewitz, S. J.
The Journal of the American Osteopathic Association, 1992/11
Free full text

1166

HIV clinical training enhances DOs skills in the fight against AIDS
Macher, A. M., Fernandez, E. S., Rivo, M. L., Mullan, F.
The Journal of the American Osteopathic Association, 1992/06
Free full text

1167

Training osteopathic medical students in behavioral medicine and psychiatry
Magen, J.
The Journal of the American Osteopathic Association, 1992/05
Free full text

1168

The Value of Some Clinical Tests of the Sacroiliac Joint
van Deursen, L. L. J. M., Patijn, J., Ockhuysen, A. L., Vortman, B. J.
The AAO Journal, 1991/09
Free full text


1170

Development of an Expert System to Teach Diagnostic Skills
Elieson, S. W.
Unpublished PhD thesis, 1990/08
Free full text

1171

The effect of helium-neon laser and osteopathic manipulation on soft-tissue trigger points
Greene, C. H., DeBias, D. A., Helig, D., Nicholas, A. S., England, K., Ehrenfeuchter, W., Young, W. L.
The Journal of the American Osteopathic Association, 1990/07
Free full text

1172

An open controlled assessment of osteopathic manipulation in nonspecific low-back pain
MacDonald, R. S., Bell, C. M. J.
Spine (Phila Pa 1976.), 1990/05





 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends