Advanced search



 
 79.6% of the records
 
 20.4 % of the records
 
 57.9 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumablack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxishair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

3081 results (please see below)  Sort:    
1

Reliability of spinal palpation for diagnosis of back and neck pain: a systematic review of the literature
Seffinger, M. A., Najm, W. I., Mishra, S. I., Adams, A., Dickerson, V. M., Murphy, L. S., Reinsch, S.
Spine (Phila Pa 1976), Oct 1
2

ОСТЕОПАТИЯ КАК ИННОВАЦИОННЫЙ ВЕКТОР В ВОССТАНОВИТЕЛЬНОЙ И СПОРТИВНОЙ МЕДИЦИНЕ
Osteopathy as an innovative Approach to Rehabilitation and Sports Medicine
Vovkogon, A., Sankova, M., Nikolenko, V., Oganesyan, M., Gridin, L.
Human Sport Medicine, 23/08
Free full text
3

The Standing Forward Flexion Test in Manual Therapy: A Critical Review and a Functional Reinterpretation
Colonna, S., Casacci, F.
Cureus, 2026/01
Free full text
4

Race, ethnicity, and gender discrepancies between allopathic and osteopathic otolaryngology trainees from 2015 to 2023
Minutello, K. M., Nicks, S. L., Gillette, B. T., Hasan, S., Shermetaro, C. B.
Journal of Osteopathic Medicine, 2026/01
Free full text
5

Allopathic resident prevalence in orthopedic residency programs formerly accredited by the American Osteopathic Association during single accreditation
Murray, J. B., Balazs, G. C., Speicher, M. R., Olsen, A. A.
Journal of Osteopathic Medicine, 2026/01
Free full text
6

Osteopathic manipulative treatment for enhanced pitch performance in collegiate baseball players: a feasibility study on shoulder and hip interventions
Rosten, C., Brown, S., Nandedkar, T., Pearson, A., Worthington, E., Fastring, D.
Journal of Osteopathic Medicine, 2026/01
Free full text
7

Incorporation of virtual reality into medical physiology
Benmerzouga, I., Oviawe, E.
Advances in Physiology Education, 2026/01
Free full text
8

Effectiveness of the Spencer technique on pain, disability and range of motion in patients with frozen shoulder: A systematic review and meta-analysis with meta-regression of randomized controlled trials
Tsai, Y. Y., Chen, Y. J., Lin, L. H.
Physiotherapy Theory and Practice, 2026/01
9

A.T. Stills „Finding health …“ – Ad fontes!
Dippon, M.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
10

Im Gespräch mit … Christian Schwartzkopf
(In dialog with Christian Schwartzkopf)
Mihajlovic, Z., Schwartzkopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
11

Editorial
Wikus, P.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
12

Psychosoziale Aspekte chronischer Schmerzen aus interdisziplinärer Perspektive
Zöller, E., Feld, K.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
13

The influence of osteopathic correction on the functional activity of the palatine tonsils in the complex therapy of chronic tonsillitis
(Влияние остеопатической коррекции на функциональную активность нёбных миндалин в комплексной терапии хронического тонзиллита)
Vedyashkina, A. S., Mokhov, D. E., Dmitrieva, I. A.
Russian Osteopathic Journal, 2025/12
14

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/12
Free full text
15

Analysis of hepatitis B immunity in vaccinated medical students
Gentile, N., Aghera, C., Smith, H., Mazzoleni, S., Redden, D., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2025/12
Free full text
16

Examiner reliability of a systematic osteopathic musculoskeletal examination model in patients with stroke: results from the SOMADC-AC study
Yee, A. H., Brooks, W. J., Palchik, G. A., Akers, B., Li, Y., Dossett, M. L.
Journal of Osteopathic Medicine, 2025/12
17

Mit viel Improvisation und Empathie: Osteopathische Behandlung im Rahmen humanitärer Hilfsprojekte.
(With a lot of improvisation and empathy: Osteopathic treatment within the framework of humanitarian aid projects)
Bauer, C., Prediger, G.
Osteopathische Medizin, 2025/12
18

General Osteopathic Treatment: Status quo – Teil 2
(General Osteopathic Treatment: Status Quo – Part 2)
Engel, M.
Osteopathische Medizin, 2025/12
19

Analyzing Medical Student Knowledge Regarding Nutrition
Barros, M., Weir, S.B., Bennett, A.
Journal of Osteopathic Medicine, 2025/12
20

Zwischen Evidenz und Empfinden
(Between evidence and perception)
Franke, H.
Osteopathische Medizin, 2025/12
21

Physician and Resident Physician knowledge of childhood obesity management guidelines
Chaar, S., Chaaban, A., Bitar, R., Hill Guseman, E.
Journal of Osteopathic Medicine, 2025/12
22

Addressing Chronic Disease Burden and Healthcare Access Gaps in People Experiencing Homelessness: A Community-Based Study Through Osteopathic Medical Student-Led Interventions in Detroit
Figueroa, K., Nallabelli, N., Abu-Zama, A., Bryce, R., Restini, C.
Journal of Osteopathic Medicine, 2025/12
23

Characterization and comparison of osteopathic medical student performance in pathology and laboratory medicine: an analysis of competency in an integrated organ-systems curriculum
Harp, E., Hughes, G.
Journal of Osteopathic Medicine, 2025/12
24

Effects of Lymphatic Pump Treatment and Methotrexate in Arthritis Development and Behavior in Rats with Adjuvant-Induced Arthritis
Kafkis, C., Tamane, S., Manuel, M. J., Zanotti, B., Del Toro, R. M., Incrocci, R., Swanson-Mungerson, M., Volin, M. V.
Journal of Osteopathic Medicine, 2025/12
25

Within-Pair Association Between Central Obesity and the Onset of General Obesity Over 17 Years Among Male Twins Discordant for Incident Obesity: Implications for Osteopathic Manipulative Treatment in Obesity Management
Kim, W. S., Blum, D., Dai, J.
Journal of Osteopathic Medicine, 2025/12
26

Supporting Early Osteopathic Treatment Through Automated Grading of Knee Osteoarthritis
Lois, D.
Journal of Osteopathic Medicine, 2025/12
27

Osteopathic Medical Students’ Perspectives on Osteopathic Manipulative Therapy during Third- Year Clerkships: A Cross-sectional Study of Three Osteopathic Medical Schools
Longley, S., Spears, E., Domingo, F. S., Kymes, E., Dixon, C., Weir, S.B.
Journal of Osteopathic Medicine, 2025/12
28

Public Perception of Osteopathic Manipulative Medicine (OMM) as an Effective Treatment for Musculoskeletal Disorders: A Survey Study
Patel, K., Persaud, N. A., Ganti, L.
Journal of Osteopathic Medicine, 2025/12
29

D.O. Podcast Increases Pre-Medical Student Knowledge and Attitudes Toward Osteopathic Medicine
Sullivan, V. E., D'Amelio, M. P., Storch, I. M., van Rooyen, D. R., Storch, N. C., Callaway, C. A., Pierce-Talsma, S. L., Hauler, J. J.
Journal of Osteopathic Medicine, 2025/12
30

Osteopathic Medical Education and Treatment: Changes in Perspective Through the Lens of Standardized Patients
Thompson, T. R., Craun, W. D., Strickland Creech, T., Parks, J. M., Nolin, J. R.
Journal of Osteopathic Medicine, 2025/12
31

Perceptions of Campus Climate and Inclusivity Among LGBTQIA+ Osteopathic Medical Students: A Cross-Sectional Study
Varin, P., Temucin, S., Reese, A., Florescu, N., Grace, C., Bettiker, R., Sonneville, K., Fiscus, V., Tanaka, L.A.
Journal of Osteopathic Medicine, 2025/12
32

Comment on “Immediate effects of three different upper trapezius trigger point techniques on pain intensity and pressure threshold in students with cervical pain: a randomized clinical trial”
Wei, Y., Wei, H., Wang, Y.
International Journal of Osteopathic Medicine, 2025/12
33

Response to Letter to the Editor “Repositioning Menstrual Pain Management: Multidisciplinary Collaboration and Cultural Sensitivity as Key Priorities” about the article “Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., & Arnal-Gómez, A. (2025). Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial. International Journal of Osteopathic Medicine, 56, 100761.”
Espí-López, G. V.
International Journal of Osteopathic Medicine, 2025/12
34

Improving the Reproducibility of the Standing Forward Flexion Test After Specific Training: A Cross-Sectional Study
Colonna, S, D'Alessandro, A., Pozzati, F., Venturi, M., Andrenacci, V., Romeo, D.
Cureus, 2025/12
Free full text
35

Using Generative Artificial Intelligence (AI) to Compare Commission on Osteopathic College Accreditation (COCA) and Liaison Committee on Medical Education (LCME) Standards
Hedrick, J. S., Cottrell, S. A., Nield, L. S., Ferrari, N.
Cureus, 2025/12
Free full text
36

Le dessin ostéopathique des atteintes corporelles : une clinique émersive
(Osteopathic drawings of bodily injuries: An immersive clinical experience)
Jacquot, E., Paintendre, A., Andrieu, B.
Evolution Psychiatrique, 2025/12
37

From guidelines to practice: collective learning through clinical audit of the IFOMPT cervical framework
Bailey, D., Fawkes, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2025/12
38

Barriers and facilitators to the use of Patient Reported Outcome Measures by Australian osteopaths
Eaves, S., Kalatzis, G.
International Journal of Osteopathic Medicine, 2025/12
39

The effect of exercise on fatigue in rheumatoid arthritis: a systematic review and meta-analysis of randomized controlled trials
Jiang, X., Yu, L., Yan, Y., Zhou, S., Zheng, Q.
International Journal of Osteopathic Medicine, 2025/12
40

Effectiveness of manual therapy vs conventional physical therapy with neuromuscular training in the management of knee osteoarthritis: A randomized clinical controlled trial
Pakkir Mohamed, S. H., Albalawi, H. F., Nambi, G., Shalabi, K. M., Albalawi, M. O.
International Journal of Osteopathic Medicine, 2025/12
Free full text
41

Gut-Brain Axis in Inflammatory Bowel Disease: Pathogenesis and Therapeutics
Perry, S., Pillarisetti, L., Gelfman, T., Agrawal, D. K.
Archives of Internal Medicine Research, 2025/12
Free full text
42

Educating tomorrow’s osteopaths and the crucial role of ethics teaching. Where we are now? A position paper of the Italian Academy of Osteopathic Medicine
Ferioli, E.
Medicina e Morale, 2025/12
43

The metaverse as a pedagogical clinic: Re-envisioning human presence, empathy, and touch in digital care training
Amalia, R.
International Journal of Osteopathic Medicine, 2025/12
44

From the Editor: To Love, Life, and Osteopathy
Ching, L. M.
AAO Journal, 2025/12
45

Autonomic Rehabilitation: Cardiovagal and Autonomic Impacts of Post Isometric Muscle Energy at the Upper Cervical Spine
Miller, A., Curran, C., Fanous, S., Nakashima, T., Yates, H., Johns, J., Fotopoulos, T., Gustin, D., Wilson, J., McAllister, J., Moon, J., Thornburgh, K., Wenner, A., Garg, R., Gharbo, R.
AAO Journal, 2025/12
46

Assessing content validity of the Osteo-TAQ(Aus) using cognitive interviews: cross-jurisdictional evidence from UK osteopathic practice​​
Thomson, O. P., Golder, E., McLeod, G. A., Draper-Rodi, J., Vogel, S., Vaughan, B.
BMC Research Notes, 2025/12
Free full text
47

Manual therapy in preoperative preparation of patients with knee arthroplasty
(Мануальная терапия в предоперационной подготовке пациентов с эндопротезированием коленного сустава)
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/12
48

Immediate Effects of Osteopathic Manipulative Therapy on Thoracoabdominal Mobility, Respiratory Muscle Strength and Pulmonary Function in Healthy Men: Preliminary Crossover Trial
Zago, J., Rondinel, T., Urueña, B., Amatuzzi, F., Queiroz, R., Nascimento, L., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2025/11
49

Cancer Prevention and Therapy With Nutritional Science: Addressing the Gap in Medical Education and Practice
Collignon, T. E., Bishayee, A.
MedComm, 2025/11
Free full text
50

DO and MD Enrollment in U.S. Dermatology Residencies Following the Graduate Medical Education Merger: Implications for Access
Park, L., Beach, S., Glick, B. P., Benedetto, A. V.
Clinical Dermatology, 2025/11
51

Osteopathic manipulative treatment in the management of headaches associated with musculoskeletal dysfunction: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Ying-Fang Wang, M., Johnston, R., Will, M., Gibson, E., Spencer, D., Garcia, C., Snider, K. T.
Journal of Osteopathic Medicine, 2025/11
Free full text
52

Osteopathie bei Transidentität - Eine Einzelfallstudie zum Einfluss auf Lebensqualität, Cortisolwerte und Wohlbefinden bei einem transgender Jugendlichen unter Hormontherapie
(Osteopathy in Transgender Identity - A Single-Case Study on the Impact on Quality of Life, Cortisol Levels, and Well-being in a Transgender Adolescent Undergoing Hormone Therapy)
Gugatschka, N.
Unpublished MSc thesis, 2025/11
53

Use of osteopathic manipulation techniques for management of acute otitis media in pediatric patients: a scoping review
Kim, C. H.S., McCray, L. R., Nguyen, S. A., Shermetaro, C., Robbins, W. K.
European Archives of Oto-Rhino-Laryngology, 2025/11
Free full text
54

Osteopathische Behandlungsansätze bei gastrointestinalen Beschwerden
(Osteopathic treatment approaches for gastrointestinal complaints)
Leitner, S.
Unpublished MSc thesis, 2025/11
55

Reliabilität des faszialen Beckentests in der globalen osteopathischen Befundung
(Reliability of the fascial pelvic test in the global osteopathic assessment)
Meissl, A.
Unpublished MSc thesis, 2025/11
56

EXPRESS: Differences in Attitudes among Health Professions Students and Educators toward People Experiencing Homelessness: Novel Correlations with Physical Comfort, Prior Experiences, and Interest in Learning
Gilmore, E., Szeto, C., Spector, E., Shono, Y., Pumerantz, A.
Journal of Investigative Medicine, 2025/11
57

Assessing eating disorder education in U.S. medical schools: a qualitative content analysis of lecture slides
Laboe, A. A., Pictor, L. E., Gavuji, M., Temucin, S., Kreynin, A., Sheil, E., Jourdan, B., Schaumberg, K., Davis, H., Harrop, E. N.
Eating and Weight Disorders, 2025/11
Free full text
58

Evaluation of Craniosacral Therapy Effects on Brain Wave Patterns in Children with Mild Autism Spectrum Disorder Using the QEEG Method
Kopańska, M., Szczygielski, J., Batrman, P., Banaś-Ząbczyk, A.
Acta Neuropsychologica, 2025/10
Free full text
59

Affirmative Action Repeal and Racial and Ethnic Diversity in US Medical School Admissions
Florescu, N., Lin, A., Temucin, S., Rae, L.
JAMA Network Open, 2025/10
Free full text
60

Necrobiosis lipoidica arising in a port wine stain treated with topical ruxolitinib
Edupuganti, N., Nguyen, J., Siddiqui, F., Dukharan, V., Nathoo, R.
Journal of Osteopathic Medicine, 2025/10
Free full text
61

European research Priorities for Osteopathic Care (PROCare): a sequential exploratory investigation and survey
Vaucher, P., Carnes, D., Hohenschurz-Schmidt, D., Thomson, O., Vogel, S., Arienti, C., Bright, P., Alvarez Bustins, G., Esteves, J., Koch Esteves, N., Fawkes, C., Rinne, S., Roura, S., Treffel, L., Wagner, A., Draper-Rodi, J.
BMJ Open, 2025/10
Free full text
62

Do patients with renal calculi exhibit viscerosomatic reflexes as evident on CT imaging?
Haughton, D. R., Gupta, A. K., Nasir, B. R., Kania, A. M.
Journal of Osteopathic Medicine, 2025/10
Free full text
63

Enhancing Embryology Education Through Virtual Reality: A Pilot Study
Quiñones-Rodríguez, J., Rice, R., Mayer, W., Marchelli, G., Bouchoukian, M., Davis, P.
Anatomical Record, 2025/10
64

Impact of touch interventions on brain activity in moderately preterm infants: study protocol for a pilot randomised controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., Tansini, L., Pisanu, D., Di Leo, D., Vergani, E., Righini, A., Arrigoni, F., Fanos, V., Rescigno, M., Veggiotti, P., Lista, G., Gazzolo, D.
BMJ Open, 2025/10
Free full text
65

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10
66

Osteopathic manipulative treatment for refractory chronic traumatic pain and mobility restrictions at a level 1 trauma center
Baltazar, G. A., Cao, M., Van Vleet, J., Hart, S., Jakubowski, A., Suree, N., Petrone, P., Islam, S., Machado, F., Rubano, J.
Journal of Osteopathic Medicine, 2025/10
Free full text
67

Visceral Osteopathy in Treating Refractory Irritable Bowel Syndrome: Results of a French National Multicentre Randomised Controlled Trial
Wuestenberghs, F., Sabate, J. M., Jouet, P., Mion, F., Vidon, M., Piche, T., Napoléon, M., Roman, S., Soliman, H., Benallaoua, M., Bouchoucha, M., Benamouzig, R.
United European Gastroenterology Journal, 2025/10
68

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10
69

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10
70

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/10
Free full text
71

Assessing Osteopathic Medical Student Knowledge of Common Vitamin and Mineral Deficiencies
Stevens, A. A., Weir, S. B.
Cureus, 2025/10
Free full text
72

Top 100 cited articles in osteopathic medical education: A bibliometric analysis
Bright, H. S. IV., Robinson, K., Fitterling, L., Kelley, S., Wang, M. Y.F., Lipke, L.
Medical Reference Services Quarterly, 2025/10
73

The Spinal Facilitation Hypothesis and Reflex Arcs in Modern Osteopathic Medicine
Bordoni, B., Simonelli, M., Morabito, B., Escher, A. R.
Cureus, 2025/09
Free full text
74

Osteopathische Behandlung bei akuter Tendovaginitis de Quervain
(Osteopathic treatment for acute De Quervain's tendovaginitis)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09
75

Interrater Reliability of a Manual Diagnostic Protocol for Pancreatic Functional Visceral Dysfunction
Faria, M., Machado, N., de Sousa, M. C., Pires, P. M., Pires, T.
Journal of Integrative and Complementary Medicine, 2025/09
76

A proven template for providing streamlined, scalable, cost-effective clinical research opportunities in osteopathic medical schools
Greek, J. N., Greek, A. P., Hopper, M., Arnce, R.
Journal of Osteopathic Medicine, 2025/09
Free full text
77

Ultrasound Strain Zero-Crossing for Assessing Adult Hypertonic Muscles: A Feasibility Study
Gao, J., Rubin, J. M.
Journal of Ultrasound in Medicine, 2025/09
78

Osteopathic manipulative treatment in a patient with idiopathic scoliosis assessed by breathing pattern characterization using optoelectronic plethysmography and quality of life — a case report
Gaillard, L., Stubbe, L., Riquet, D., Houel, N.
Journal of Bodywork and Movement Therapies, 2025/09
Free full text
79

Attitudes, Beliefs, and Values of Italian Osteopaths Toward the Management of Patients With Tension-Type Headache: A Categorical Content Analysis
Iacopini, A., Esteves, J. E., Consorti, G., Lunghi, C., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2025/09
80

Osteopathic intervention for inflammatory conditions of the lactating breast: a case series
Engel, R., Willy, K., Fuller, E.
International Journal of Osteopathic Medicine, 2025/09
81

Multidisciplinary perceptions of osteopathy in the Italian hospital context
Lopane, D., Mazzoleni, B., Saetta, A., Soekeland, F., Dacomi, A., Tartaglia, F. C., Coldani, C., Tomaiuolo, G., Cattani, D., Sguanci, M., Cangelosi, G., Palomares, S. M., Mancin, S.
Advances in Integrative Medicine, 2025/09
82

The Rule of the Artery: Management of Peripheral Vascular Disease with Osteopathic Manipulative Treatment in a Low Resource Setting in Iquitos, Peru
Kamm, M.
Spartan Medical Research Journal, 2025/09
83

Assessing Osteopathic Medical Students’ Perceptions on Training to Identify Social Determinants of Health: A Pilot Study in a Detroit Street Medicine Program
Nallabelli, N.
Spartan Medical Research Journal, 2025/09
84

Equity reporting in systematic reviews and meta-analysis for geographic atrophy: a PROGRESS-Plus assessment
Emmert, R., McKenzie, T., Smith, D., Russell, H., Schultheis, G., Hartwell, M.
Journal of Osteopathic Medicine, 2025/09
Free full text
85

The Emerging Role of Osteopathic Manipulative Medicine in Enhancing Quality of Life for Palliative and End-of-Life Patients: A Narrative Review
Ngo, A. L., Nguyen, L., Shahbandeh, C., Nichols, J.
Cureus, 2025/09
Free full text
86

Osteopaths' attitudes, skills and use of evidence-based practice in Portugal
Nunes, A., Santo, J. E., Moita, J.
International Journal of Osteopathic Medicine, 2025/09
87

Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/09
88

Repositioning Menstrual Pain Management: Multidisciplinary Collaboration and Cultural Sensitivity as Key Priorities
Nufi, E. P.
International Journal of Osteopathic Medicine, 2025/09
89

Liebe Leserinnen und Leser
(Dear readers)
Newiger, C.
Osteopathische Medizin, 2025/09
90

General Osteopathic Treatment: Status quo – Teil 1
(General Osteopathic Treatment: Status Quo – Part 1)
Engel, M.
Osteopathische Medizin, 2025/09
91

Editorial
(Editorial)
Scheuchl, F.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09
92

Der Darm als Schlüssel zur ganzheitlichen Gesundheit
(The gut as key to holistic health)
Herberhold, M.
Osteopathische Medizin, 2025/09
93

Interdisziplinäre Perspektiven auf die Ankyloglossie: Diagnostik, Therapie und Evidenz
(Interdisciplinary perspectives on ankyloglossia: diagnosis, treatment, and evidence)
Moghtader, D., Vogt, R.
Osteopathische Medizin, 2025/09
94

From the Editor: Becoming the Author of Something Beautiful
Ching, L. M.
The AAO Journal, 2025/09
95

Impact of Osteopathic Manipulative Treatment on Improving Function and Restoring Quality of Life After Sternoclavicular Joint Resection
Krueger, A., Schaefer, M.
The AAO Journal, 2025/09
96

OMT as an Adjunct Therapy to Clubbed Feet: A Case Study
Tucker, A., Dorsa, I., Patel, J., Seemann, J., Hicks, K., Leggoe, S.
The AAO Journal, 2025/09
97

The systemic effects of inflammation and the dynamics of cytokine profile in chronic apical periodontitis
(Системные эффекты воспаления и динамика цитокинового профиля при хроническом апикальном периодонтите)
Bagryantseva, N. V.
Russian Osteopathic Journal, 2025/09
98

Physiological substantiation of the effect of mechanical impact on internal organs (literature review
(Физиологическое обоснование влияния механических воздействий на внутренние органы (обзор литературы)
Ikhlef, A., Potekhina, Y. P., Simenko, E. V.
Russian Osteopathic Journal, 2025/09
99

Combined rehabilitation of patients after acute cerebrovascular accident in the early recovery period: the role of osteopathic correction
(Комбинированная реабилитация пациентов после острого нарушения мозгового кровообращения в раннем восстановительном периоде: роль остеопатической коррекции)
Makichyan, T. G., Rylsky, A. V., Melkosyants, D. I.
Russian Osteopathic Journal, 2025/09
100

Effect of taichichuan practice on postural balance and muscle electrical activity (pilot study
(Влияние практики тайцзицюань на постуральный баланс и электрическую активность мышц (пилотное исследование)
Mikhailov, A. F., Milutka, Y. A., Potekhina, Y. P., Milyanyuk, A. O.
Russian Osteopathic Journal, 2025/09
101

Osteopathy as a direction of integrative medicine
(Остеопатия как направление интегративной медицины)
Moiseev, V. I.
Russian Osteopathic Journal, 2025/09
102

Is osteopathic treatment appropriate for a patient with multimorbidity?
(Уместно ли остеопатическое лечение пациенту с мультиморбидностью?)
Musina, G. M., Novikov, Y. O., Musina, S. M.
Russian Osteopathic Journal, 2025/09
103

Effect of osteopathic correction on the outcome of pregnancy and childbirth in women with chronic pyelonephritis
(Влияние остеопатической коррекции на исход беременности и родов у женщин с хроническим пиелонефритом)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/09
104

Gastrointestinal motility disorder in celiac disease: influence of osteopathic correction
(Нарушение моторики органов желудочно-кишечного тракта при целиакии: влияние остеопатической коррекции)
Oreshko, A. Y., Mokhov, D. E., Tregubova, E. S., Oreshko, L. S.
Russian Osteopathic Journal, 2025/09
105

Centering the Medical Student Perspective in a Mixed-Methods Evaluation of the Holistic Admissions Process at a Mission-Driven Institution
Liszka, B. L.
Unpublished PhD thesis, 2025/08
Free full text
106

The effect of osteopathic manipulative treatment on length of stay and pain relief in pediatric appendectomy: a pilot non-randomized time-controlled clinical trial
Lo Piccolo, R., Cantagalli, M. M., Ferroni, T., Fracchiolla, F., Morabito, A.
Frontiers in Pediatrics, 2025/08
Free full text
107

Clinical Reasoning and Practices in the Osteopathic Management of Visceral Disorders: A Grounded Theory Study in the Italian Context
Camonico, T., Lippi, F., Rizzo, N., Barusso, A., Rossettini, G., Villafañe, J. H., Cerritelli, F., Papa, L., Esteves, J. E.
Healthcare, 2025/08
Free full text
108

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text
109

Le dessin ostéopathique des atteintes corporelles: une clinique émersive
Jacquot, E., Paintendre, A., Andrieu, B.
L'Evolution Psychiatrique, 2025/08
110

Integrating a Microbiology Laboratory Improves the Attitudes and Performance of First-Year Osteopathic Medical Students
Hrach, V. L.
Cureus, 2025/08
Free full text
111

Comparative cross-sectional analysis of asthma outcomes and sinus surgery utilization in Appalachian and non-Appalachian counties of Ohio
Borgemenke, S., Osap, R., Bogunovich, K., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/08
Free full text
112

The impact of adverse childhood experiences on age of diabetes diagnosis and associations with race and ethnicity
Rice, A., Taylor, M., Hendrix-Dicken, A., Elenwo, C., Croff, J., Chalmers, L. J., Coffey, S., Hartwell, M.
Journal of Osteopathic Medicine, 2025/08
Free full text
113

Impact of osteopathic tests on heart rate and heart rate variability: an observational study on osteopathic students
Gillet, F., Gault, M., Dussault, V., Cheggour, S., Grinand, M., Martinez, P.
Journal of Osteopathic Medicine, 2025/08
Free full text
114

Private equity in healthcare: implications and policy recommendations
Jestin, M.
Journal of Osteopathic Medicine, 2025/07
Free full text
115

Patience in Practice: A Nonoperative Approach to Osteochondritis Dissecans
Rodas, A. W., Gupta, P., Pan, K., Rule, R., Goddard, M.
Cureus, 2025/07
Free full text
116

Changes in Electromagnetic Activity Following Osteopathic Manipulative Treatment: A Novel Assessment Using Induction Sensors
Savla, P., Brazdzionis, J., Marino, M., Siddiqi, I., Sweiss, R., King, C., Miulli, D. E.
Cureus, 2025/07
Free full text
117

Predicting First-Semester Performance of First-Year Medical Students in a Changing Landscape
Walker, M., George, A., Mohsin, S., Nichani, R., Garg, R., Chosie, K., Kennedy, C.
Cureus, 2025/07
118

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text
119

The effectiveness of training student physicians in culturally sensitive patient care using an interprofessional culturally competent curriculum
Aminpour, A., Gelvin, M., Smurzynski, A., Gardner, F., Gardere, J.
Journal of Osteopathic Medicine, 2025/07
Free full text
120

Development of a national osteopathic Practice-Based Research Network (PBRN): the NCOR Research Network
Draper-Rodi, J., Fawkes, C., Bailey, D.
Scientific Reports, 2025/07
Free full text
121

Editorial
listed, , No authors
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
122

Lessons learned from the digital transformation of physiotherapy education: A phenomenological study
Eccott, L., Moulson, A., Atkinson, K., Livatino, S., Lewis, J., Cairns, M.
International Journal of Osteopathic Medicine, 2025/06
Free full text
123

An overview of systematic reviews on the efficacy and safety of osteopathic techniques
Zipp, C. R., Semlitsch, T., Tögel, G., Krenn, C., Loder, C., Jeitler, K., Siebenhofer, A.
Journal of Bodywork and Movement Therapies, 2025/06
124

Osteopathische Behandlung eines Reizdarmsyndroms
(Osteopathic treatment of irritable bowel syndrome)
Scheuchl, F., Spohr, G.
Osteopathische Medizin, 2025/06
125

Die doppelte Facette der Identität der Osteopathie
(The dual facet of osteopathy's identity)
L'Hermite, P.L.
Osteopathische Medizin, 2025/06
126

Inter-rater and intra-rater reliability of belt-stabilized hand-held dynamometer using make test in lower extremity muscle strength assessment among healthy adults
Espino, R. V. S., Gonzalez-Suarez, C., Ingram, L. A., Gomez, I. N. B., Agarao, K. A. T., Flores, J. G., Bulseco, N.
International Journal of Osteopathic Medicine, 2025/06
127

Acute changes in functional connectivity associated with first osteopathic manual treatment in chronic low back pain spatially overlap with opioid receptor expression
Tomaiuolo, F., Cerritelli, F., Sestieri, C., Keys, J., Paolucci, T., Sensi, S. L., Ferretti, A., Delli Pizzi, S.
Brain Research Bulletin, 2025/06
Free full text
128

From the Editor: Continuing the Legacy
Barnes, P. L.
The AAO Journal, 2025/06
129

Combined Myofascial Technique for a Second Posterior Sacral Segment Dysfunction
Stellon, A. G., Rudberg-Post, L. J., Gustafson, H. C., Hartwell, L. E., Matz, O. C., Woolley, A. L.
The AAO Journal, 2025/06
130

The Use of Osteopathic Manipulative Medicine During the Inpatient Evaluation for Acute Coronary Syndrome
Coppinger, C., Rit, N., Coppinger, J.
The AAO Journal, 2025/06
131

Novel COL4A1-related phenotype: generalized hypermobility in a patient with heterozygous missense mutation at NM_001845.6(COL4A1): c.4006G>A (p. Val1336Ile)
Mingo, E. N., Unger, M. J. Jr.
The AAO Journal, 2025/06
132

The utility of the implantable loop recorder in patients with Ehlers-Danlos syndrome and hypermobility spectrum disorder
Tale, E., Robinson, G., Edward, J., Kaushal, R., Riley, B., Cohen, T. J.
Journal of Osteopathic Medicine, 2025/06
Free full text
133

The use of OMT in Myalgic Encephalomyelitis/Chronic Fatigue Syndrome
Brancale, D., Cooley, D.
The AAO Journal, 2025/06
134

From Fatigue to Function: A Case Report of The Use of OMT in Chronic Fatigue Syndrome
Finkelstein, A., Petrillo, G., Keys, J.
The AAO Journal, 2025/06
135

A Novel Calibration Methodology for Osteopathic Manipulative Medicine Research: Improving Study Validity by Standardizing Intra-researcher Techniques
Hahn, D., Krakowski, M., Kadriovski, S., Pierides, M., Velasquez, L., Volokitin, M.
The AAO Journal, 2025/06
136

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06
137

Impact of Osteopathic Manipulative Treatment in Delivering Comprehensive Care in Populations with Disabilities
Villarosa, M., Bae, P., Yeam, J., Hoang, V., White, G., Blumer, J.
The AAO Journal, 2025/06
138

The Impact of Biological Sex, Medical School Background, and Geographic Location on Diversity in U.S. Neurosurgery Residency Programs
Fioletova, M., Perkinson, K. A., Nemani, M., Sees, J. P.
Cureus, 2025/06
Free full text
139

The effect of osteopathic manipulative treatment on chronic rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kalkat, A., Hammes, C., Kohli, E., Callahan, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2025/06
Free full text
140

Besteht eine Korrelation zwischen dem Zink-Test und den gängigen HVR-Parameter, gemessen an einer heterogenen Stichprobe, die sich aus Long-/Post-COVID-19-Syndrom PatientInnen und einer Kontrollgruppe zusammensetzt? und Bestehen Unterschiede in den Ergebnissen des Zink-Test zwischen der Gruppe der Long-/Post-COVID-19-Syndrom PatientInnen und der Kontrollgruppe?
(Is there a correlation between the CCP and commonly used HRV-Parameters, measured in a heterogeneous sample consisting of Long-/post-COVID-19-Syndrom patients and a control group, Are there differences in the CCP between the patient group and the control group)
Klupsch, K.
Unpublished MSc thesis, 2025/06
141

Effekte der Osteopathie auf die HRV, die NRS und die Lebensqualität bei Patientinnen mit primärer Dysmenorrhoe: Eine integrative Fallserie
(Effects of Osteopathy on HRV, NRS, and Quality of Life in Patients with Primary Dysmenorrhea: An Integrative Case Series)
Markovics, M.
Unpublished MSc thesis, 2025/06
142

Osteopathic practitioner´s considerations on infertility treatment
Triay Salamanca, S.
Unpublished MSc thesis, 2025/06
Free full text
143

Assessment of reserve capacities of the body of children and adolescents in conditions of population physiological monitoring
(Оценка резервных возможностей организма детей и подростков в условиях популяционного физиологического мониторинга)
Kalyuzhny, E. A., Bogomolova, E. S., Mukhina, I. V., Galova, E. A., Godina, E. Z., Khomyakova, I. A., Fedotova, T. K., Gorbachova, A. K.
Russian Osteopathic Journal, 2025/06
144

Оsteopathic treatment of supraorbital neuralgia in a child
(Остеопатическое лечение супраорбитальной невралгии у ребенка)
Musina, G. M., Novikov, Y. O., Musina, S. M.
Russian Osteopathic Journal, 2025/06
145

Effect of osteopathic correction on urodynamic parameters in pregnant women with chronic pyelonephritis
(Влияние остеопатической коррекции на показатели уродинамики у беременных с хроническим пиелонефритом)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/06
146

Possibilities of including osteopathic methods of correction in the complex treatment of urolithiasis
(Возможность включения остеопатической коррекции в комплексное лечение мочекаменной болезни)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/06
147

Integrative medicine
(Интегративная медицина)
Shabrov, A. V., Mokhov, D. E., Tregubova, E. S., Korotkov, K. G., Moiseev, V. I., Partsernyak, S. A.
Russian Osteopathic Journal, 2025/06
148

Effekte einer osteopathischen Behandlung auf die Herzratenvariabilität bei Patientinnen mit Colitis Ulcerosa: Eine integrative Fallserie
(Effects of Osteopathic Treatment on Heart Rate Variability in Patients with Ulcerative Colitis: An Integrative Case Series)
Schabauer, O.
Unpublished MSc thesis, 2025/06
149

Einfluss einer einmaligen osteopathischen Behandlung auf Stabilität, Symmetrie und Sensomotorik von Kindern mit Angststörung oder ADHS
(Effect of a single osteopathic treatment on stability, symmetry and sensorimotor function in children with symptoms of an anxiety disorder or ADHD)
Wittig-Chronopoulos, M.
Unpublished MSc thesis, 2025/06
150

Changes in Pain, Spasticity, and Quality of Life After Use of Counterstrain Osteopathic Manipulative Treatment in Individuals with Spinal Cord Injuries
Din, S., Grimmett, M. P., Sandoval, A. P., Clancy, S. E., Payton, S. L., Jackson, J. M., Cornelio, V. C., Warren, E., Courtner, A., Williamson, E., Sharma, A., Dolbow, D. R.
Journal of Bodywork and Movement Therapies, 2025/06
151

Pilot study MOVENDOP protocol - impact on quality of life following postoperative osteopathic abdominal mobilizations in patients operated for endometriosis
Comptour, A., Dechambenoit, C., Kwiatkowski, F., Vidal, A., Duval, M., De Antonio, M., Jacobs, A., Bourdel, N.
PLoS One, 2025/05
Free full text
152

Assessing Osteopathic Medical Students' Knowledge, Attitude, and Perspective on the Use of Assisted Reproductive Technologies (ART)
Patel, A., Capote, M. M., Manguvo, A., Mafuvadze, B.
Cureus, 2025/05
Free full text
153

Breath of Relief: Osteopathic Manipulative Treatment of Chronic Postoperative Pain in a Bilateral Lung Transplant Patient
Duggal, V., Finkelstein, A., Radigan, R., Bhushan, P.
Cureus, 2025/05
Free full text
154

The Impact of a Simulated Intrauterine Device Insertion Clinic on Osteopathic Medical Students’ Knowledge, Attitude, and Self-Efficacy Regarding Intrauterine Devices
Betit, A. L., Kelly, L. P., Garg, R., Patel, P. G.
Cureus, 2025/05
155

Towards a more equitable future: development, implementation, and evaluation of a novel e-course on racial disparities in pain management for medical students
Stensland, M., Maples, N., Sanford, E., Martinez, M.
BMC Medical Education, 2025/05
Free full text
156

Exploring manual therapy in the management of irritable bowel syndrome in adults: A scoping review
Płóciennik-Korycka, N., Pani, S. M., Bruc, B., Contu, P., Wrzesińska, M.
Complementary Therapies in Medicine, 2025/05
Free full text
157

Osteopathic, logopedic and psychological assessment to improve outcome in patients undergoing cardiac surgery: A randomized clinical trial (TITANIC trial)
Volpato, E., Stilo, L., Tavanelli, M., Bordoni, B., Oreni, L., Toccafondi, A., Moraschi, A., Morici, N.
European Journal of Preventive Cardiology, 2025/05
158

International medical graduate orthopaedic residents show higher research productivity than United States graduate peers before and during residency
MacLeod, J. S., Jacome, F., Mansour, H., Lee, M. S., Akwuole, F., Cho, S., Lee, J., Lema, O., Chopra, A., Bakaes, Y., Painter, S., Baker, H., Mejia, A.
International Orthopaedics, 2025/05
159

Efforts in Undergraduate Medical Education to Improve Socioeconomic Status Diversity
Velasquez, D. E., Shrestha, A., Matias, W. R.
Academic Medicine, 2025/05
Free full text
160

Patient-Practitioner-Environment Synchronization: Four-Step Process for Integrating Interprofessional and Distinctive Competencies in Osteopathic Practice-A Scoping Review with Integrative Hypothesis
Lunghi, C., Baroni, F., D'Alessandro, G., Consorti, G., Tramontano, M., Stubbe, L., Conte, J., Liem, T., Zegarra-Parodi, R.
Healthcare, 2025/04
Free full text
161

A cross-sectional study of newly established medical schools in the United States: student body diversity remains an unmet challenge
Oyoun Alsoud, L., West, K., Sorrell, S., Andolsek, K. M., Al Hageh, C., Ibrahim, H.
Medical Education Online, 2025/04
Free full text
162

Modeling the importance of physician training in practice location for Ohio otolaryngologists
Borgemenke, S., Newsom, D., Scheatzle, P., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/04
Free full text
163

Tradition-Dismissive vs. Tradition Reconceptualization Approaches in Musculoskeletal Care: The Example of Osteopathic Care
D&rsquo, Alessandro, G., Lunghi, C., Consorti, G., Zanon, S., Berti, F., Turinetto, M., Di Pietrantonio, L., Longobardi, M., Zegarra-Parodi, R., Baroni, F.
Applied Sciences, 2025/03
Free full text
164

A call for improving the internal validity and the reporting of manual therapy trials self-labelled as pragmatic: A methodological review
Roura, S., Alvarez, G., Hohenschurz-Schmidt, D., Solà, I., Núñez-Cortés, R., Bracchiglione, J., Fernández-Jané, C., Phalip, J., Gich, I., Sitjà-Rabert, M., Urrútia, G.
International Journal of Osteopathic Medicine, 2025/03
Free full text
165

Effects of pain education delivered through telerehabilitation on pain and disability in patients with chronic musculoskeletal pain: A systematic review protocol
Velho, G., de Araujo, F. X., da Silva, C. V., Machado, J. C., da Silva, F. C., Hoegh, M. S., Silva, M. F.
International Journal of Osteopathic Medicine, 2025/03
166

Efficacy of preoperative exercise rehabilitation for patients after total knee arthroplasty: An updated systematic review and meta-analysis
Zhou, Y., Wang, S.
International Journal of Osteopathic Medicine, 2025/03
167

The development of the National Council for Osteopathic Research - Research Network (NCOR-RN): A qualitative focus group study of osteopaths’ views
Bailey, D., Fawkes, C., Carnes, D., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2025/03
168

Effekt von osteopathischen Behandlungen während interdisziplinärem Gewichtsreduktionskonzept von Patienten mit Adipositas Grad 1 -3
(Effect of Osteopathic Treatments During an Interdisciplinary Weight Reduction Program in Patients with Grade 1–3 Obesity)
Brenner, M.
Unpublished MSc thesis, 2025/03
169

Advancing Equitable Osteopathic Practice: Integrating Person-Centredness & Addressing Racial Biases Through the Lens of Critical Theory
Mhadhbi, H., MacMillan, A., Draper-Rodi, J., Ménard, M., Sinderholm Sposato, N.
International Journal of Osteopathic Medicine, 2025/03
170

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R, 2025/03
171

Assessing the effects of manual therapy on pain in patients living with Persistent Non-Specific Low Back Pain (PNSLBP): Which evaluation criteria and measurement tools used in randomised controlled clinical trials? A systematic review
Bilhaut, A., Olivier, A.H., Draper-Rodi, J., Cretual, A., Ménard, M.
International Journal of Osteopathic Medicine, 2025/03
172

Die Rolle des Placebo-Effekts in der Osteopathie
(The role of the placebo effect in osteopathy)
Liem, T.
Osteopathische Medizin, 2025/03
173

Historische Denkmodelle der Iliosakralbewegungen – Teil 2: Fryette-Modell, Strachan-Modell und Mitchell-Modell
(Historical thought models of sacroiliac movements - Part 2: Fryette model, Strachan model and Mitchell model)
Koch, D.
Osteopathische Medizin, 2025/03
174

From the Editor: Empirical Knowledge and the Scientific Method
Ching, L. M.
The AAO Journal, 2025/03
175

The Spiritual Component Of Still's Writings
Kimberly, P. E.
The AAO Journal, 2025/03
176

An osteopathic assessment of lower extremity somatic dysfunctions in runners
Santanello, A., Volokitin, M., Matthew, P., Modica, A., McKellar, C., Thakkar, K., Schear, M., Tai, A., Nagler, J., Suarez, S.
Journal of Osteopathic Medicine, 2025/03
Free full text
177

Effect of different osteopathic techniques on the tone and electrical activity of the sternocleidomastoid muscles
(Влияние различных остеопатических техник на тонус и электрическую активность грудино-ключично-сосцевидных мышц)
Popova, V. I., Kondratev, V. E., Vedyashkina, A. S., Potekhina, Y. P.
Russian Osteopathic Journal, 2025/03
178

Dynamics of osteopathic status in patients with chronic tonsillitis during complex treatment with inclusion of osteopathic correction
(Динамика остеопатического статуса у пациентов с хроническим тонзиллитом при комплексном лечении с включением остеопатической коррекции)
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushk, S. A.
Russian Osteopathic Journal, 2025/03
179

Non-medicamentous methods in conservative treatment and preoperative preparation of patients with gonarthritis (literature review
(Немедикаментозные методы в консервативном лечении и предоперационной подготовке пациентов с гонартритом (обзор литературы)
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/03
180

Osteopathic correction as part of complex treatment of patients with uterine form of infertility
(Остеопатическая коррекция в составе комплексного лечения пациенток с маточной формой бесплодия)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/03
181

Application of osteopathic correction in complex therapy of patients with varicose veins of the lower limbs
(Применение остеопатической коррекции в комплексной терапии пациенток с варикозной болезнью нижних конечностей)
Belash, V. O., Usenko, K. P.
Russian Osteopathic Journal, 2025/03
182

Editorial
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
183

Kommunikation und professionelle Gesprächsführung in der osteopathischen Praxis
(Communication and professional conversation techniques in the osteopathic practice)
Stachowski, A.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
184

Integration of Osteopathy in Portuguese National Health Service: Perceptions and Expectations of Citizens and Health Professionals
Maria, B., Gomes, S., Goes, A. R.
International Journal of Osteopathic Medicine, 2025/02
Free full text
185

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text
186

“There is a way to work together“: A qualitative study on complementary medicine therapists' perceptions of their role in the Swiss healthcare system
Dubois, J., Rodondi, P.Y., Akre, C.
Complementary Therapies in Clinical Practice, 2025/02
Free full text
187

“There is a way to work together“: A qualitative study on complementary medicine therapists' perceptions of their role in the Swiss healthcare system
Dubois, J., Rodondi, P.Y., Akre, C.
Complementary Therapies in Clinical Practice, 2025/02
188

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text
189

Pursuing Osteopathic Recognition: A National Survey on US Program Director Perspectives
Dong, T., Shapiro, M., Soh, M., Merkebu, J., Cervero, R., McClain, R., Durning, S. J.
Journal of Graduate Medical Education, 2025/02
Free full text
190

Approche neuroprotectrice de l’ostéopathie chez les grands prématurés : tolérance, sécurité et bénéfices potentiels
(Neuroprotective approach of osteopathy in very preterm infants: tolerance, safety, and potential benefits)
O'Connor, S.
Unpublished PhD thesis, 2025/01
Free full text
191

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text
192

Early osteopathic manipulative treatment to prevent cranial positional deformities: A randomized controlled trial
Genelot, C., Macioce, V., Huguet, H., Harrewijn, I., Cambonie, G., Dessauge, D., Mura, T., Moulis, L., Captier, G.
Archives de Pédiatrie, 2025/01
Free full text
193

The Fascial Distortion Model in Military Aircrew with Chronic Neck Pain: A Case Study
Fullenkamp, A. J.
Military Medicine, 2025/01
194

The Effect of Osteopathic Visceral Manipulation on Quality of Life and Postural Stability in Women with Endometriosis and Women with Pelvic Organ Prolapse: A Non-Controlled Before-After Clinical Study
Wójcik, M., Kampioni, M., Hudáková, Z., Siatkowski, I., Kędzia, W., Jarząbek-Bielecka, G.
Journal of Clinical Medicine, 2025/01
Free full text
195

Electronic health care record for objective structured clinical examination stations at Philadelphia College of Osteopathic Medicine School of Pharmacy Georgia Campus during 2022-2023 academic year
Alhaddad, G., Saade, R., Najafabadi, I. K.
American Journal of Health-System Pharmacy, 2025/01
196

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01
197

Shifting Perspectives: Assessing Knowledge and Beliefs in Harm Reduction Strategies Among Future Healthcare Professionals - H.E.R.O. Harm Reduction and Opioid Education
Hamilton, M. E., Brian, M., Hill, S., Hurst, T.
American Journal of Health-System Pharmacy, 2025/01
198

Editorial
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
199

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text
200

Dynamometry for the assessment of trunk muscle strength in postpartum women with pregnancy-related posterior pelvic girdle pain: A reliability study
Jafarian, F.S., Jafari-Harandi, M., Yeowell, G., Sadeghi-Demneh, E.
International Journal of Osteopathic Medicine, 2024/12
201

Is visceral osteopathy therapy effective? A systematic review and meta-analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Esteban-Tarcaya, G., Mamud-Meroni, L., Jiménez-del-Barrio, S.
International Journal of Osteopathic Medicine, 2024/12
202

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text
203

The rise of advanced practice provider independence bills: a misguided attempt to address the physician shortage
Bohler, F., Peters, G., Aggarwal, N., Harvey, K., Bohler, J. D.
Journal of Osteopathic Medicine, 2024/12
Free full text
204

“Disproportionate Olympic Rings” – the usage of a biopsychosocial (BPS) framework of care when managing people with musculoskeletal pain by osteopaths in Aotearoa/New Zealand– A qualitative study
Kovanur Sampath, K., Darlow, B., Tumilty, S., Shillito, W., Fairs, E., Devan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/12
205

A call to include intersectionality on board examinations
Dozier, D. R., Rodríguez, J. E.
Journal of Osteopathic Medicine, 2024/12
Free full text
206

Osteopathic health care in aged care facilities: The experience of practitioners in an emerging practice setting
Amorim, M., Bennett, J., McGarry, D., Moore, B., Orrock, P., Whitton, L., Dullard, S.
Australasian Journal on Ageing, 2024/12
Free full text
207

Osteopathic Manual Treatment in Women with Endometriosis: A Scoping Review on Clinical Symptoms, Fertility and Quality of Life
De Strooper, M., De Nys, L., Theys, L., Vermeersch, A., Quaghebeur, J.
International Journal of Osteopathic Medicine, 2024/12
Free full text
208

Effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in individuals with chronic low back pain: A double-blind, randomised placebo-controlled trial
Armbrust, D., Arêas, G. P. T., Fonseca, C. L., Arêas, F. Z. S., Duarte, N. A. C., Santana, S. A. A., Dumont, A. J. L., Neto, H. P., Oliveira, C. S.
Clinical Rehabilitation, 2024/12
209

Bedrohung oder Chance – Das 150-jährige Bestehen der Osteopathie
(Threat or opportunity – Osteopathy's 150-year-existence)
Lewis, J.
Osteopathische Medizin, 2024/12
210

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität – Teil 2: Ergebnisse der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability - Part 2: Results of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/12
211

Embryologie und Wirbelsäule – Teil 1: Entstehung und Entwicklung der Somiten als Anlage der Wirbelsäule
(Embryology and the spinal column - Part 1: Origin and development of the somites as the anlage of the spinal column)
Wojtowicz, A., Freeman, B., Dijs, P.
Osteopathische Medizin, 2024/12
212

Outreach Education led by Osteopathic Medical Students on Substance Use Prevention for Sustainable Health Literacy in Underserved Youth Communities
Garg, E., Gogineni, K., Mahimkar, S., Jambunathan, V., Jamal, L., Nazaroff, C., Restini, C.
Journal of Osteopathic Medicine, 2024/12
213

Assessing the Role of Osteopathic Medical Education on Community Health Literacy Interventions Pilot Study
Good, C., McClain, E.
Journal of Osteopathic Medicine, 2024/12
214

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12
215

“Limitations of Life:” A Mixed Methods Survey Exploring Osteopathic Medical Students’ Perspectives on Reasons Preventing them from Practicing In Rural Communities
Haque, N., Richardson, C.
Journal of Osteopathic Medicine, 2024/12
216

Building Disability Competency in Osteopathic Medical Students in Rural Ohio Pilot Study
Hughes, A., Barrett, J., Dillman, O.
Journal of Osteopathic Medicine, 2024/12
217

Impact of Suboccipital Release Osteopathic Manipulative Treatment on Cardiac Control in Healthy Adults
Kachelmeyer, J., Witczak, R., Cummings, K., Crasta, M.
Journal of Osteopathic Medicine, 2024/12
218

Exploring Attitudes Towards Osteopathic Medicine in First and Second Year Osteopathic Medical Students Following Osteopathic Manipulative Medicine
Neiman, N., de Jesus, A., Zeller, A. M.
Journal of Osteopathic Medicine, 2024/12
219

The Effect of Osteopathic Manipulative Treatment in Chronic Rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kallat, A., Callahan, M., Kohli, E., Hammes, C., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/12
220

Investigation of Suboccipital Release, Muscle Energy, and Combination Therapy, Respectively Evaluating their Effect on Carotid Artery Blood Flow: Preliminary Results
Sabbagh, M., Moriarty, S., Perera, I., Dziepak, S., Santiago, M., Peddibhotla, V., Rubis, C., Anandakrishnan, R., Rawlins, F., Brolinson, P. G.
Journal of Osteopathic Medicine, 2024/12
221

Using Osteopathic Manipulative Therapy to Treat Irritable Bowel Syndrome and Severe Refractory Gastroesophageal Reflux Disease: A Case Report
Johnson, T., Jahnke, A. R., Reindel, K.
Cureus, 2024/12
Free full text
222

Manual medical technologies in complex treatment and rehabilitation of patients with primary osteoarthritis (literature review
(Мануальные медицинские технологии в комплексном лечении и реабилитации пациентов с первичным остеоартритом (обзор литературы)
Mokhov, A. D., Belyaeva, I. B., Mokhov, D. E., Gavrilova, T. A.
Russian Osteopathic Journal, 2024/12
223

The possibility of using osteopathic correction in the complex treatment of patient with tinnitus
(Возможность применения остеопатической коррекции в комплексном лечении пациента с тиннитусом)
Revina, M. B.
Russian Osteopathic Journal, 2024/12
224

Osteopathic correction as part of complex treatment of patients with irritable bowel syndrome
(Остеопатическая коррекция в составе комплексного лечения пациентов с синдромом раздраженного кишечника)
Yarysheva, Y. V., Dmitriev, A. A., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/12
225

From the Editor: Dr. Still, Natural Philosopher
Ching, L. M.
The AAO Journal, 2024/12
226

Characteristics, opportunities, and challenges of osteopathy (COCO) in the perceptions of osteopaths in Germany, Austria, and Switzerland: a metasynthesis
Manschel, J., Porthun, J., Beuckels, J. M., Martin, D.
European Journal of Medical Research, 2024/12
Free full text
227

Das Menschenbild in der Osteopathie. Wie Osteopath*innen den Menschen sehen. Eine qualitative Studie
Fuchsluger, M.
unpublished MSc thesis, 2024/12
228

The use of respiratory patient reported outcome measures (PROMs) in the management of COPD: Perceptions of Australian osteopaths
Engel, R., Baxter, D., Muddle, L., Vaughan, B., Grace, S.
Complementary Therapies in Clinical Practice, 2024/11
Free full text
229

Das Menschenbild in der Osteopathie Wie Osteopath*innen den Menschen sehen. Eine qualitative Studie
(The Human Image in Osteopathy: Osteopaths' Perspectives on the Human Being. A Qualitative Study)
Fuchsluger, M.
Unpublished MSc thesis, 2024/11
Free full text
230

Eine Inter-Rater-Reliabilitätsstudie zur anterolateralen Mobilitätstestung des proximalen Tibiofibulargelenks
(An inter-rater reliability study for the anterolateral mobility test of the proximal tibiofibular joint)
Gomm, E.
Unpublished MSc thesis, 2024/11
231

Osteopathische Anamnese aus Sicht der Patient*innen
(Osteopathic Case History Taking from a Patient`s Perspective)
Gridling, V.
Unpublished MSc thesis, 2024/11
232

Feasibility of a cinematic-virtual reality training program about opioid use disorder for osteopathic medical students: a single-arm pre–post study
Rehl, D., Mangapora, M., Love, M., Love, C., Shaw, K., McCarthy, J., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/11
Free full text
233

Die Interrater Reliabilität des passiven Mobilitätstest des Os Coccygis im Sitzen
(The inter-rater reliability of the passive motion test of the os coccygis in the sitting position)
Ouschan, J.
Unpublished MSc thesis, 2024/11
234

Osteopathie in der Rehabilitation von Patienten mit rezidivierenden muskuloskeletalen Verletzungen: eine experimentelle Studie
(Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study)
Sankova, M. V., Nikolenko, V. N., Vovkogon, A. D., Oganesyan, M. V., Trishina, A., Babarzai, L., Antonyan, S. Z., Babarzai, F., Pontes-Silva, A., Zharikov, Y. O.
Manuelle Medizin, 2024/11
235

Enhancing Clinical Skills Through Virtual Reality: A Study on 12-Lead Electrocardiogram Placement in Medical Education
Olayeye, K., Oviawe, E.
Cureus, 2024/11
Free full text
236

Development of an abdominal myofascial release therapy intervention for children with irritable bowel syndrome: Feasibility, acceptability, and preliminary outcomes
Benitez, A. J., Dourlain, J., Rana, A., Cohen, T. S., Miccio, R., Evans, J., Rosoff-Verbit, Z., Wang, X., Mascarenhas, M.
Neurogastroenterology and Motility, 2024/11
237

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text
238

Building an evidence base for osteopathy: Trials and tensions. A qualitative study of the experience of clinicians engaging in research
Grace, S., Engel, R., Vogel, S., Ahrens, G., Barclay, K., Guy, C., Lowe, C., McCormack, T., Paranthoiene, J., Carnes, D.
Complementary Therapies in Clinical Practice, 2024/11
Free full text
239

TikTok and frozen shoulder: a cross-sectional study of social media content quality
D'Ambrosi, R., Bellato, E., Bullitta, G., Cecere, A. B., Corona, K., De Crescenzo, A., Fogliata, V., Micheloni, G. M., Saccomanno, M. F., Vitullo, F., Celli, A.
Journal of Orthopaedics and Traumatology, 2024/11
Free full text
240

The impact of prepregnancy body mass index on pregnancy and neonatal outcomes
Mackeen, A. D., Boyd, V. E., Schuster, M., Young, A. J., Gray, C., Angras, K.
Journal of Osteopathic Medicine, 2024/10
Free full text
241

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10
242

Kann osteopathische Behandlung der Patella Knieschmerzen, Beweglichkeit und Lebensqualität verbessern? Eine randomisierte kontrollierte Studie
(Can Osteopathic Treatment of the Patella Improve Knee Pain, Mobility, and Quality of Life? A Randomized Controlled Study)
Dierenbach, R.
Unpublished MSc thesis, 2024/10
243

Assessing nutrition literacy and nutrition counseling proficiency following an interdisciplinary culinary medicine elective
Kirby, A. N., DeBellis, J., Wolter, K., Mount, G., Wang, C.H., Bishop, J., Barkhouse, J., Wirth, K., Nguyen, N., Cacciatore, C., Kraus, K.
Journal of Osteopathic Medicine, 2024/10
Free full text
244

Effect of manual manipulation on mechanical gait parameters
Yanuck, S. B., Fox, S. K., Harting, B. R., Motyka, T. M.
Journal of Osteopathic Medicine, 2024/10
245

Effectiveness of Osteopathic Treatment in Adults with Short Hamstring Syndrome: A Systematic Review
Ogando-Berea, H., Leirós-Rodríguez, R., Hernandez-Lucas, P., Rodríguez-González, Ó
Journal of Clinical Medicine, 2024/10
Free full text
246

Limb spasticity and telemedicine consultation for reconstructive surgery: patient perspectives of surgical assessment
Bardwell, A., Crowe, C. S., Rhee, P. C.
Journal of Osteopathic Medicine, 2024/09
Free full text
247

Die Bedeutung des osteopathischen Behandelns für Kinder nach einer Frühgeburt: Eine Befragung von Kinderosteopath*innen
(The importance of osteopathic treatment for children after premature birth: a survey of pediatric osteopaths)
Hackner, L., Belz, S., Esch, S.
Osteopathische Medizin, 2024/09
248

Efficacy of ankle mobilization on postural control in older people: A systematic review with meta-analysis
Hernández-Guillén, D., García-Gomariz, C., Roig-Casasús, S., Díaz-Díaz, B., Domínguez-Navarro, F., Pérez-Maletzki, J., Blasco, J.M.
International Journal of Osteopathic Medicine, 2024/09
Free full text
249

Food insecurity and childhood outcomes: a cross-sectional analysis of 2016–2020 National Survey of Children’s Health data
Elenwo, C., Fisch, C., Hendrix-Dicken, A., Coffey, S., Wetherill, M. S., Hartwell, M.
Journal of Osteopathic Medicine, 2024/09
Free full text
250

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität: Teil 1 – Ziele, Material und Methoden der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability: Part 1 - Objectives, material and methods of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/09
251

Osteopathy in the Italian healthcare landscape: Perceptions and areas of competence according to healthcare professionals
Lopane, D., Mazzoleni, B., Cattani, D., Soekeland, F., Dacomi, A., Coldani, C., Tomaiuolo, G., Cangelosi, G., Mancin, S.
Advances in Integrative Medicine, 2024/09
252

ADHS bei Erwachsenen in der osteopathischen Praxis
(ADHD in adults in the osteopathic practice)
Plathner, M.
Osteopathische Medizin, 2024/09
253

Development and adaptation of the Osteopaths' Therapeutic Approaches Questionnaire (Osteo-TAQ) for the Australian osteopathic profession - A cognitive interview study
Thomson, O. P., McLeod, G. A., Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2024/09
254

Young Doctors Program-Colorado: An Elective Elementary School Program to Improve Health Literacy, Utilization of the Healthcare System, and Osteopathic Awareness
Sposet, S., Fabich, R., McEchron, M.
Medical Science Educator, 2024/09
Free full text
255

Validität palpationsbasierter Messungen des Beckenschiefstands – eine Sekundäranalyse
(Validity of palpation-based measurements of pelvic obliquity - a secondary analysis)
Brandl, A., Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
256

Behandlung des männlichen chronischen Beckenschmerzsyndroms (CBSS)
(Treatment of male chronic pelvic pain syndrome (CPPS))
Switters, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
257

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text
258

Integrating nutrition and culinary medicine into preclinical medical training
Johnston, E. A., Torres, M., Goldgraben, S., Burns, C. M.
BMC Medical Education, 2024/09
Free full text
259

Osteopathic status and quality of life of pregnant women in megacities
(Остеопатический статус и качество жизни беременных в мегаполисах)
Nenashkina, E. N., Tregubova, E. S., Davletshina, L. T., Kozlova, O. P.
Russian Osteopathic Journal, 2024/09
260

Chronic Rhinosinusitis Management: A Narrative Review Comparing Interventional Treatment With Osteopathic Manipulation
Klover, C. R., Gorantla, V. R.
Cureus, 2024/09
Free full text
261

„Wie der Ast gebogen wird, so wächst der Baum“
Teichmann, P.
Skeptiker, 2024/09
262

Effects of High-Velocity Spinal Manipulation on Quality of Life, Pain and Spinal Curvature in Children with Idiopathic Scoliosis: A Systematic Review
Piqueras-Toharias, M., Ibáñez-Vera, A. J., Peinado-Rubia, A. B., Rodríguez-Almagro, D., Lomas-Vega, R., Sedeño-Vidal, A.
Children, 2024/09
Free full text
263

Effects of Osteopathic Manipulative Treatment (OMT) on Lower Extremity Muscle Characteristics in Parkinson's disease (PD) Patients
Radigan, R., Finkelstein, A., Mehra, M., Bhushan, P., Lombardo, T., Yao, S.
Movement Disorders, 2024/09
264

Professional skill priorities: Comparison views of osteopathy industry professionals and osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2024/09
Free full text
265

The legislative position of the Osteopath in Italy after the Decree of the Ministry of Universities and Research of 29 November 2023, in agreement with the Minister of Health: implications in terms of professional responsibility and current shortcomings
D'Antonio, G., Del Prete, S., Naso, I., Berloco, T., Spadazzi, F., Delogu, G., Bolino, G.
La Clinica Terapeutica, 2024/08
Free full text
266

Association and disparities of food insecurity and exposure to violence: analysis of the National Survey of Children’s Health
Bloom, M., McCoy, C., Hendrix-Dicken, A. D., Elenwo, C., Baxter, M. A., Coffey, S., Hartwell, M.
Journal of Osteopathic Medicine, 2024/08
Free full text
267

A Test of Reliability: Cranial Rhythmic Impulse for Distant Diagnoses
Alvarez, L. A., Cook, A. C., Sweeney, C. P., Walter, M. R., South, S. C., Myers, N., Boesler, D., Ma, S., Thomas, K., Quinn, T. A.
Cureus, 2024/08
Free full text
268

Changes in the Affective Empathy of Osteopathic Students: a Longitudinal Study
Newton, B. W., Vaskalis, Z. T.
Medical Science Educator, 2024/08
269

The WELLMESS Project (Move Well, Eat Well, Sleep Well, Stress Well)
Machireddy, D. R., Reid, C. G., Hollingsworth, J. C., Redden, D.
Cureus, 2024/08
Free full text
270

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text
271

Evaluation of the Effect of Nutrition Education on Osteopathic Medical Students’ Personal Nutrition Choices and Incorporation Into Future Medical Practice
Parker, A. T., Bateman, R., Fastring, D.
Cureus, 2024/08
Free full text
272

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text
273

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08
274

Inhibition zwischen zwei Somatischen Dysfunktionen messbar machen
(Making inhibition between two Somatic Dysfunctions measureable)
Lemburg, K.
Unpublished MSc thesis, 2024/08
275

The effect of osteopathic manipulative treatment on quality of life in patients with cardiac implantable electronic devices
Nikakis, J., Tale, E., Malkov, D., Arora, U. S., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2024/08
Free full text
276

Medical malpractice liability in large language model artificial intelligence: legal review and policy recommendations
Shumway, D. O., Hartman, H. J.
Journal of Osteopathic Medicine, 2024/07
Free full text
277

Pelvic Palpatory Tests in Manual Therapy and Osteopathy: A Critical Review of the Literature and Suggestions for New Research
Colonna, S., Mazzanti, M.
Cureus, 2024/07
Free full text
278

The Neurophysiological Effects of Craniosacral Treatment on Heart Rate Variability: A Systematic Review of Literature and Meta-Analysis
Cook, A. C., Egli, A. E., Cohen, N. E., Bernardi, K., Chae, M. Y., Kapalko, B. A., Coyne, S. A., Scott, R.
Cureus, 2024/07
Free full text
279

Use of person-centered language in obesity-related publications across sports medicine journals: a systematic review of adherence to person-centered language guidelines in sports medicine
Webb, J., Mach, K., Gooch, T., Reddy, A., Anderson, M., Scott, J., Checketts, J. X., Walker, L., Hartwell, M.
Journal of Osteopathic Medicine, 2024/07
Free full text
280

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07
281

The Effects of Osteopathic Manipulative Treatment on Brain Activity: A Scoping Review of MRI and EEG Studies
Bonanno, M., Papa, G. A., Ruffoni, P., Catalioto, E., De Luca, R., Maggio, M. G., Calabrò, R. S.
Healthcare, 2024/07
Free full text
282

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text
283

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Canadian osteopaths
Pelletier, R., Morin, C., Noy, M., Thomson, O. P., Sundberg, T., Leach, M. J.
International Journal of Osteopathic Medicine, 2024/06
284

Comorbidities associated with symptoms of subjective cognitive decline in individuals aged 45–64
Monahan, Z., Heath, J., Santos, A. D., Ford, A., Hartwell, M.
Journal of Osteopathic Medicine, 2024/06
Free full text
285

Historia de la osteopatía en Colombia
(History of osteopathy in Colombia)
Granados Jiménez, J. A.
Unpublished MSc thesis, 2024/06
Free full text
286

Osteopathie und inneres Wohlbefinden bei Menschen mit chronischer Erkrankung
(Osteopathy and inner well-being by people with chronic illness)
Fachinger, B. C.
Unpublished MSc thesis, 2024/06
287

Die Inter- Rater- Reliabilitätstestung des Vorlauftests im Stand und im Sitz
(Inter- rater- reliability of the standing and sitting forward flexion test in symptomatic and asymptomatic adults)
Flicker-Niederl, T.
Unpublished MSc thesis, 2024/06
288

Fasziale Manipulation© nach Stecco: Interrater-Reliabiltätstestung der Palpationsprüfung
(Fascial Manipulation© by Stecco: Interrater Reliability of the Palpation Evaluation)
Floner, M.
Unpublished MSc thesis, 2024/06
289

Der Einfluss von Osteopathie auf Schluckstörung und Erbrechen bei CMS
(The influence of osteopathy on dysphagia and vomiting in CMS)
Hinterreither, R.
Unpublished MSc thesis, 2024/06
290

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06
291

Die Intertester-Reliabilität des lumbosakralen Spring-Tests in Bauchlage
(The inter-rater reliability of the lumbosacral spring test in prone position)
Kampl, A.
Unpublished MSc thesis, 2024/06
292

Berücksichtigung sozialer Faktoren in der Patient*innen-Osteopath*innen-Beziehung - Eine qualitative Studie vor der Theorie des Enaktivismus
(Considering Social Factors in the Patient-Osteopath Relationship - A Qualitative Study from the Perspective of Enactivim)
Mayrl, E.
Unpublished MSc thesis, 2024/06
293

Der Einfluss von Osteopathie auf Spastik bei einer Multiple Sklerose (MS) Patientin
(The influence of osteopathy on spasticity in a multiple sclerosis (MS) patient)
Pleister, M.I.
Unpublished MSc thesis, 2024/06
294

Effekte auf die Wundheilung von Spalthautentnahmestellen Klinischer Vergleich von osteopathischen Lymphpumptechniken (LPT), Atemtherapie (AT) und der interventionsfreien Nachbehandlung, bezüglich Re-Epithelialisierung und der Veränderung von Ödem, Perfusion und Oxygenierung
(Effects to wound healing of split skin graft donor sites Clinical comparison of osteopathic lymph pumping techniques (LPT), respiratory therapy (RT) and intervention-free follow-up treatment with regard to re-epithelialization and changes in edema, perfusion and oxygenation)
Schreil, V.
Unpublished MSc thesis, 2024/06
295

ISG-Bewegungstest nach Becker – Eine Inter-Rater-Reliabilitätsstudie
(ISG mobility test according to Becker - An inter-rater reliability study)
Simon, M.
Unpublished MSc thesis, 2024/06
296

The Role of Osteopathic Structural Findings in Meningitis
Cecil, E., Burke, D.
The AAO Journal, 2024/06
297

Osteopathic correction in the complex treatment of women of reproductive age with pelvic organ prolapse
(Остеопатическая коррекция в комплексном лечении женщин репродуктивного возраста с пролапсом тазовых органов)
Bakanova, A. R., Lebedev, D. S., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/06
298

Selected issues of quality of medical care in the field of osteopathy
(Отдельные вопросы качества медицинской помощи по профилю «остеопатия»)
Belash, V. O., Tregubova, E. S.
Russian Osteopathic Journal, 2024/06
299

Short leg syndrome in clinical practice
(Синдром короткой ноги в клинической практике)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06
300

Osteopathy as a field of scientific knowledge: the path to evidence-based research
(Остеопатия как область научного познания: путь к доказательности исследований)
Mokhov, D. E., Tregubova, E. S., Potekhina, Y. P.
Russian Osteopathic Journal, 2024/06
301

Indicators of body postural balance plotted in time during the total occlusal reconstruction (pilot study
(Динамика показателей постурального баланса тела в процессе тотальной реконструкции окклюзии зубных рядов (пилотное исследование)
Osokin, A. V., Shemonaev, V. I., Postnikov, M. A., Parkhomenko, A. N.
Russian Osteopathic Journal, 2024/06
302

Dynamic styles of osteopaths based on assessment of the bioelectrical activity of the brain using the method of mathematical analysis of a first-order multivariate structural function
(Динамические стили остеопатов на основе оценки биоэлектрической активности мозга с применением метода математического анализа мультивариативной структурной функции первого порядка)
Piskunova, G. E., Trifonov, M. I., Panasevich, E. A., Belyaev, A. F.
Russian Osteopathic Journal, 2024/06
303

Hand joints mobility features of dentists in different specialties
(Особенности подвижности суставов верхних конечностей у врачей-стоматологов разных специальностей)
Vdovina, L. V., Bulycheva, M. M., Runova, N. B., Potekhina, Y. P.
Russian Osteopathic Journal, 2024/06
304

Die Inter Rater- Reliabilitätstestung des Vorlauftests im Stand und im Sitz
(Inter- rater- reliability of the standing and sitting forward flexion test in symptomatic and asymptomatic adults)
Flicker-Niederl, T.
Unpublished MSc thesis, 2024/06
305

Invasive Beatmung und prolongiertes Weaning: Auswirkungen osteopathischer Techniksequenzen
(Invasive ventilation and prolonged weaning. Effects of osteopathic sequences of techniques)
Boehme, A., Thönnessen, P., Ibel, R.
Osteopathische Medizin, 2024/06
306

Osteopathic Management of Chronic Pain Following Bilateral Periacetabular Osteotomy in Developmental Hip Dysplasia
Edgar, T., Heller, G. R., Hutson, M., Melin, D., Bardowell, A.
The AAO Journal, 2024/06
307

“That’s The Way We Have Always Done It”: Resetting the Hips
Tschantz, V., Fremarek, N., Hammond, E., Digambar, S., Vargas, E., Harden, D., Tobey, A. H., Kozar, A. J.
The AAO Journal, 2024/06
308

Effects of Osteopathic Manipulative Treatment (OMT) on Self-Reported Benefits and Lower Extremity Functionality in Parkinson’s Disease (PD) Patients
Finkelstein, A., Radigan, R., Mehra, M., Bhushan, P., Yao, S. C.
The AAO Journal, 2024/06
309

Der Gesundheitsbegriff bei A.T. Still: Eine qualitative Studie
(Andrew Taylor Still‘s concept of health)
Dippon, M.
Osteopathische Medizin, 2024/06
310

Osteopathie, was bist du?: Homo- und Heterogenität zwischen osteopathischen und manualmedizinischen Techniken
(Osteopathy, what are you?: Homogeneity and heterogeneity between osteopathic and manual medicine techniques)
Engel, M.
Osteopathische Medizin, 2024/06
311

Development of an Osteopathic Manipulative Treatment Clinician-Parent Home Care Education Intervention for Children with Otitis Media
Krzykwa, E., Pietrantoni, D., Waters, H.
The AAO Journal, 2024/06
312

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06
313

Impact of Cervical High-Velocity, Low-Amplitude Osteopathic Manipulative Technique on Blood Flow in the Middle Cerebral, Internal Carotid, and Vertebral Arteries
Mehmert, R., Troyer, E., Jones, J., Stull, C., Brunk-Grady, M., Kondrashov, P.
The AAO Journal, 2024/06
314

A Qualitative and Quantitative Analysis of Suboccipital Release on Heart Rate Variability
Moon, J., Fotopoulos, T. J., Gustin, D., Thornburgh, K. R., Wenner, A. R., McAllister, J. M.
The AAO Journal, 2024/06
315

Post Isometric Muscle Energy at the Cervical Spine (OA, C1, C2) Increases Vagal Tone as Quantified by Heart Rate Variability Metrics
Nakashima, T., Curran, C., Yates, H., Fanous, S., Johns, J., Fotopoulos, T. J., Miller, A.
The AAO Journal, 2024/06
316

Effects of OMT on Blood Glucose and Insulin Sensitivity in Adult Male Rats
Petrillo, G., Staudt, M., Lobo, S., Cai, W., Keys, J.
The AAO Journal, 2024/06
317

Severe Eczema and Hair Growth Improvements with Osteopathic Manipulative Treatment (OMT) in Pediatric Patient: A Case Study
Sanchez, E., Papadopoulos, D., Yao, S. C., Abu-Sbaih, R.
The AAO Journal, 2024/06
318

An Osteopathic Approach to Eyelid Myokymia
Shih, S., Rundquist, L., Qureshi, Y.
The AAO Journal, 2024/06
319

Stoffwechselflexibilität – eine wichtige Grundlage des Behandlungserfolgs: Prospektive Kohortenstudie über den Einfluss der osteopathischen Lebensstilberatung auf die metabolische Flexibilität
(Metabolic flexibility - an important basis of the treatment success: Prospective cohort study on the influence of osteopathic lifestyle coaching on metabolic flexibility)
Zweedijk, F., Smidts, Y.
Osteopathische Medizin, 2024/06
320

Berücksichtigung sozialer Faktoren in der Patient*innen-Osteopath*innen-Beziehung Eine qualitative Interviewstudie vor der Theorie des Enaktivismus
Mayrl, E.
Unpublished MSc thesis, 2024/06
321

The association of folate deficiency with clinical and radiological severity of knee osteoarthritis
Abedi, M., Mollashahi Javan, H., Khosravi, A., Rohani, R., Mohammadsharifi, G.
Journal of Osteopathic Medicine, 2024/05
Free full text
322

Associations of social determinants of health and childhood obesity: a cross-sectional analysis of the 2021 National Survey of Children’s Health
Batioja, K., Elenwo, C., Hendrix-Dicken, A., Ali, L., Wetherill, M. S., Hartwell, M.
Journal of Osteopathic Medicine, 2024/05
Free full text
323

Research integrity and academic medicine: the pressure to publish and research misconduct
Kearney, M., Downing, M., Gignac, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text
324

Die leise Stimme der PatientInnen: Interviews mit PatientInnen zum Thema „Die dritte Säule der evidenzbasierten Medizin in der osteopathischen Behandlung“
(The quiet voice of the patients: Interviews with patients on the topic of “The third pillar of evidence-based medicine in osteopathic treatment”)
Ebner, V.
Unpublished MSc thesis, 2024/05
325

Der Begriff Selbstheilung – und seine Bedeutung aus Perspektive österreichischer Osteopath:innen
(The concept of self-healing - and its meaning from the perspective of Austrian osteopaths)
Kaiser, K.
Unpublished MSc thesis, 2024/05
326

Interrater-Reliabilität des O'Brien-Tests
(Interrater reliability of the O'Brien test)
Rautenstengel, R.
Unpublished MSc thesis, 2024/05
327

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text
328

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text
329

The Tensegrity Curriculum: A Comprehensive Curricular Structure Supporting Cultural Humility in Undergraduate Medical Education
Jones, A. C., Bertsch, K. N., Williams, D., Channell, M. K.
Advances in Medical Education and Practice, 2024/05
Free full text
330

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05
331

Interrater-Reliabilität des O'Brien-Tests
(Interrater reliability of the O'Brien test)
Rautenstengel, R.
Unpublished MSc thesis, 2024/05
332

Celebrating Success: Osteopathic Physicians’ Journey From Match Day to Healthcare Leadership
Gregory, P.
Osteopathic Family Physician, 2024/05
333

A modern way to teach and practice manual therapy
Kerry, R., Young, K. J., Evans, D. W., Lee, E., Georgopoulos, V., Meakins, A., McCarthy, C., Cook, C., Ridehalgh, C., Vogel, S., Banton, A., Bergström, C., Mazzieri, A. M., Mourad, F., Hutting, N.
Chiropractic & Manual Therapies, 2024/05
Free full text
334

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text
335

The impact of emergency medicine residents on clinical productivity
Pallaci, M., Jouriles, N., dos Santos, A., Miller, J., Gothard, M. D., Seaberg, D. C.
Journal of Osteopathic Medicine, 2024/04
Free full text
336

The effectiveness of an osteopathic manual technique compared with a breathing exercise on vagal tone as indicated by heart rate variability, a crossover study
Cavanagh, M., Cope, T., Smith, D., Tolley, I., Orrock, P., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text
337

Reliabilität der Testung der 4 Diaphragmen nach dem Zink - Modell (Inter-rater Test Studie)
(Reliability of testing the 4 diaphragms according to the zink-model (inter-rater test study))
Hansmann, M.
Unpublished MSc thesis, 2024/04
338

Effect of manual osteopathic techniques on the autonomic nervous system, respiratory system function and head-cervical-shoulder complex—a systematic review
Stępnik, J., Czaprowski, D., Kędra, A.
Frontiers in Medicine, 2024/04
Free full text
339

Der unmittelbare Effekt einer osteopathischen Behandlung des Caecums - bei PatientInnen nach offener Appendektomie - auf die lumbopelvine Mobilität: eine randomisierte kontrollierte Studie
(The immediate effect of osteopathic treatment of the caecum - in patients after open appendectomy - on lumbopelvic mobility: a randomized controlled trial)
Prodinger, R.
Unpublished MSc thesis, 2024/04
340

Overcoming barriers to equality, diversity, inclusivity, and sense of belonging in healthcare education: the Underrepresented Groups' Experiences in Osteopathic Training (UrGEnT) mixed methods study
Draper-Rodi, J., Abbey, H., Hammond, J., Thomson, O. T., Brownhill, K., MacMillan, A., Fabusuyi, Y., Vogel, S.
BMC Medical Education, 2024/04
Free full text
341

Where are the Black men in osteopathic medical schools?
Megafu, M. N.
Journal of Osteopathic Medicine, 2024/04
Free full text
342

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text
343

Das Verständnis von deutschsprechenden Osteopath:innen der Schweiz bezüglich des Nervus vagus und dessen Integration in den Praxisalltag : eine qualitative Studie
(The understanding of German-speaking osteopaths in Switzerland regarding the vagus nerve and its integration into everyday practice : a qualitative study)
Eggenberg, E., Gottschalk, Y., Koller, M.
Unpublished MSc thesis, 2024/04
Free full text
344

L'intégration de la thématique du surpoids et de l'obésité en consultation ostéopathique : une étude qualitative phénoménologique
(The integration of the theme of overweight and obesity in osteopathic consultation: a phenomenological qualitative study)
Golay, S., Jordan, S.
Unpublished MSc thesis, 2024/04
Free full text
345

Quelle est la place de la respiration du·de la patient·e lors d’une consultation ostéopathique chez les ostéopathes pratiquant en Suisse : une étude qualitative phénoménologique
(What is the place of the patient's breathing during an osteopathic consultation among osteopaths practicing in Switzerland: a phenomenological qualitative study?)
Gremaud, L., Guggisberg, F., Marti, J., Morisetti, L.
Unpublished MSc thesis, 2024/04
Free full text
346

Quel raisonnement clinique adoptent les ostéopathes travaillant en Suisse romande pour le traitement des patient·e·s consultant pour un motif de céphalées ? : une étude qualitative
(What clinical reasoning do osteopaths working in French-speaking Switzerland adopt for the treatment of patients consulting for a reason of headache? A qualitative study)
Rey, S., Caviglioli, M.
Unpublished MSc thesis, 2024/04
Free full text
347

Que signifie l’infertilité pour les ostéopathes suisses et quelle est l’importance de la fertilité dans leur pratique ostéopathique?
(What does infertility mean to Swiss osteopaths, and how important is fertility to their osteopathic practice?)
Schär, S., Sarlandie, M.
Unpublished MSc thesis, 2024/04
Free full text
348

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text
349

Australian private health insurer attitudes towards osteopathy: A qualitative study
Engel, R., Grace, S., Duncan, N., Wade, B., Paterson-Allsop, J., O'Hara, B., Vaughan, B.
International Journal of Osteopathic Medicine, 2024/03
Free full text
350

A framework for the interpretation of heart rate variability applied to transcutaneous auricular vagus nerve stimulation and osteopathic manipulation
Kania, A., Roufail, J., Prokop, J., Stauss, H. M.
Physiological Reports, 2024/03
Free full text
351

Comparing the remote effects of dry needling and ischemic pressure on pain intensity and threshold of the myofascial trigger points in women: A Single Blinded Randomized Clinical Trial
Ghanavati, T., Adigozali, H., Rezaei, M., Gilani, N., Ahadi, J.
International Journal of Osteopathic Medicine, 2024/03
352

Perceptions of Australian osteopaths on the use of telehealth for patient care: Barriers and enablers for implementation
Grace, S., Engel, R., Mastronardo, C., Muddle, L., Fleischmann, M., Vaughan, B., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2024/03
Free full text
353

Inter-rater and intra-rater reliability of manual assessment of respiratory motion in patients with unilateral cervical radiculopathy: A cross-sectional study
Kordi Yoosefinejad, A., Yousefiyan, R., Nazari, R., Rezaei, I.
International Journal of Osteopathic Medicine, 2024/03
354

What is wrong with osteopathy? A response to Thomson and MacMillan
Nicholls, D. A.
International Journal of Osteopathic Medicine, 2024/03
355

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03
356

The inter- and intra-rater reliability of the manual diaphragm assessment scale in healthy participants
Viegas, I., Francisco, C., Farinha, E., Nunes, A.
International Journal of Osteopathic Medicine, 2024/03
357

Influence of professional sports activities on bone mineral density (literature review
(Влияние профессиональной спортивной деятельности на минеральную плотность кости (обзор литературы)
Nikitina, K. I., Vykhodets, I. T., Abramova, T. F., Nikitina, T. M.
Russian Osteopathic Journal, 2024/03
358

From the Editor: Aspects of Complexity in Osteopathic Medicine
Ching, L. M.
The AAO Journal, 2024/03
Free full text
359

The effect of complex treatment including osteopathic correction on pain intensity and quality of life in patients with chronic tonsillitis
(Влияние комплексного лечения с включением остеопатической коррекции на интенсивность боли и качество жизни пациентов с хроническим тонзиллитом)
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushkin, S. A.
Russian Osteopathic Journal, 2024/03
360

The role of aspirin, statins, colchicine, and IL-1 inhibitors in prevention of cardiovascular events: a systematic integrative review
Arboleda, V., Hackworth, A., Bonnice, S., Gonzalez, V., Cabrera, D., Colletti, C., Baxter, C., Aleman Oliva, C., Kabir, S., Huang, J., Khan, A., Filoramo, S., Ecoff, S., Demory Beckler, M., Kesselman, M. M.
Journal of Osteopathic Medicine, 2024/03
Free full text
361

The Effects of Patient-specific Sequenced Osteopathic Manipulative Treatment by AGR on Quality of Life
Yang, Y., Stiles, E., Kingery, J.
The AAO Journal, 2024/03
362

Werden osteopathische Studien zu Unrecht methodisch abgewertet?: Über die Ergebnisse einer meta-epidemiologischen Studie hinsichtlich der Verblindung von Teilnehmer*innen in randomisiert kontrollierten Studien
(Are osteopathic studies wrongly methodologically downgraded?: On the results of a meta-epidemiological study regarding the blinding of participants in randomized controlled trials)
Franke, H.
Osteopathische Medizin, 2024/03
Free full text
363

Strain Relief – Teil 2: Technische Ausführung: Behandlung chronischer Schmerzen in der unteren Extremität
(Strain Relief - Part 2: Technical performance: Treatment of chronic pain in the lower extremity)
Liedtke, H.
Osteopathische Medizin, 2024/03
364

Osteopathische Behandlungsmöglichkeiten chronisch entzündlicher Darmerkrankungen: Eine qualitative Analyse von Interviews
(Osteopathic treatment options for chronic inflammatory bowel disease: A qualitative analysis of interviews)
Pestonit, J. F., Hesse, T.
Osteopathische Medizin, 2024/03
365

„Osteopathische Medizin mit wissenschaftlich belegbaren Argumenten fundiert kommunizieren“: Gabi Prediger interviewt Priv.-Doz. Dr. med. Gabriele Rotter
(“Communicating osteopathic medicine with scientifically validated arguments“: Gabi Prediger interviews Priv.-Doz. Dr. med. Gabriele Rotter)
Rotter, G., Prediger, G.
Osteopathische Medizin, 2024/03
366

Aus der digitalen Welt
(From the digital world)
Sonntag, M.
Osteopathische Medizin, 2024/03
Free full text
367

The evolution of type 2 diabetes management: glycemic control and beyond with SGLT-2 inhibitors and GLP-1 receptor agonists
Serowik, T. C., Pantalone, K. M.
Journal of Osteopathic Medicine, 2024/03
Free full text
368

Increased circulating microRNA-21 level as a potential indicator for predicting a higher risk of incident fragility fractures
Si, Z.X., Zhou, S.F., Shen, Z.L., Yan, J.L.
Journal of Osteopathic Medicine, 2024/03
Free full text
369

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03
370

Interrater agreement and reliability of a palpation method for locating C1 transverse process in the cervical spine
Ferreira, A. P. A., Maddaluno, M. L. M., Curi, A. C. C., Ferreira, A. d. S.
International Journal of Osteopathic Medicine, 2024/03
371

Cross-Sectional Analysis of the Effect of Physical Activity, Nutrition, and Lifestyle Factors on Medical Students' Academic Achievement
Neuman, J., Ina, E. A., Huq, S. O., Blanca, A., Petrosky, S. N.
Cureus, 2024/03
Free full text
372

Effect of Osteopathic Manipulation in an Autism Spectrum Child With Speech Impairment and Attention Deficit: A Case Report
Sharath, H. V., Raghuveer, R., Qureshi, M. I., Warghat, P. A., Desai, S., Brahmane, N. A.
Cureus, 2024/03
Free full text
373

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03
374

Effect of physiotherapy on infertility treatment in polycystic ovary syndrome patients
Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jędrzejczyk, S., Jerzak, M., Jerzak, M.
Przegląd Menopauzalny, 2024/03
375

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03
376

Is Craniosacral Therapy Effective? A Systematic Review and Meta-Analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Cabanillas-Barea, S., Esteban-Pérez, J., Jiménez-del-Barrio, S.
Healthcare, 2024/03
Free full text
377

The Sentient Cell: Implications for Osteopathic Medicine
Bordoni, B., Escher, A. R., Castellini, F., Vale, J.
Cureus, 2024/02
Free full text
378

Osteopathic approach as an additional therapy of infertility in women with PCOS
Jędrzejczyk, S., Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jerzak, M., Jerzak, M.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/02
379

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02
380

Social determinants of health in patients with arthritis: a cross-sectional analysis of the 2017 Behavioral Risk Factor Surveillance System
Webb, J., Emmert, R., Reddy, A., Sajjadi, N. B., Greiner, B., Bray, N., Hartwell, M.
Journal of Osteopathic Medicine, 2024/02
Free full text
381

Profession-based manual therapy nomenclature: exploring history, limitations, and opportunities
Degenhardt, B., van Dun, P. L. S., Jacobson, E., Fritz, S., Mettler, P., Kettner, N., Franklin, G., Hensel, K., Lesondak, D., Consorti, G., Frank, L., Reed, W. R., MacDonald, C., Kremen, V., Martin, C., Landels, B., Standley, P.
Journal of Manual & Manipulative Therapy, 2024/02
Free full text
382

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text
383

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text
384

Reliability and Validity of the Variability Model Testing Procedure for Somatic Dysfunction Assessment: A Comparison with Gait Analysis Parameters in Healthy Subjects
Vismara, L., Bergna, A., Tarantino, A. G., Dal Farra, F., Buffone, F., Vendramin, D., Cimolin, V., Cerfoglio, S., Pradotto, L. G., Mauro, A.
Healthcare, 2024/02
Free full text
385

Interdisciplinary Approach to Orthodontic Treatment Involving an Osteopath and a Dentist (Protocol)
Aptekar, I. A., Abramova, E. V., Postnikov, M. A., Kopetsky, I. S., Eremin, D. A., Postnikova, E. M., Poluianova, E. B., Aptekar, V. I., Muravyov, I. O.
Bulletin of Russian State Medical University, 2024/02
Free full text
386

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text
387

Delayed discovery: the COVID-19 pandemic’s influence on osteoarthritis clinical trials
Sajjadi, N. B., Anderson, J. M., Hughes, G. K., Abraham, C. E., Malik, J., Hartwell, M., Vassar, M.
Journal of Osteopathic Medicine, 2024/01
Free full text
388

Zwischen Evidenz und individueller klinischer Expertise – ein Vergleich der Konzeption der Evidenzbasierten Medizin und den Anliegen der Osteopathie
(Between evidence and individual clinical expertise – a comparison of the concept of evidence-based medicine and the concerns of osteopathy)
Stierl, J. A.
unpublished MSc thesis, 2024/01
389

The Effect of the Coronavirus (COVID-19) Pandemic on Gender and Medical School Diversity in Gastroenterology Fellowship Matching
Almujarkesh, M. K., Alsakarneh, S., Almeqdadi, M., Al Ta'ani, O., Mohamad, B., Kinnucan, J.
Gastro Hep Advances, 2024/01
Free full text
390

Mitleid und Mitgefühl
(Pity and compassion)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
391

The Future of Osteopathy
Bordoni, B., Escher, A. R.
Cureus, 2024/01
Free full text
392

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text
393

Does Osteopathic Heart-Focused Palpation Modify Heart Rate Variability in Stressed Participants with Musculoskeletal Pain? A Randomised Controlled Pilot Study
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Healthcare, 2024/01
Free full text
394

Antitumoral Agent-Induced Constipation: A Systematic Review
Calsina-Berna, A., González-Barboteo, J., Llorens-Torromé, S., Julià-Torras, J.
Cancers, 2024/01
Free full text
395

Characteristics, Opportunities, and Challenges of Osteopathy Based on the Perceptions of Osteopaths in Austria: Qualitative Interview Study
Manschel, J., Porthun, J., Winkler, U., Beuckels, J. M., Martin, D.
JMIR Human Factors, 2024/01
Free full text
396

Integrating Osteopathic Principles for Enhanced Dermatological Outcomes: A Literature Review
Ventura, N., Soti, V.
Cureus, 2024/01
Free full text
397

Expériences des personnes transgenres et/ou non binaires en ostéopathie en Suisse romande : étude phénoménologique
(Experiences of transgender and/or non-binary people in osteopathy in French-speaking Switzerland: a phenomenological study)
Lefaure, B., Mercier, I., Jobin, M.
Unpublished MSc thesis, 2024/01
398

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12
399

Osteopathie als Beruf: Zur Praxeologie des osteopathischen Handelns
(Osteopathy as a profession: The praxeology of osteopathic practice)
Kaiser, A. K.
Osteopathische Medizin, 2023/12
400

Strain Relief – Teil 1: Grundlagen: Ein neues Verfahren zur Behandlung chronischer Schmerzen im Bewegungsapparat am Beispiel von therapieresistenten, funktionellen Beschwerden in der unteren Extremität
(Strain Relief - Part 1: Basics: A new procedure for the treatment of chronic pain in the musculoskeletal system using the example of therapy-resistant, functional complaints in the lower extremities)
Liedtke, H.
Osteopathische Medizin, 2023/12
401

Power and capital: In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
402

Views from Australian osteopaths and industry stakeholders about the profession: A qualitative study
Mastronardo, C., Muddle, L., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2023/12
403

Effects of combined taping of quadriceps and hamstring muscles on pain and disability in patients with knee osteoarthritis: Randomized assessor-blinded controlled study
Mohamed, Y. E., Abd-Alkareem, D. S., Balbaa, A.E. A.A., Samy, M. M., Ashour, R. S.
International Journal of Osteopathic Medicine, 2023/12
404

Construct validity and reliability of a test for sacroiliac dysfunction: Downing test
Ribeiro, R. P., Guerrero, F. G., Camargo, E. N., Pivotto, L. R., Aimi, M. A., Candotti, C. T., Loss, J. F.
International Journal of Osteopathic Medicine, 2023/12
405

Application of high-velocity low-amplitude technique in cervicothoracic junction produces cardiovascular responses in subjects with C7-T1 dysfunction: Randomized crossover trial
Zago, J., de Souza, B. U. L., Amatuzzi, F., Rondinel, T. Z., Queiroz, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2023/12
406

Osteopathic status and quality of life of healthy pregnant women
(Остеопатический статус и качество жизни здоровых беременных)
Davletshina, L. T., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/12
Free full text
407

The possibility of reversibility of liver fibrosis under the influence of complex treatment
(Возможность обратимости фиброза печени под влиянием комплексного лечения)
Kozhokina, S. G.
Russian Osteopathic Journal, 2023/12
Free full text
408

Pathophysiological aspects of microgravity and gravity therapy in cardiovascular diseases
(Патофизиологические аспекты микрогравитации и гравитационной терапии при сердечно-сосудистых заболеваниях)
Pereshein, A. V., Kuznetsova, S. V., Petrova, D. A., Potemina, T. E.
Russian Osteopathic Journal, 2023/12
Free full text
409

From the Editor: Interrelationship in Osteopathic Medicine
Ching, L. M.
The AAO Journal, 2023/12
Free full text
410

Simplicity of Osteopathy
Fryette, H. H.
The AAO Journal, 2023/12
Free full text
411

Osteopathic Manipulative Treatment for the Management of Irritable Bowel Syndrome: A Case Report
Heineman, K.
The AAO Journal, 2023/12
Free full text
412

‘More harm than good’ – A qualitative study exploring the attitudes and beliefs of a group of Italian osteopaths about spinal imaging in the management of patients with chronic low back pain
Ogliari, L., Formica, A., Bettelli, L.
International Journal of Osteopathic Medicine, 2023/12
413

Power and capital; In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
414

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text
415

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12
416

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12
417

Retrospective Study of Osteopathic Manipulative Treatment Use for Pain in Patients with Ehlers Danlos Syndromes and Hypermobility Spectrum Disorder (EDS/HSD)
Chung, M. J., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
418

Making sense of cranial osteopathy: An interpretative phenomenological analysis
Banton, A., Vogel, S., Lee-Treweek, G.
International Journal of Osteopathic Medicine, 2023/12
Free full text
419

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12
420

Assessing Correlation Between Manual Dexterity, Specialty Choice and Desire to Practice OMT in Newly Admitted Osteopathic Medical Students
Rome, V., Brolis, N.
Journal of Osteopathic Medicine, 2023/12
421

Trends in Contributions to the Osteopathic Political Action Committee: A Twenty-Two-Year Analysis
Scully, T., Loria, R., Golden, A., Martinez, V. H., Sees, J.
Journal of Osteopathic Medicine, 2023/12
422

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12
423

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
Free full text
424

Interrater-Reliabilität des dynamischen Michaelis-Rauten-Tests bei StudienteilnehmerInnen mit und ohne lumbale und/oder urogenitale Beschwerden
(Interrater reliability of the dynamic Michaelis diamond test in study participants with and without lumbar and/or urogenital complaints)
Crone, A.
Unpublished MSc thesis, 2023/11
425

Erwartungen von PatientInnen der deutschsprachigen Schweiz an OsteopathInnen und die osteopathische Behandlung
(Expectations of patients in German-speaking Switzerland regarding osteopaths and osteopathic treatment)
Hanke, K.
Unpublished MSc thesis, 2023/11
426

Interrater-Reliabilität eines Mobilitätstests der Harnblase bei symptomatischen und asymptomatischen Frauen
(Interrater reliability of a mobility test of the urinary bladder in symptomatic and asymptomatic women)
Hopfner, R.
Unpublished MSc thesis, 2023/11
427

Anorexie mentale et médiations somatiques : évaluations croisées de l’ostéopathie et de la psychomotricité sur les préoccupations corporelles
(Osteopathy and Anorexia Nervosa: Cross-evaluations of osteopathy and psychomotricity on bodily concerns)
Mattatia, J., Gaha, N., Cottin, L., Mattatia, D., Morelle, Q., Truong, R., Saussé-Corbière, L., Yi, M.K.
Annales Médico-psychologiques, revue psychiatrique, 2023/11
428

Testung der Interrater Reliabilität bei Verwendung der MED-Skala zur Mobilitätstestung des Diaphragmas abdominale
(Testing of interrater reliability when using the MED scale for mobility testing of the abdominal diaphragm)
Pleterski, L.
Unpublished MSc thesis, 2023/11
429

Der Effekt einer osteopathischen Behandlung verglichen mit einer Scheinbehandlung, auf das autonome Nervensystem, gemessen mit der Herzratenvariabilität, bei Long/Post COVID-19 Patienten mit Fatigue Syndrom: Eine klinische randomisierte kontrollierte Studie
(The effect of osteopathic treatment compared with sham treatment on the autonomic nervous system, as measured by heart rate variability, in long/post COVID-19 patients with fatigue syndrome: A clinical randomized controlled trial)
Pöhlmann, T.
Unpublished MSc thesis, 2023/11
430

Interrater-Reliabilität des Active Straight Leg Raise Tests
(Interrater reliability of the Active Straight Leg Raise Test)
Tinodi, N.
Unpublished MSc thesis, 2023/11
431

Die Selbsteinschätzung von Intuition und analytischer Erkenntnis in Bezug auf Anamnese und Befund bei österreichischen OsteopathInnen
(Self-assessment of intuition and analytical knowledge in relation to anamnesis and diagnosis of Austrian osteopaths)
Brandstötter, M.
Unpublished MSc thesis, 2023/11
432

Welchen Einfluss hat eine Manipulation mit einer HVLA Technik (High-Velocity–Low-Amplitude-Thrust) am oberen Sprunggelenk bei Erwachsenen mit einer funktionellen Instabilität (FI) auf die Faktoren Range of Motion in der Dorsalflexion, den Schmerz, insuffiziente Reflexe und den funktionellen Zustand?
(What is the impact of a manipulation with an HVLA technique (high-velocity-low-amplitude-thrust) on the ankle joint in adults with functional instability (FI) on the factors range of motion in dorsiflexion, pain, insufficient reflexes and functional instability?)
Callegari-Reinhold, K. R.
Unpublished MSc thesis, 2023/11
433

Der Einfluss einer suboccipitalen Release Technik auf den Schmerz sowie auf die sensomotorische Leistung bei PatientInnen mit chronischen, unspezifischen Nackenschmerzen
(The influence of a suboccipital release technique on pain and sensorimotor performance in patients with chronic, non-specific neck pain)
Kiener, S.
Unpublished MSc thesis, 2023/11
434

Palpation von Hypomobilität im distalen Tibiofibulargelenk
(Palpation of hypomobility of the distal tibiofibular joint)
Kunter, T.
Unpublished MSc thesis, 2023/11
Free full text
435

Der Einfluss des „general osteopathic treatment“ (GOT) auf das Gangbild, die Funktionalität und posturale Kontrolle von Schlaganfallpatient*innen. Eine randomisierte kontrollierte Pilotstudie
(The influence of “general osteopathic treatment“ (GOT) on gait, functionality and postural control in stroke patients. A randomized controlled pilot study)
Mühlbauer, T.
Unpublished MSc thesis, 2023/11
436

Interrater-Reliabilitätstestung des kranialen Ecoute-Tests der Dura mater spinalis
(Inter-rater reliability for the cranial Ecoute-Test of the Dura mater spinalis)
Raffeiner, E.
Unpublished MSc thesis, 2023/11
437

Interrater-Reliabilität des Tissue Tension Tests
(The interrater reliability of the Tissue Tension Test)
Roch, M.
Unpublished MSc thesis, 2023/11
438

Hat eine auf Körperflüssigkeit und Diaphragmen basierende osteopathische Behandlung in Kombination mit Physiotherapie eine bessere Wirkung auf die gesundheitsbezogene Lebensqualität bei ambulant betreuten MS-PatientInnen als ausschließlich physiotherapeutische Behandlung?
(Does body fluid and diaphragm-based osteopathic treatment combined with physical therapy have a better effect on health-related quality of life in outpatients with MS than physical therapy alone?)
Shikha, K.
Unpublished MSc thesis, 2023/11
439

Uterusmobilität – eine Inter-Rater-Reliabilitätsstudie
(Uterine mobility test – an inter-rater-reliability study)
Wuschko, M.
Unpublished MSc thesis, 2023/11
440

Updates on Diversity Among Cardiology-Related Fellowships
Walk, C. T., Lantz, R.
Cureus, 2023/10
441

The factors influencing the awareness and uptake of osteopathy by Pacific people in Auckland
Fifita, Y. C.
Unpublished MSc thesis, 2023/10
Free full text
442

Historische Denkmodelle der Iliosakralbewegungen
(Historical models for the iliosacral joint)
Koch, D.
unpublished DO thesis, 2023/10
Free full text
443

The osteopath-parent-child triad in osteopathic care in the first 2 years of life: a qualitative study
Accardi, C., Cerritelli, F., Bovo, L., Esteves, J. E.
Frontiers in Psychology, 2023/10
Free full text
444

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text
445

A biopsychosocial approach as a part of an osteopathic intervention in the management of chronic prostatitis/chronic pelvic pain: A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2023/10
446

The Use of Osteopathic Manipulative Treatment for Treatment of Sore Throat, Headache, and Facial Pain: A Case Report
Berkowitz, M. R.
The AAO Journal, 2023/09
Free full text
447

From the Editor: Phenomenology and the Development of Expertise in Osteopathy
Ching, L. M.
The AAO Journal, 2023/09
Free full text
448

Resolution of Stridor, Gastritis and Cephalgia in an Adolescent with Reflex Sympathetic Dystrophy Following Osteopathic Manipulative Treatment—A Case Report
Habenicht, A. L.
The AAO Journal, 2023/09
Free full text
449

Changes in the osteopath′s brain bioelectrical activity while listening to the patient′s cranial rhythmic impulse (pilot study
(Изменения биоэлектрической активности мозга врача-остеопата в процессе прослушивания краниального ритмического импульса пациента (пилотное исследование)
Piskunova, G. E., Belyaev, A. F.
Russian Osteopathic Journal, 2023/09
Free full text
450

Dermal Reflections of Neural Disorders: An Hypothesis
Patriquin, D. A.
The AAO Journal, 2023/09
Free full text
451

Comparison of affected lumbar proprioception due to different injuries with healthy controls: An observational study
Simsek, S., Altindal, F., Kilicarslan, B.
International Journal of Osteopathic Medicine, 2023/09
452

The role of manual therapy for osteopaths in the management of temporomandibular disorders: A qualitative study
McComish, N.
Unpublished MSc thesis, 2023/09
Free full text
453

Der Einwärtsgang – Physiologie oder Pathologie?
(The inward gait - physiology or pathology?)
Halasz, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
454

Klinische Differenzialdiagnostik bei 4–12-jährigen kieferorthopädischen Patienten
(Clinical differential diagnostics in 4-12-year-old orthodontic patients)
Medlitsch, A., Pittschieler, E.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
455

Mechanische Eigenschaften der Arterien
(Mechanical characteristics of the arteries)
Wyvekens, M., Hirth, T., Wyvekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
456

Models of medical rehabilitation: problems and solutions
(Модели медицинской реабилитации: проблемы и их решения)
Eremushkin, M. A.
Russian Osteopathic Journal, 2023/09
Free full text
457

Osteopathy in the world of modern medicine
(Остеопатия в мире современной медицины)
Konopleva, E. L., Ostapenko, V. M., Tarasov, N. A.
Russian Osteopathic Journal, 2023/09
Free full text
458

Possibilities of non-drug methods of treatment for chronic pelvic pain syndrome in men (systematic review
(Возможности немедикаментозных методов лечения при синдроме хронической тазовой боли у мужчин (систематический обзор)
Krikunov, A. I., Potekhina, Y. P.
Russian Osteopathic Journal, 2023/09
Free full text
459

A new view at the problem of finding the center of stability of the spine
(Новый взгляд на проблему поиска центра устойчивости позвоночника)
Orel, A. M., Semenova, O. K.
Russian Osteopathic Journal, 2023/09
Free full text
460

Changes in the osteopath′s brain bioelectrical activity while listening to the patient′s cranial rhythmic impulse (pilot study)
(Изменения биоэлектрической активности мозга врача-остеопата в процессе прослушивания краниального ритмического импульса пациента (пилотное исследование))
Piskunova, G. E., Belyaev, A. F.
Russian Osteopathic Journal, 2023/09
461

Influence of Osteopathic Manipulative Treatment on the Quality of Life and the Intensity of Lumbopelvic Pain in Pregnant Women in the Third Trimester: A Prospective Observational Study
Correia, M. L. A., Peixoto Filho, F. M., Gomes Júnior, S. C.
Healthcare, 2023/09
Free full text
462

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09
463

Short-term effects on heart rate variability of occipito-mastoid suture normalization in healthy subjects
Besson, C., Mur, T., Benaim, C., Schmitt, L., Gremeaux, V.
Frontiers in Neuroscience, 2023/09
Free full text
464

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text
465

Die Schilddrüse aus der Sicht der Osteopathie: Teil 3: Behandlung
(The thyroid gland from the point of view of osteopathy: Part 3: Treatment)
Frühwein, J.
Osteopathische Medizin, 2023/09
466

„Der Placeboeffekt ist nichts Schlimmes!“
('The placebo effect isn't a bad thing!')
Stechmann, K., Cerritelli, F.
Osteopathische Medizin, 2023/09
467

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09
468

Medical Uncertainty of Future Physicians: Socialization and Uncertainty Management in Medical Education
Duty, K. M.
Unpublished PhD thesis, 2023/08
469

Medical Leadership in Inpatient Rehabilitation Facilities in the United States
Davis, S. M., Davis, A., Wong, T., Mekany, M., Majors, D., Perret Karimi, D.
American Journal of Physical Medicine & Rehabilitation, 2023/08
Free full text
470

The Evaluation of a Digital Health Intervention to Improve Human Papillomavirus Vaccine Recommendation Practices of Medical Students
Richman, A. R., Torres, E., Wu, Q., Eldridge, D., Lawson, L.
Journal of Cancer Education, 2023/08
471

Diversity Differences Among Cardiovascular Fellowships Across Five Geographic Regions in the United States
Dye, M., Saeed, A., Nguyen, T. Q., Yu, S., Bey, J., Hefner, D., Walk, C. T., Lantz, R.
Cureus, 2023/08
Free full text
472

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text
473

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text
474

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text
475

Peritoneal Adhesions in Osteopathic Medicine: Theory, Part 1
Bordoni, B., Escher, A. R., Girgenti, G. T.
Cureus, 2023/07
Free full text
476

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/07
477

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07
478

Effectiveness of Osteopathic Manipulative Treatment in Treating Symptoms of Irritable Bowel Syndrome: A Literature Review
Lotfi, C., Blair, J., Jumrukovska, A., Grubb, M., Glidden, E., Toldi, J.
Cureus, 2023/07
Free full text
479

An Osteopathic Approach to Dizziness Secondary to Meniere’s Disease
Grote, J., Perez, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
480

Der biodynamische Behandlungsansatz in der osteopathischen Praxis – eine qualitative Interviewstudie
(The biodynamic treatment approach in osteopathic practice - a qualitative interview study)
Grasmück, J., Müller, F., Kienzler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
481

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
Free full text
482

Resolution of a Plica Band Syndrome with Osteopathic Manipulative Treatment
Barr, J., Heller, G.
The AAO Journal, 2023/06
Free full text
483

Investigating the mechanism of dextrose prolotherapy in vitro: fibroblast proliferation and production of growth factors
Harting, B., Fox, S., Motyka, T., Hinkelman, A.
The AAO Journal, 2023/06
Free full text
484

Effect of Muscle Energy Technique (MET) on muscle parameters and lower extremity functionality in a Parkinson’s Disease (PD) patient: A case report
Macmillan, G., Radigan, R., Finkelstein, A., Yao, S.
The AAO Journal, 2023/06
Free full text
485

Osteopathic Manipulative Treatment for Chemotherapy-Induced Abdominal Pain and Anorexia in Glioblastoma Multiforme
McIntire, R., Terry, R., Gebhardt, G.
The AAO Journal, 2023/06
Free full text
486

Die Schilddrüse aus der Sicht der Osteopathie: Teil 2: Pathologie und Dysfunktion
(The thyroid gland from the point of view of osteopathy: Part 2: Pathology and dysfunction)
Frühwein, J.
Osteopathische Medizin, 2023/06
Free full text
487

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
Free full text
488

Palpatory tests in manual therapies: an international survey on osteopathic clinical practice
Novelli, E., Molinari, L., Consolo, S., Mingrone, L.
Journal of Complementary and Integrative Medicine, 2023/06
Free full text
489

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06
490

Influence of osteopathic correction on range of motion and quality of life in patients with arthrosis of the shoulder joint of I–II degrees
(Влияние остеопатической коррекции на объем движения и качество жизни у пациентов с артрозом плечевого сустава I–II степени)
Avzaletdinov, B. K., Akhmetov, B. H.
Russian Osteopathic Journal, 2023/06
Free full text
491

Phenotypic signs of connective tissue dysplasia in adolescents
(Фенотипические признаки дисплазии соединительной ткани у подростков)
Shashmurina, V. R., Mishutina, O. L., Postnikov, M. A., Shashmurina, A. B., Dmitrieva, E. V., Parfenov, R. V.
Russian Osteopathic Journal, 2023/06
Free full text
492

The influence of general osteopathic treatment on the quality of life of elderly people
(Влияние общего остеопатического лечения на качество жизни людей пожилого возраста)
Usupbekova, B. S., Zhusupbekova, N. E., Shyikymanarov, E. S.
Russian Osteopathic Journal, 2023/06
Free full text
493

The possibilities of osteopathic correction using for the treatment of children with attention deficit hyperactivity disorder
(Возможности применения остеопатической коррекции для лечения детей с синдромом дефицита внимания и гиперактивности)
Zaev, A. I., Stenkova, O. V.
Russian Osteopathic Journal, 2023/06
Free full text
494

Tau mai te wairua, tau mai te hauora: Navigating hauora in osteopathy
Thomas, J. D.
Unpublished MSc thesis, 2023/06
Free full text
495

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06
496

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists: An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/06
497

Terapia manual y tratamiento osteopático en pacientes con EPOC estable
(Manual therapy and osteopathic treatment in patients with stable COPD)
Diaz Serrano, R., Souto Villar, M. A.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text
498

Eficacia de la terapia combinada con la técnica de inhibición suboccipital y la manipulación del segmento cervical alto en la cefalea tensional
(Effectiveness of combined therapy with suboccipital inhibition technique and upper cervical segment manipulation in tension headache)
Ferrera Suárez, A.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text
499

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/06
Free full text
500

Accompagner les changements curriculaires vers l’approche par compétences dans les formations en santé : étude d’une stratégie de changement pragmatique portée par un individu-tercéisateur dans un institut de formation en ostéopathie français
(Facilitating curricular changes towards the competency-based approach in health education : study of a pragmatic change strategy supported by a third-party with terceisation function in an osteopathic training institute)
Quesnay, P.
Unpublished PhD thesis, 2023/06
501

Exploring the effects of standardized soft tissue mobilization on the viscoelastic properties, pressure threshold and touch threshold of the caesarean section scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2023/06
502

Efectos del tratamiento osteopático en trastornos neurocognitivos asociados y la calidad de vida relacionada con la salud en el trastorno del espectro alcohólico fetal
(Effects of osteopathic treatment on associated neurocognitive disorders and health-related quality of life in fetal alcohol spectrum disorder)
Cases Solé, R.
Unpublished PhD thesis, 2023/06
Free full text
503

Osteopathy in the Early Diagnosis and Management of Degenerative Cervical Myelopathy: National Survey
Brannigan, J. F. M., Mowforth, O. D., Rogers, M., Wood, H., Karimi, Z., Kotter, M. R. N., Davies, B. M.
JMIR Formative Research, 2023/05
Free full text
504

The effect of cranial techniques on the heart rate variability response to psychological stress test in firefighter cadets
Wójcik, M., Siatkowski, I.
Scientific Reports, 2023/05
Free full text
505

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
506

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05
507

Osteopathic manipulative treatment of patients with chronic low back pain in the United States: a retrospective cohort study
Licciardone, J. C., Moore, S., Fix, K., Blair, L. G., Ta, K.
Journal of Osteopathic Medicine, 2023/05
Free full text
508

Perceptions of experienced osteopaths on interprofessional communication
Grech, R.
Unpublished MSc thesis, 2023/05
Free full text
509

Is there a mean difference in attitude when care for LGBTQ patients between primary care provider subgroups?
Doan, T.
Unpublished MSc thesis, 2023/05
Free full text
510

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists : An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/05
511

Effets d’une vocalisation sur l’activité cérébrale lors d’un chatouillement
(Effects of vocalization on brain activity during tickling)
Barras, M., Casas, L.
Unpublished MSc thesis, 2023/04
Free full text
512

Comment les ostéopathes enseignant en Suisse décrivent leur raisonnement ? clinique : Une étude phénoménologique descriptive
(How osteopaths teaching in Switzerland describe their clinical reasoning: A descriptive phenomenological study)
Very, A.
Unpublished MSc thesis, 2023/04
513

Efficacy of the Osteopathic Pedal Pump in Reducing Lower Limb Volume in Older Adults with Lymphedema
Parikh, S. H., Adams, J. S., Goodwin, B. J., McLaughlin, M. H., Noll, D. R.
Journal of the American Geriatrics Society, 2023/04
514

Comparative Effects of Positional Release Technique Versus Deep Transverse Friction Massage on Pain and Disability in patients with Acute Mechanical Low Back Pain
Ammara, U., Shahzadi, F., Nazir, S., Fatima, K., Batool, F., Gondal, K. S., Aqeel, M., Shah, S., Maqbool, S.
Pakistan Journal of Medical and Health Sciences, 2023/04
515

The role of manual therapy in the management of temporomandibular joint disorder: A scoping review
Arefian, N.
Unpublished MSc thesis, 2023/04
Free full text
516

Exploring the approaches used by New Zealand osteopaths to help promote exercise rehabilitation adherence
Whitford, P.
Unpublished MSc thesis, 2023/04
Free full text
517

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text
518

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text
519

Informing the Physical Therapy Management of Congenital Muscular Torticollis Clinical Practice Guideline: A Systematic Review
Castilla, A., Gonzalez, M., Kysh, L., Sargent, B.
Pediatric Physical Therapy, 2023/04
520

Does the osteopathic pedal pump reduce lower limb volume in healthy subjects?
Adams, J. S., Parikh, S. H., Goodwin, B. J., Noll, D. R.
Journal of Osteopathic Medicine, 2023/04
Free full text
521

Quelles sont les attentes et les croyances des patient-e-s romand-e-s vis-à-vis du processus de consentement dans la prise en charge ostéopathique ? : une étude qualitative
(What are French-speaking Swiss patients' expectations and beliefs regarding the consent process in osteopathic care? A qualitative study)
Droux, F., Dubosson, A.
Unpublished MSc thesis, 2023/04
Free full text
522

A Heart for Medicine: Palpitations In the Midst of Training
Coggins, J.
Osteopathic Family Physician, 2023/03
523

Die osteopathische Technik – ein Metakonzept
(The osteopathic technique - a meta concept)
Engel, M.
Osteopathische Medizin, 2023/03
524

Covid-19 Fatigue: Diagnosis and Treatment for the Osteopathic Physician
Foss, V. B., Maddie, N., Frankini, E. L., Landman, S., Maccagnano, J., Yao, S. C.
Osteopathic Family Physician, 2023/03
525

What Makes Us Special, Different and Alike?
Gregory, P.
Osteopathic Family Physician, 2023/03
526

A Case Study of Postural Imbalance with Lymphatic Congestion Which Responded to OMT
Lockhart, W. C.
The AAO Journal, 2023/03
Free full text
527

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03
528

Aus der digitalen Welt: „Find it, fix it and leave it alone”
(From the digital world: “Find it, fix it and leave it alone“)
Sonntag, M.
Osteopathische Medizin, 2023/03
529

Goniometric effects of an osteopathic technique, active stretching with specific, fixation on the mobility of the Scapular Waist
(Гониометрическая оценка применения остеопатической техники активного вытяжения со специфической точкой фиксации. Влияние на подвижность плечевого пояса)
Campillar, M. A.
Russian Osteopathic Journal, 2023/03
Free full text
530

Results of osteopathic correction according to the stabilography data in patients with lower limb amputation at the transtibial level
(Результаты остеопатической коррекции по данным стабилографии у пациентов с ампутацией нижних конечностей на уровне голени)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2023/03
Free full text
531

Pathogenetic prerequisites for the use of osteopathic correction in chronic tonsillitis
(Патогенетические предпосылки применения остеопатической коррекции при хроническом тонзиллите)
Vedyashkina, A. S., Potekhina, Y. P., Mokhov, D. E.
Russian Osteopathic Journal, 2023/03
Free full text
532

Kann mittels Osteopathie der Hormonstatus von infertilen Frauen mit Polyzystischem-Ovarial-Syndrom (PCOS) beeinflusst werden?
(Is it possible to influence the hormone levels of infertile women with polycystic ovarian syndrome (PCOS) by osteopathic treatments?)
Hartl, V.
Unpublished MSc thesis, 2023/03
533

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03
534

Inter-rater reliability between osteopaths of differing clinical experience on sagittal plane running gait analysis: A pilot study
Tripodi, N., Dagiandis, T., Hameed, A., Heilberg, L., Olbinski, E., Reid, C., White, A., McLaughlin, P.
International Journal of Osteopathic Medicine, 2023/03
535

Der liegende Gehtest – eine Interrater-Reliabilitätsstudie
(The supine walking test – an inter-rater reliability study)
Sendlhofer, J.
Unpublished MSc thesis, 2023/03
536

Efectividad del tratamiento osteopático manipulativo y fascial en el postoperatorio de cirugía de injerto de derivación de arteria coronaria
(Effectiveness of osteopathic manipulative and fascial treatment in the postoperative period of coronary artery bypass graft surgery)
Bruni, E.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
537

Eficacia de las técnicas osteopáticas en el dolor de rodilla
(Effectiveness of osteopathic techniques in knee pain)
González Ruiz, P. M., Laguna Aranda, A. M., Aranda Guirado, L.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
538

Efecto de la osteopatía en la enfermedad por reflujo gastroesofágico
(Effect of osteopathy on gastroesophageal reflux disease)
Martín Ruiz, M.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
539

Physical and Simulated Tensegrity Models of the Skull Bones and Fascia using CT Bone-Shape Data
Looman, J., Venne, G., Blostein, D., Scarr, G.
Journal of Bodywork and Movement Therapies, 2023/03
540

Efectividad del tratamiento osteopático en el dolor pélvico crónico
(Effectiveness of osteopathic treatment for chronic pelvic pain)
Rivero Rodríguez, S.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text
541

Der Effekt einer Stillpunktinduktion am Sakrum auf das vegetative Nervensystem, im Vergleich zu einer Scheinbehandlung, gemessen anhand der Herzratenvariabilität (HRV)
(The Effect of a sacrum stillpoint induction on the autonomic nervous system compared to a sham treatment, as measured by heart rate variability (HRV))
Franzin, K.
Unpublished MSc thesis, 2023/03
542

Effekt einer Unwinding-Technik des zervikothorakalen Diaphragmas auf die Herzratenvariabilität (HRV) im Vergleich zu einer Scheinbehandlung
(Effect of an unwinding technique of the cervicothoracic diaphragm on the heart rate variability (HRV) compared to a sham treatment)
Gwendolyn, A.
Unpublished MSc thesis, 2023/03
543

Effektivität einer craniosacralen Behandlung bei Multiple-Sklerose-PatientInnen mit Störungen im Urogenitaltrakt im Vergleich zur physiotherapeutischen Behandlung mittels aktiver Beckenbodenübungen
(Effectiveness of a craniosacral treatment on patients with multiple sclerosis with problems of the urogenital system compared with pelvic floor training)
Karner, A.
Unpublished MSc thesis, 2023/03
544

Die Interrater Reliabilitätstestung des passiven Bewegungstests des Os coccygis in der Bauchlage
(The interrater reliability of the passive motion test from the os coccygis in prone position)
Matschek, T.
Unpublished MSc thesis, 2023/03
545

Intertester Reliabilitätsprüfung einer viszeralen Mobilitätsuntersuchung an der Nierenzone
(Examination of the Intertester Reliability of a passive visceral mobility palpation on the left kidney area)
Wasserbauer, T.
Unpublished MSc thesis, 2023/03
546

Der Einfluss einer visceralen Behandlungstechnik auf die Beweglichkeit der Halswirbelsäule
(The influence of a visceral treatment technique on the mobility of the cervical spine)
Koch, K.
Unpublished MSc thesis, 2023/03
547

Connecting the dots: alterations in bioelectric activity at acupuncture Ting (Jing-Well) points following CV4 cranial manipulation
Hendryx, J. T., Kannan, A., Prashad, J., Falk, K.
Journal of Osteopathic Medicine, 2023/03
Free full text
548

Der Einfluss der Osteopathie auf infantile nicht-synostotische Plagiozephalie
(The Influence of Osteopathy on infantile non-synostotic Plagiocephaly)
Archam, S.
Unpublished MSc thesis, 2023/03
549

Die Interrater Reliabilitätstestung des passiven Bewegungstests des Os coccygis in der Bauchlage
(The interrater reliability of the passive motion test from the os coccygis in prone position)
Matschek, T.
Unpublished MSc thesis, 2023/03
550

Die Interrater-Reliabilität der osteopathischen Untersuchung des Caecums
(The Interrater-reliability of the osteopathic examination of the cecum)
Beyer, L.
Unpublished MSc thesis, 2023/03
551

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text
552

Der liegende Gehtest – eine Interrater- Reliabilitätsstudie
(The supine walking test – an inter- rater reliability study)
Sendlhofer, J.
Unpublished MSc thesis, 2023/03
553

Weibliche Genitalverstümmelung und Osteopathie
(Female genital mutilation and osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
554

Characteristics of patients presenting at a university outpatient department for com-plementary and integrative medicine
Rotter, G., Binting, S., Teut, M., Ortiz, M., Willich, S. N., Brinkhaus, B.
Complementary Medicine Research, 2023/02
555

Pilot of an Interprofessional Functional Nutrition and Lifestyle Medicine Elective with Community Cooking Classes during Covid-19 Pandemic
Jones, G. M., Stevenson, T.
Journal of Integrative and Complementary Medicine, 2023/02
556

An Update on Medical School Accreditation in the United States: Implications for the Single Graduate Medical Education (GME) Era
Ahmed, H., Kortz, M., Carmody, J. B.
Cureus, 2023/02
Free full text
557

Perceived Value of Osteopathic Recognition
Maier, R., Weaver, J., Ginoza, J. A., Meyer, D., Gothard, D.
Family Medicine, 2023/02
Free full text
558

The Impact of Complementary and Integrative Medicine Following Traumatic Brain Injury: A Scoping Review
Kim, S., Mortera, M. H., Wen, P. S., Thompson, K. L., Lundgren, K., Reed, W. R., Sasson, N., Towner Wright, S., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
The Journal of Head Trauma Rehabilitation, 2023/02
Free full text
559

Effectiveness of osteopathic treatment in patients with Lower Urinary Tract Symptoms (LUTS)
Arora, A., Ghosh, T.
Biomedicine, 2023/02
560

Effect of compression of fourth ventricle on the respiratory capacity in the post COVID patients
Agarwal, K., Ghosh, T.
Biomedicine, 2023/02
Free full text
561

Fragen und die Existenz verschiedener Wahrheiten
(Questions and the existence of various truths)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
562

Zuverlässigkeit eines Klassifizierungssystems zur Beurteilung eines Tortikollis beim Säugling
(Reliability of a classification system for the assessment of torticollis in infants)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
563

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
564

Historical Osteopathic Principles and Practices in Contemporary Care: An Anthropological Perspective to Foster Evidence-Informed and Culturally Sensitive Patient-Centered Care. A Commentary
Zegarra-Parodi, R., Baroni, F., Lunghi, C., Dupuis, D.
Healthcare, 2023/01
Free full text
565

An exploration of the experience of osteopaths managing individuals with endometriosis
Zeigler, Z. L.
Unpublished MSc thesis, 2023/01
Free full text
566

“It's all about the story”. Osteopaths' experiences of exploring menopausal symptoms: A qualitative interview study
Gelli, N., Abbey, H.
International Journal of Osteopathic Medicine, 2023/01
567

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text
568

“We're IMGs, and we're often seen as human garbage outside of primary care“: A qualitative investigation of dynamic status hierarchy construction online by medical trainees
Franklyn, G.
Social Science & Medicine, 2023/01
569

Dynamic touch induces autonomic changes in preterm infants as measured by changes in heart rate variability
Manzotti, A., Cerritelli, F., Monzani, E., Savioli, L., Esteves, J. E., Lista, G., Lombardi, E., Rocca, S. L., Biasi, P., Galli, M., Chiera, M., McGlone, F. P.
Brain Research, 2023/01
570

Successful buprenorphine transition while overlapping with a full opioid agonist to treat chronic pain: a case report
Patel, K. V., Sahni, S., Taylor, L. F.
Journal of Osteopathic Medicine, 2023/01
Free full text
571

What are the current rehabilitative approaches to ACL recovery post reconstruction surgery that osteopaths may implement?: A scoping review
Caughey, C.
Unpublished MSc thesis, 2023/01
Free full text
572

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12
573

The intersection of the two complimentary fields of preventive cardiology and integrative cardiology: A Fellow's voice
Cheung, B.
American Journal of Preventive Cardiology, 2022/12
Free full text
574

Osteopathie als personenzentrierte und integrierende Behandlungsmethode (Teil 2)
(Osteopathy as a person-centered and integrative treatment method (Part 2))
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/12
575

Osteopathische Geriatrie. Teil 2: Behandlung - Prinzipien und Methoden
(Osteopathic geriatrics. Part 2: Treatment - Principles and methods)
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/12
576

The Role of Osteopathic Manipulative Medicine in the Rehabilitation of a Competitive Dancer after a Major Abdominal Surgery
Berenbeim, G., Figueroa, J.
The AAO Journal, 2022/12
Free full text
577

Application of infrared thermography in the study of the osteopathic correction results in patients with amputation defects of the lower extremities
(Инфракрасная термография в исследовании результатов остеопатической коррекции у пациентов с ампутационными дефектами нижних конечностей)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2022/12
578

Electron-donor and regulatory effects of superoxide anion radicals on the processes of osteogenesis and bone remodeling: literature review
(Регуляторное действие пероксидных анион-радикалов на процессы остеогенезиса и костного ремоделирования: обзор литературы)
Rakhmanin, Y. A., Fesyun, A. D., Stekhin, A. A., Yakovleva, G. V.
Russian Osteopathic Journal, 2022/12
579

Epiploic Appendagitis Mimicking Acute Appendicitis: An Osteopathic Case Report
Chin, J., Oseguera, B., Hon, K., Lomiguen, C. M., McBride, T.
Cureus, 2022/12
Free full text
580

The effect of the COVID-19 pandemic on osteopathic education in ACGME-OR residencies from February 2020 to February 2021
Bingham, S., Bray, N. N., Eddy, A. J.
Journal of Osteopathic Medicine, 2022/12
Free full text
581

The role of 3D digital applications in manual therapy education – A scoping review
Kovanur Sampath, K., Arumugam, A., Jull, G.
International Journal of Osteopathic Medicine, 2022/12
582

Evocations of Osteopathy's founder and questions for contemporary osteopathic professional identity: A thematic analysis
Skinner, D., Esber, T., Walkowski, S.
International Journal of Osteopathic Medicine, 2022/12
583

A Case Study Examining Women in Leadership at a College of Osteopathic Medicine
Kelley, S.
Unpublished Dissertation, 2022/12
584

A web-based review of global health programs in U.S. allopathic and osteopathic medical schools
Edwards, M. K., An, C., Rohrbaugh, R., Peluso, M. J., Lam, S. K.
Medical Teacher, 2022/12
585

Acupuncture and Osteopathic Medicine for Atopic Dermatitis – a Three-armed Randomized Controlled Explorative Clinical Trial
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Clinical and Experimental Dermatology, 2022/12
Free full text
586

A Peer-led Program to Increase Diversity in Osteopathic Medical Schools: Three Year Update
Hu, J., Smart, H., Garo, J. A., Rachdi, O., Fernandes Paul, M.
Journal of Osteopathic Medicine, 2022/12
587

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12
588

Student Developed Didactic Series Rooted in Osteopathic Philosophy
Newman, N., Ahmed, S., Shiffler, V., Sinitsa, I., Harold, Z., Naeem, A., Lovett, G., Nazar, A.
Journal of Osteopathic Medicine, 2022/12
589

Beliefs and Attitudes About Opioid Prescribing in Patients With Low Back Pain: A Survey of Osteopathic Physicians
Pham, B., Tzau, A., Lee, A. S., DeStefano, L. A., Popovich, J. M.
Journal of Osteopathic Medicine, 2022/12
590

A Collaborative Modeling Approach to Understand the Perspective of Patients with Low Back Pain Referred for Osteopathic Manipulative Medicine Management
Tzau, A., Popovich, J. M.
Journal of Osteopathic Medicine, 2022/12
591

Diagnosis and management of headache disorders in osteopathic practice: A qualitative study
Tripodi, N., Cordina, J., Jaffre, D., Mason, K., McMahon, G., Xeureb-Graham, B., Yanovsky, R., Wospil, R.
International Journal of Osteopathic Medicine, 2022/12
592

Optimizing chronic pain management through patient engagement with quality of life measures: a randomized controlled trial
Licciardone, J. C., McDonald, H., Yablon, M., Ngo, W., Cunanan Garza, K. A., Aryal, S.
Journal of Osteopathic Medicine, 2022/11
Free full text
593

Osteopathic Manipulative Medicine for Chronic Pain in the Setting of Cerebral Palsy
Dixon, D. S., Elwert, N. C., McDermott, G. A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/11
594

Student performance in medical biochemistry and genetics: comparing campus-based versus zoom-based lecture delivery
Faner, M. A., Ritchie, R. P., Ruger, K. M., Waarala, K. L., Wilkins, C. A.
BMC Medical Education, 2022/11
Free full text
595

Der Gesundheitsbegriff bei A. T. Still. Eine Untersuchung auf dessen Ursprung und Bedeutung
(The concept of health in A. T. Still. An investigation into its origin and meaning)
Dippon, M.
unpublished MSc thesis, 2022/11
Free full text
596

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/11
Free full text
597

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11
598

Model-Base Estimation of Non-Invasive Ventilation Weaning of Preterm Infants Exposed to Osteopathic Manipulative Treatment: A Propensity-Score-Matched Cohort Study
Tarantino, A. G., Vismara, L., Buffone, F., Bianchi, G., Bergna, A., Vanoni, M., Tabbi, C., Bresesti, I., Agosti, M.
Healthcare, 2022/11
Free full text
599

The Profile of Belgian Osteopaths: A Cross-Sectional Survey
van Dun, P. L. S., Verbeeck, J., Arcuri, L., Esteves, J. E., Cerritelli, F.
Healthcare, 2022/10
Free full text
600

At-home ECG monitoring with a real-time outpatient cardiac telemetry system during the COVID-19 pandemic
Jaramillo, N., Malkov, D., Nikakis, J., Arora, U. S., Cohen, T. J.
Journal of Osteopathic Medicine, 2022/10
Free full text
601

Release of Cervical Muscle Tension Improves Psychological Stress and Symptoms of Moderate-to-Severe Atopic Dermatitis: a Case Series with 20 Patients
Hosono, S., Fujita, K., Nimura, A., Akita, K.
Dermatology and Therapy, 2022/10
Free full text
602

Effect of Visceral Mobilization on Abdomino-Phrenic Dyssynergia in Irritable Bowel Syndrome Patients
Hammam, E. E. E.D., Sayed, A. A., Abdelkader, F., El-Moatasem, A. M.
The Egyptian Journal of Hospital Medicine, 2022/10
Free full text
603

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
604

Die Rolle der Osteopathie im Geburtsprozess – eine qualitative Studie
(The role of osteopathy in the birth process - a qualitative study)
Janisz, M., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
605

Effectiveness of Mulligan's Two-Leg Rotation Versus Muscle Energy Technique in Subjects With Hamstring Tightness
Jaiswal, P. R., Qureshi, I., Phansopkar, P. A.
Cureus, 2022/09
Free full text
606

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie – Teil 2
(Positional plagiocephaly: The role of brainstem sensitization in the pathophysiology of positional plagiocephaly - Part 2)
Zweedijk, R.
Osteopathische Medizin, 2022/09
607

A Thematic Analysis of Osteopathic Physicians' Identities and Experiences in North American Professional Sports
Blacha, K., Cade, A., Russell, T., Skinner, D.
Open Access Journal of Sports Medicine, 2022/09
Free full text
608

Andrew Taylor Still lebt: Ent-wicklungslinien der osteopathischen Forschung und Lehre
(Andrew Taylor Still is alive: Lines of development of osteopathic research and teaching)
Levin, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
609

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text
610

Effectiveness of routine physical therapy with and without muscle energy technique in patients with upper crossed syndrome
Shahzad, H., Fatima, A., Ahmad, A., Khan, Z. A., Gilani, S. A.
Rawal Medical Journal, 2022/09
Free full text
611

Modern approaches to osteopathic diagnostics, its theoretical and practical foundations
(Современные подходы к остеопатической диагностике, её теоретические и практические основы)
Mokhov, D. E., Potekhina, Y. P., Gurichev, A. A.
Russian Osteopathic Journal, 2022/09
612

The impact of osteopathic correction on the life quality of pregnant women
(Влияние остеопатической коррекции на качество жизни беременных)
Nenashkina, E. N.
Russian Osteopathic Journal, 2022/09
613

Substantiation of the economic efficiency of the author′s manual repositioning method of the shoulder joint
(Обоснование экономической эффективности авторской мануальной методики вправления вывиха плеча)
Slabospitskii, M. A., Mokhov, D. E., Limarev, V. V., Tkachenko, P. V., Tkachenko, A. N., Mansurov, D. S., Khaydarov, V. M.
Russian Osteopathic Journal, 2022/09
614

The effectiveness of a multimodal approach in the treatment of patients with upper crossed syndrome: A randomized controlled trial
Aneis, Y. M., El-Badrawy, N. M., El-Ganainy, A.E. A., Atta, H. K.
Journal of Bodywork and Movement Therapies, 2022/09
615

The Portuguese osteopaths attitudes towards a biomechanical or biopsychosocial model in the approach of chronic low back pain – A cross-sectional questionnaire-based survey
Dinis, M., Silva, C., Cruz, R., Esteves, J., Nunes, A.
International Journal of Osteopathic Medicine, 2022/09
616

Osteopathic Medical Students’ Subjective Preparedness for LGBTQ+ Patient Care and Influencing Factors: A Multi-Institutional Survey Study
Morimoto, K., Uy, J. C., Blair, L., Barab, H., Wu, W., Oosterbaan, C., Ozdowski, L., Guenther, E.
The AAO Journal, 2022/09
Free full text
617

The Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ) - A content validity study
Thomson, O. P., Vaughan, B., Sampath, K., Draper-Rodi, J., Fleischmann, M., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/09
618

Interaktion zwischen Gehirn und Herz: Modifikation der Interaktion zwischen Gehirn und Herz bei chronischen Schmerzen durch osteopathische Behandlung
(Interaction between brain and heart: modification of brain-heart interaction in chronic pain by osteopathic treatment)
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Osteopathische Medizin, 2022/09
619

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09
620

Osteopathie als personenzentrierte und integrierende Behandlungsmethode – Teil 1
(Osteopathy as a person-centered and integrative treatment method - Part 1)
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/09
621

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09
622

Osteopathische Geriatrie: Teil 1: Grundlagen, Ziele
Osteopathic geriatrics - Part 1: Basics, goals
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/09
623

Osteopathische Medizin – Wo bleibt der Beweis?
(Osteopathic medicine - Where is the evidence?)
Schleusener, R.
Osteopathische Medizin, 2022/09
624

Effectiveness of instrument assisted soft tissue mobilization (IASTM) and muscle energy technique (MET) on post-operative elbow stiffness: a randomized clinical trial
Bhosale, P., Kolke Pt, S.
Journal of Manual & Manipulative Therapy, 2022/09
625

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text
626

Exploring lumbo-pelvic functional behaviour patterns during osteopathic motion tests: A biomechanical (en)active inference approach to movement analysis
Ménard, M., Couvertier, M., Awai, L., Esteves, J. E., Bideau, B., Vaucher, P.
International Journal of Osteopathic Medicine, 2022/09
627

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text
628

Student Attitudes About Osteopathic Medical Schools: Increasing Student Willingness to Apply
Mattiace, S. M.
Unpublished Dissertation, 2022/08
Free full text
629

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text
630

“What you feel under your hands“: exploring professionals' perspective of somatic dysfunction in osteopathic clinical practice-a qualitative study
Arcuri, L., Consorti, G., Tramontano, M., Petracca, M., Esteves, J. E., Lunghi, C.
Chiropractic & Manual Therapies, 2022/08
Free full text
631

Thoracic Manual Therapy Improves Pain and Disability in Individuals With Shoulder Impingement Syndrome Compared With Placebo: A Randomized Controlled Trial With 1-Year Follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/08
632

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text
633

Effectiveness of Osteopathic Treatment on the Spinal Column as Measured by the Spinal Mouse®: A Case Series
Colati, R., Pagano, A.
Cureus, 2022/08
Free full text
634

Thoracic manual therapy improves pain and disability in individuals with shoulder impingement syndrome compared to placebo: a randomised controlled trial with one year follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/08
635

Efficacy of Single Stretching Session of Iliopsoas Using Proprioceptive Neuromuscular Facilitation Versus Muscle Energy Technique on Low Back Pain in Patients With Lumbar Hyper-Lordosis
Lakkadsha, T. M., Qureshi, M. I., Kovela, R. K., Saifee, S. S., Lalwani, S. S.
Cureus, 2022/08
Free full text
636

The association between operating margin and surgical diversity at Critical Access Hospitals
Hopper, W., Zeller, R., Burke, R., Lindsey, T.
Journal of Osteopathic Medicine, 2022/07
Free full text
637

Interventions non-pharmacologiques et syndrome de l’intestin irritable: revue de la littérature et méthodologie des essais thérapeutiques pour l’évaluation de l’efficacité de l’ostéopathie
(Nonpharmacological interventions and irritable bowel syndrome: review of the literature and methodology of therapeutic trials for the evaluation of the effectiveness of osteopathy)
Amsallem, F.
Unpublished PhD thesis, 2022/07
Free full text
638

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07
639

Grisel-Syndrom bei einem Vorschulkind
(Grisel's syndrome in a preschool child)
Boltz, A.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
640

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07
641

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07
642

Cervical cancer screening among women with comorbidities: a cross-sectional examination of disparities from the behavioral risk factor surveillance system
Austin, J., Delgado, P., Gatewood, A., Enmeier, M., Frantz, B., Greiner, B., Hartwell, M.
Journal of Osteopathic Medicine, 2022/07
Free full text
643

Im Gespräch mit … Christian Hartmann
(In dialog with ... Christian Hartmann)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
644

Die Osteopathie aus Sicht der ärztlichen Osteopathen – eine qualitative Interviewstudie
(Osteopathy from the point of view of medical osteopaths - a qualitative interview study)
Waubert de Puiseau, A., Belz, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
645

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie –Teil 1
(Positional plagiocephaly: the role of brainstem sensitization in the pathophysiology of positional plagiocephaly -Part 1)
Zweedijk, R.
Osteopathische Medizin, 2022/06
646

Pediatric unilateral knee swelling: a case report of a complicated differential diagnosis and often overlooked cause
Guardado, K. E., Sergent, S.
Journal of Osteopathic Medicine, 2022/06
Free full text
647

Liebe Leser*innen
(Dear readers)
Kramme, P.
Osteopathische Medizin, 2022/06
648

Chronic cough as seen by allergy specialists: An internet survey of providers in a large nation-wide practice
Prenner, Bruce M., Topp, Robert, McCan, William A.
Allergy and Asthma Proceedings, 2022/06
649

The use of osteopathic correction in the complex rehabilitation of patients with acute cerebrovascular accident
(Применение остеопатической коррекции в комплексной реабилитации пациентов с острым нарушением мозгового кровообращения)
Belash, V. O., Gritsay, E. O., Musina, T. S.
Russian Osteopathic Journal, 2022/06
650

A Holistic Approach to Physical and Mental Health: Associations Between Chronic Disease and Psychiatric Conditions
Patel, P., Mancuso, A.
Psychology Health & Medicine, 2022/06
651

Comparison of the osteopathic status of children in the first six months of life with regurgitation with functional disorders of the digestive system or perinatal damage of the nervous system
(Сравнение остеопатического статуса детей первого полугодия жизни со срыгиваниями на фоне функциональных расстройств органов пищеварения или перинатального поражения нервной системы)
Eremina, E. A., Serdyukova, T. B., Kuzmina, Y. O.
Russian Osteopathic Journal, 2022/06
652

Osteopathy and physiotherapy compared to physiotherapy alone on fatigue in long COVID: Study protocol for a pragmatic randomized controlled superiority trial
Certain Curi, A. C., Antunes Ferreira, A. P., Calazans Nogueira, L. A., Mello Meziat Filho, N. A., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2022/06
Free full text
653

David S. Festinger (1962-2021)
Dugosh, J. W., Dugosh, K. L., Lent, M. R.
American Psychologist, 2022/06
654

A Proposal for the Use of Craniosacral Therapy in Firefighter Cadets to Decrease Cortisol Levels and Improve Postural Stability—A Randomized Trial
Wójcik, M., Siatkowski, I., Żekanowska, E.
Journal of Men's Health, 2022/06
Free full text
655

Osteopathy — a new direction of medicine (modern concept of Osteopathy
(Остеопатия — новое направление медицины (современная концепция остеопатии)
Mokhov, D. E., Potekhina, Y. P., Tregubova, E. S., Gurichev, A. A.
Russian Osteopathic Journal, 2022/06
656

An Enactive-Ecological Model to Guide Patient-Centered Osteopathic Care
Cerritelli, F., Esteves, J. E.
Healthcare, 2022/06
Free full text
657

The influence of cultural philosophies on clinical practice of spinal manipulation: A comparison in Chinese manipulative therapy versus New Zealand osteopathy for the treatment of musculoskeletal disorders
Zhao, Y.
Unpublished MSc thesis, 2022/06
658

Anthony G. Chila – ein sehr persönlicher Nachruf auf einen außergewöhnlichen Lehrer
Anthony G. Chila - a very personal obituary of an extraordinary teacher
Buekens, J.
Osteopathische Medizin, 2022/06
659

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text
660

Deutschsprachige Osteopathieliteratur: Eine Übersicht von der Entdeckung der Osteopathie bis zum Jahr 2000
(German-language osteopathic literature: a survey from the discovery of osteopathy to the year 2000)
Engel, M.
Osteopathische Medizin, 2022/06
661

Durch dissipative Strukturierung zu Kohärenzgefühl und Gesundsein?
(Through dissipative structuring to a sense of coherence and being healthy?)
Pelz, H.
Osteopathische Medizin, 2022/06
662

Die vier vegetativen Nervensysteme
(The four autonomic nervous systems)
Plathner, M.
Osteopathische Medizin, 2022/06
663

Effect of post-isometric relaxation versus myofascial release therapy on pain, functional disability, rom and qol in the management of non-specific neck pain: a randomized controlled trial
Khan, Z. K., Ahmed, S. I., Baig, A. A. M., Farooqui, W. A.
BMC Musculoskeletal Disorders, 2022/06
Free full text
664

4 M's to make sense of evidence – Avoiding the propagation of mistakes, misinterpretation, misrepresentation and misinformation
Draper-Rodi, J., Vaucher, P., Hohenschurz-Schmidt, D., Morin, C., Thomson, O. P.
International Journal of Osteopathic Medicine, 2022/06
665

The Successful Use of Osteopathic Manipulative Treatment (OMT) for Positional Plagiocephaly: Now He's an Ambi-turner!
Harris, Z., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
666

Does the inter-osseous membrane fascial dysfunction exist ? An observational study comparing palpation to ultrasound measurements
Lecardonnel, T., Salmon, M., Merdy, O., Sarzeaud, R., Matthew, T.
International Journal of Osteopathic Medicine, 2022/06
667

Abnormal Foot Progression Angle Kinematics in Cervical Dystonia Improved After Osteopathic Manipulative Medicine: A Prospective Case Series
Mancini, J., Oliff, Z., Abu-Sbaih, R., Simone, J., LaRosa, A., Mody, S., Li, T. S., Leder, A.
Cureus, 2022/06
Free full text
668

Factors affecting utilization of CT scan following ultrasound evaluation of suspected appendicitis
Zisman, A., Novi, B., Gaughan, J., Carr, L.
Journal of Osteopathic Medicine, 2022/06
Free full text
669

Professional identity in osteopathy: A scoping review of peer-reviewed primary osteopathic research
Phillips, A. R.
International Journal of Osteopathic Medicine, 2022/06
Free full text
670

Relevance of historical osteopathic principles and practices in contemporary care: Another perspective from traditional/complementary and alternative medicine
Vogel, S., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2022/06
Free full text
671

A study of consumer expectations and requirements for the quality of osteopathic services in parents of minor patients
(Исследование потребительских ожиданий и требований к качеству услуг по остеопатии у родителей несовершеннолетних пациентов)
Vinitskaya, T. V.
Russian Osteopathic Journal, 2022/06
672

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
673

SCIWORA: A Pediatric Case
Masterson, C., Byrd, A., Gebhardt, G.
The AAO Journal, 2022/06
Free full text
674

The Effects of a Novel Virtual Reality Osteopathic Manipulative Medicine Program on First Year Practical Exam Scores
Ahmed, E., Jose, J., Stout, R., Yao, S. C.
The AAO Journal, 2022/06
Free full text
675

Sacroiliac joint dysfunction: hypomobility and hypermobility
Bordoni, B.
Journal of Osteopathic Medicine, 2022/06
Free full text
676

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
677

Native American Student Perspectives on Culturally Integrated Education at a Tribal College of Osteopathic Medicine
Gatewood, A., Terry, R., Bray, N., Hartwell, M.
The AAO Journal, 2022/06
Free full text
678

A Guide for Transitioning Osteopathic Research from Medical School to Residency to Increase Research Productivity across Medical Training
Gober, C., Daly, E., Heinking, K. P.
The AAO Journal, 2022/06
Free full text
679

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
680

Osteopathic Manipulative Treatment may be a Cost-Effective Approach to Reducing Pain Associated with Acute Flare of Interstitial Cystitis
Hermann, S. J., Barnett, M. E., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
681

Managing Muscle Rigidity: An Osteopathic Approach to the Treatment of Stiff Person Syndrome
Mainville, M., Cameron, D. L., Barry, P.
The AAO Journal, 2022/06
Free full text
682

An Osteopathic Approach to Childhood Scoliosis and Leg Length Inequality in a Pediatric Patient with Chiari I Malformation
Schultz, R., Baig, Y., Henderson, K. K., Heinking, K. P.
The AAO Journal, 2022/06
Free full text
683

Effects of Muscle Energy Technique versus Bruegger's Relief Exercise on the Forward Head Posture among electronic gadget users - A Pilot study
Dalawar, A., Afzal, H., Dalawar, I., Murtaza, A., Ghafoor, A., Fiaz, S.
Pakistan Journal of Medical and Health Sciences, 2022/05
Free full text
684

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text
685

Cross-Sectional Study of Osteopathic General Surgeons in University-Based General Surgery Departments
Khan, M. T., Patnaik, R., Wheeler, C., Ibrahim, M., Wolf, H., Baumgardner, K. C., Lovely, R. S.
Cureus, 2022/05
Free full text
686

Advocacy for Change: An Osteopathic Review of Traumatic Brain Injury Among Combat Veterans
Pendlebury, G. A., Oro, P., Haynes, W., Byrnes, T. R., Keane, J., Goldstein, L.
Cureus, 2022/05
Free full text
687

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text
688

Muscle Energy Technique plus Neurac Method in Stroke Patients with Hemiplegia Complicated by Diabetes Mellitus and Assessment of Quality of Life
Wang, J., Wang, S., Wu, H., Dong, S., Zhang, B.
Disease Markers, 2022/05
Free full text
689

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05
690

Upgrade rate of percutaneously diagnosed pure flat epithelial atypia: systematic review and meta-analysis of 1,924 lesions
Ferre, R., Kuzmiak, C. M.
Journal of Osteopathic Medicine, 2022/05
Free full text
691

Parental leave in medical school: supporting students as parents
Ortega, S. R., Barnes, J. M., Waller, J. D.
Journal of Osteopathic Medicine, 2022/05
Free full text
692

Interrater Reliabilität des 3 Phasen Tests
(Interrater reliability of the 3 phases test)
Grömer, M.
Unpublished MSc thesis, 2022/05
693

Die Interrater-Reliabilität der Routineuntersuchung cranialer Dysfunktionen der vier Schädelzonen
(The Interrater-Reliability of the routine examination of cranial dysfunctions based on four skull zones)
Götz, T.
Unpublished MSc thesis, 2022/05
Free full text
694

Sensibilisierung von Osteopath:innen in der Deutschschweiz gegenüber dem Thema Transidentität vor und nach der Lektüre eines Informationsblatts : qualitative Studie
(Sensitization of osteopaths in German-speaking Switzerland to the topic of trans identity before and after reading an information sheet : qualitative study)
Noser, M., Odermatt, C.
Unpublished MSc thesis, 2022/04
Free full text
695

An updated brief overview on post-traumatic headache and a systematic review of the non-pharmacological interventions for its management
Argyriou, A. A., Mitsikostas, D. D., Mantovani, E., Litsardopoulos, P., Panagiotopoulos, V., Tamburin, S.
Expert Review of Neurotherapeutics, 2022/04
Free full text
696

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text
697

Manual Therapy Intervention in Men With Chronic Pelvic Pain Syndrome or Chronic Prostatitis: An Exploratory Prospective Case-Series
Rabal Conesa, C., Cao Avellaneda, E., López Cubillana, P., Prieto Merino, D., Khalus Plish, A., Martínez Franco, A., López Abad, A.
Cureus, 2022/04
Free full text
698

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text
699

Osteopathic management of dysmenorrhea: A qualitative snapshot of New Zealand women’s experiences
Leys, A. E.
Unpublished MSc thesis, 2022/04
Free full text
700

Having Heart: Affective and Cognitive Empathy Scores vs. Residency Specialty Match at an Osteopathic Medical School
Newton, B. W.
Medical Science Educator, 2022/04
701

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text
702

Improving practice patterns in patients with newly diagnosed bladder masses treated with transurethral resection
Wilson, J., Drach, D., Zanghi, J., Siegert, J.
Journal of Osteopathic Medicine, 2022/04
Free full text
703

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) residency curriculum guidelines to meet Accreditation Council for Graduate Medical Education (ACGME) milestones
Balyakina, E. S., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2022/04
Free full text
704

Clinical evaluation and management of calcific tendinopathy: an evidence-based review
Catapano, M., Robinson, D. M., Schowalter, S., McInnis, K. C.
Journal of Osteopathic Medicine, 2022/04
Free full text
705

A Content Analysis of Osteopaths' Attitudes for a More Inclusive Clinical Practice towards Transgender People
Baldin, I., Esteves, J. E., Tramontano, M., Macdonald, M., Baroni, F., Lunghi, C.
Healthcare, 2022/03
Free full text
706

Osteopathie bei Atopischer Dermatitis - eine randomisiert kontrollierte monozentrische explorative Studie
(Osteopathy in Atopic Dermatitis - a randomised controlled monocentric exploratory trial)
Ahnert, M. W.
Unpublished PhD thesis, 2022/03
Free full text
707

The effectiveness of rehabilitation of patients after covid pneumonia with osteopathic methods
(Эффективность реабилитации пациентов после перенесенной ковид-пневмонии методами остеопатии)
Belyaev, A. F., Fotina, O. N., Kharkovskaya, T. S., Yurchenko, A. A.
Russian Osteopathic Journal, 2022/03
Free full text
708

Instrumental methods and technical means for assessing the results of osteopathic correction in patients after lower limb amputation
(Инструментальные методы и технические средства для оценки результатов остеопатической коррекции у пациентов после ампутации нижних конечностей)
Kolyshnitsyn, N. Y., Mokhov, D. E.
Russian Osteopathic Journal, 2022/03
Free full text
709

Age-related and sexual features of the mobility of the temporomandibular joints
(Возрастные и половые особенности подвижности височно-нижнечелюстных суставов)
Kryukov, E. R., Potekhina, Y. P., Vdovina, L. V., Kournikova, A. A.
Russian Osteopathic Journal, 2022/03
Free full text
710

Study of the combined use of osteopathic correction and EEG-biofeedback training in children with attention deficit hyperactivity disorder
(Исследование сочетанного применения остеопатической коррекции и ЭЭГ-БОС-тренингов у детей с синдромом дефицита внимания и гиперактивности)
Kudryashova, V. G., Chetverikova, N. A.
Russian Osteopathic Journal, 2022/03
Free full text
711

Effectiveness of manual therapy in the treatment of cervicogenic headache: A systematic review
Núñez-Cabaleiro, P., Leirós-Rodríguez, R.
Headache, 2022/03
Free full text
712

Features of active and passive joints mobility of skiers and skaters athletes
(Особенности активной и пассивной подвижности суставов у спортсменов лыжников и конькобежцев)
Mironova, A. D., Potekhina, Y. P., Kurnikova, A. A.
Russian Osteopathic Journal, 2022/03
Free full text
713

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text
714

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text
715

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
716

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text
717

Efficacy and Feasibility of an Osteopathic Intervention for Neurocognitive and Behavioral Symptoms Usually Associated With Fetal Alcohol Spectrum Disorder
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., García-Algar, Ó.
Frontiers in Behavioral Neuroscience, 2022/03
Free full text
718

A Concordance Study of COMLEX-USA and USMLE Scores
Barnum, S., Craig, B., Wang, X., Sandella, J., Tsai, T.H., Boulet, J., Wang, Y.
Journal of Graduate Medical Education, 2022/03
Free full text
719

Results of osteopathic correction in children and adolescents with undifferentiated connective tissue dysplasia
(Результаты остеопатической коррекции у детей и подростков с недифференцированной дисплазией соединительной ткани)
Valiev, K. R., Vildanov, I. K., Zyatdinov, R. R., Gainullin, I. R.
Russian Osteopathic Journal, 2022/03
Free full text
720

In bestimmter Weise auf jemanden wirken …
(To affect someone in a certain way...)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
721

Rechtliches rund um die osteopathische Praxis – Praxisnachfolge
(Legal issues concerning osteopathic practice ... practice succession)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
722

Weibliche Anatomie: Die Harnblase
Female Anatomy: The Urinary Bladder
Bazin, O., Naudin, M.
Osteopathische Medizin, 2022/03
723

Osteopathische Diagnostik und Behandlung funktioneller Gallenblasendyskinesien: Eine qualitative Interviewstudie
(Osteopathic diagnosis and treatment of functional gallbladder dyskinesia: A qualitative interview study)
Roth, P., Belz, S.
Osteopathische Medizin, 2022/03
724

Interrater-Reliabilitätsstudie des allgemeinen osteopathischen Diaphragma-Schnelltests kranial der Symphysis pubica hinsichtlich Bewegung bei tiefer und tiefer abdominaler Inspiration
(Interrater reliability study of the general osteopathic diaphragm rapid test cranial to the symphysis pubica regarding movement during deep and deep abdominal inspiration)
Gärber, A.
Unpublished MSc thesis, 2022/03
725

The AOA/ACGME Single Accreditation System and Its Immediate and Future Impact on Family Medicine
Fugazzi, L., Cummings, M.
Family Medicine, 2022/02
Free full text
726

Alimentación y osteopatía: el papel de la alimentación en el funcionamiento del sistema fascial. Revisión sistemática
(Diet and Osteopathy: The role of diet in the functioning of fascial system. Systematic Review)
Mora Mora, S. N.
Unpublished MSc thesis, 2022/02
Free full text
727

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text
728

The rationale for including osteopathic manipulative treatment in the management of infections: a hermeneutic review
Lesho, E., McKeown, A., Laguio-Vila, M.
Expert Review of Anti-Infective Therapy, 2022/01
Free full text
729

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text
730

Effects of Adding Respiratory Training to Osteopathic Manipulative Treatment on Exhaled Nitric Oxide Level and Cardiopulmonary Function in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
The American Journal of Cardiology, 2022/01
731

Inhibiting the Musculoskeletal Pathological Processes in Post-knee Replacement Surgery With Osteopathic Manipulative Treatment: A Systematic Review
Zhou, Y., Chin, J., Evangelista, A., Podger, B., Wan, P. J., Lomiguen, C. M.
Cureus, 2022/01
732

A novel movement system screen for primary care providers: a multisite, observational study
Kettle, C., McKay, L., Cianciolo, A. M., Kareha, S. M., Ruggeri, C. E.
Journal of Osteopathic Medicine, 2022/01
Free full text
733

Teilleistungsstörung bei visueller Wahrnehmungsstörung
(Partial performance disorder in visual perception disorder)
Engemann, K., Preiss-Leger, B.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
734

Significant cognitive impairment likely associated with COVID-19 infection with relatively nonsevere symptoms
Reeves, R. R., Willoughby, S. G.
Journal of Osteopathic Medicine, 2022/01
Free full text
735

Comparing the effects of muscle energy technique and mulligan mobilization with movements on pain, range of motion, and disability in adhesive capsulitis
Razzaq, A., Nadeem, R. D., Akhtar, M., Ghazanfar, M., Aslam, N., Nawaz, S.
Journal of the Pakistan Medical Association, 2022/01
Free full text
736

Comparison of the Effect of Muscle Energy Techniques and Stretching Exercises on Pain and Psychosocial Dysfunction Levels in Individuals With Low Back Pain
Cha, B., Kim, S.
Physical Therapy Korea, 2022/01
Free full text
737

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05
738

Letter to the editor, re: « Biomedical origins of the term ’osteopathic lesion’ and its impact on people in pain »
Aubin, A.
International Journal of Osteopathic Medicine, 2021/12
739

Erratum to “The legacy and implications of the body-mind-spirit osteopathic tenet: A discussion paper evaluating its clinical relevance in contemporary osteopathic care” [Int J Osteopath Med 41 (2021) 57–65]
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/12
Free full text
740

Die Lungen als Hohlorgan zwischen Luftbewegung und Gasaustausch: Ist eine osteopathische Behandlung des Lungengewebes möglich?
(The lungs as hollow organ between air movement and gas exchange: Is an osteopathic treatment of lung tissue possible?)
Levin, P.
Osteopathische Medizin, 2021/12
741

Vagusaktivierung und Stressreaktion aus Sicht der Osteopathie
(Vagus activation and stress reactions from the point of view of osteopathy)
Liem, T.
Osteopathische Medizin, 2021/12
742

Wissenschaft und Forschung in der Osteopathie: Teil 2: Forschung in der Osteopathie
(Science and research in osteopathy - Part 2: Research in osteopathy)
Stecker, D., Scheuchl, F.
Osteopathische Medizin, 2021/12
743

Combined use of osteopathic correction and transcranial micropolarization of the brain in the treatment of children with attention deficit hyperactivity disorder
(Сочетанное применение остеопатической коррекции и транскраниальной микрополяризации головного мозга в лечении детей с синдромом дефицита внимания и гиперактивностью)
Belash, V. O., Bayer, D. V., Kostousov, V. V.
Russian Osteopathic Journal, 2021/12
744

Osteopathic status in patients with new coronavirus infection COVID-19
(Остеопатический статус пациентов с новой коронавирусной инфекцией COVID-19)
Belash, V. O., Lisenkova, N. A.
Russian Osteopathic Journal, 2021/12
745

The effect of osteopathic correction on the function of external respiration in patients after COVID-19 coronavirus pneumonia
(Влияние остеопатической коррекции на функцию внешнего дыхания у пациентов, перенесших коронавирусную пневмонию COVID -19)
Belyaev, A. F., Kharkovskaya, T. S., Fotina, O. N., Yurchenko, A. A.
Russian Osteopathic Journal, 2021/12
746

Physical parameters of neutrality in the work of an osteopathic physician
(Физические параметры нейтральности в работе врача-остеопата)
Gurichev, A. A.
Russian Osteopathic Journal, 2021/12
747

Prevalence of endocrine pathology in childhood and adolescence
(Распространенность эндокринной патологии в детском и подростковом возрасте)
Nenashkina, E. N.
Russian Osteopathic Journal, 2021/12
748

Spontaneous changes of skull morphology in premature babies: A preliminary study using plagiocephalometric analysis
(Естественная морфометрическая эволюция черепа у недоношенных младенцев: предварительное исследование с использованием плагиоцефалометрического анализа)
Wellens, S., Maroye, L., Segers, N., Dugailly, P.M.
Russian Osteopathic Journal, 2021/12
749

Perceptions of COVID-19 vaccines among osteopathic medical students (OMS)
Al Janabi, T., Chinsky, R., Pino, M. A.
International Journal of Osteopathic Medicine, 2021/12
750

Osteopathic ableism: A critical disability view of traditional osteopathic theory in modern practice
MacMillan, A.
International Journal of Osteopathic Medicine, 2021/12
751

Effects of Visceral Manipulation Treatment on Women with Infertility and Adults with Low Back Pain
Parker, A.
Unpublished Dissertation, 2021/12
752

Therapeutic Effects of Lymphatic Pump Treatment on Lymphangiogenesis and Inflammatory Cytokines in Lymph Nodes of Rats with Adjuvant-Induced Arthritis
Blucher, K. M., Jain, S., Weber, D., Gober, C., Zanotti, B., Incrocci, R., Del Toro, R., Swanson-Mungerson, M., Volin, V. V.
Journal of Osteopathic Medicine, 2021/12
753

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12
754

Effect of Self-Performed Osteopathic Manipulative Treatment (suboccipital release) on Heart Rate Recovery: A Pilot Study
Loquist, D. C., Wong, T., Warner, M., Cannumay, S., Singh, G., Nazarian, D., Saukhla, N., Hovsepian, T.
Journal of Osteopathic Medicine, 2021/12
755

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text
756

A Network Meta-Analysis of Randomized Controlled Trials Directed at Treating Lateral Epicondylalgia
Price, J. W.
The AAO Journal, 2021/12
Free full text
757

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text
758

“If you don't use or understand visceral osteopathy you're not a real osteopath“: Professional identity in Australian osteopathy through the lens of a single traditional technique
Grace, S., Fleischmann, M., Vaughan, B.
Explore (NY), 2021/11
759

Construct validity and reliability of tests for sacroiliac dysfunction: standing flexion test (STFT) and sitting flexion test (SIFT)
Ribeiro, R. P., Guerrero, F. G., Camargo, E. N., Pivotto, L. R., Aimi, M. A., Loss, J. F., Candotti, C. T.
Journal of Osteopathic Medicine, 2021/11
Free full text
760

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text
761

AOA ophthalmology and otolaryngology program closures as a model to highlight challenges of maintaining GME in high need areas
Ahmed, H., Vo, K., Robbins, W.
Journal of Osteopathic Medicine, 2021/11
Free full text
762

Der Einfluss der Osteopathie auf den Schmerz und die Beweglichkeit nach einer Rotatorenmanschettenrekonstruktion
(The influence of osteopathy on pain and mobility after rotator cuff reconstruction)
Schrempf, I.
Unpublished MSc thesis, 2021/11
763

Die Auswirkungen einer allgemein osteopathischen Behandlung bei Patientinnen/Patienten mit rheumatoider Arthritis
(The effects of general osteopathic treatment on patients with rheumatoid arthritis)
Sommeregger, B. M.
Unpublished MSc thesis, 2021/11
764

An osteopathic approach to occipital neuralgia and tinnitus
Aiman, A., Skaug, J., Fleming, R. K.
Osteopathic Family Physician, 2021/11
765

Wirksamkeit osteopathischer Behandlungen von Craniomandibulärer Dysfunktion bei Tinnitus Systematsiches Review
(Efficacy of osteopathic treatments for craniomandibular dysfunction in tinnitus. A Systematic Review)
Pollak, E.
Unpublished MSc thesis, 2021/11
766

Der Einfluss von osteopathischen Behandlungen auf die Beschwerdesymptomatik bei Patienten mit CPPS als Ergänzung zur konventionellen Therapie
(The influence of osteopathic treatments on symptomatology in patients with CPPS as an addition to conventional therapy)
Nezaj, B.
Unpublished MSc thesis, 2021/11
767

Effektivität osteopathischer Behandlungen der Osteitis pubis bei männlichen Amateurfußballspielern im Vergleich zum Goldstandard
(Effectiveness of osteopathic treatments of osteitis pubis in male amateur soccer players in comparison to the gold standard)
Klima, C
Unpublished MSc thesis, 2021/11
768

Effekt sakraler Mobilisationen auf die Herzratenvariabilität bei Patienten mit einem milden bis hohen Stressempfinden. Eine randomisierte, kontrollierte Einzelblindstudie
(Effect of sacrum mobilizations on the heart rate variability in patients with a moderate to high perceived stress score. A single blind randomized controlled study)
Chaumont, Y.
Unpublished MSc thesis, 2021/11
769

As bases teóricas e práticas para o desenvolvimento da osteopatia
(The theoretical and practical foundations for the development of osteopathy)
Neves, S. C.
Unpublished PhD thesis, 2021/10
Free full text
770

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text
771

Evaluating for a correlation between osteopathic examination and ultrasonography on thoracic spine asymmetry
Chang, S., Maddox, J., Berg, E., Kim, K., Messier, S., Swanson, L., Dobrusin, R., Stein, A. B., Nakken, G. N., Noble, J., Nydam, R.
Journal of Osteopathic Medicine, 2021/10
Free full text
772

Evaluation of the clinical effectiveness of the osteopathic correction in children with chronic bronchitis in a sanatorium
(Оценка клинической эффективности остеопатической коррекции у детей с хроническим бронхитом в условиях санатория)
Belash, V. O., Khaibullina, G. A.
Russian Osteopathic Journal, 2021/10
Free full text
773

Changes in the characteristics of perception channels in the process of mastering the discipline «Osteopathy»
(Изменение характеристик каналов восприятия в процессе освоения дисциплины «Остеопатия»)
Fisenko, P. V., Potekhina, Y. P.
Russian Osteopathic Journal, 2021/10
Free full text
774

Post-intensive care syndrome (PICS) in children
(Синдром последствий интенсивной терапии (ПИТ-синдром) у детей)
Karimova, L. K., Belash, V. O.
Russian Osteopathic Journal, 2021/10
Free full text
775

Study of polysynaptic reflex excitability and somatosensory evoked potentials in patients with myofascial pain syndrome
(Изучение полисинаптической рефлекторной возбудимости и соматосенсорных вызванных потенциалов у пациентов с миофасциальным болевым синдромом)
Safiullina, A. A., Safiullina, G. I., Yakupov, R. A.
Russian Osteopathic Journal, 2021/10
Free full text
776

Experience in the use of kinesio taping for the relief of algomenorrhea in adolescent girls in a children′s rehabilitation hospital
(Опыт применения кинезиотейпирования для купирования альгоменореи у девочек-подростков в условиях детского реабилитационного стационара)
Vasilevich, S. V., Petrov, S. S.
Russian Osteopathic Journal, 2021/10
Free full text
777

Study of the effectiveness of osteopathic correction in the complex treatment of patients with operated primary open-angle glaucoma
(Исследование эффективности остеопатической коррекции в комплексном лечении больных с прооперированной первичной открытоугольной глаукомой)
Zubkov, O. V., Smirnova, E. A., Kramar, V. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2021/10
Free full text
778

Mobilität und Motilität des Magens bei PatientInnen mit Funktioneller Dyspepsie
(Gastric Mobility and Motility in patients with Functional Dyspepsia)
Meixner, K.
Unpublished MSc thesis, 2021/10
779

Osteopathy in Germany: attitudes, beliefs and handling among general practitioners - results of a nationwide cross-sectional questionnaire survey
Schmid, G. L., Kluge, J., Deutsch, T., Geier, A. K., Bleckwenn, M., Unverzagt, S., Frese, T.
BMC Family Practice, 2021/10
Free full text
780

Palpation of the Respiratory System in Osteopathic Manual Medicine: From the Trachea to the Lungs
Bordoni, B., Escher, A. R.
Cureus, 2021/09
Free full text
781

W(h)ither osteopathy: A call for reflection; a call for submissions for a special issue
Vogel, S.
International Journal of Osteopathic Medicine, 2021/09
782

Mittelohrpathologien und Mobilität des Os temporale bei Säuglingen mit Lippen-Kiefer-Gaumenspalte
(Middle ear pathologies and mobility of the os temporale in infants with cleft lip, cleft jaw and cleft palate.)
Wedenig, K., Zemann, W., Singer, G., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
783

Changing behaviour: role of theories and techniques in increasing physical activity in non-specific low back pain patients
Williamson, S. L.
Unpublished PhD thesis, 2021/09
Free full text
784

Exploring Race and Ethnicity Representational Inequities in Illinois Medical Schools
Francone, N. O., Simon, M. A., Ortega, P.
Health Equity, 2021/09
Free full text
785

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, Dr C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09
786

Digital health technologies for osteopaths and allied healthcare service providers: A scoping review
Mastronardo, C., Muddle, L. S., Grace, S., Engel, R. M., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2021/09
787

Kinematic consistency in the knee manipulation learning: A comparison between expert and beginner therapists
Wholohan, A., Roldán-Jiménez, C., Ruiz-Muñoz, M., Bennett, P., Trinidad-Fernández, M., Gonzalez-Sanchez, M., Cuesta-Vargas, A.
International Journal of Osteopathic Medicine, 2021/09
788

The legacy and implications of the body-mind-spirit osteopathic tenet: a discussion paper evaluating its clinical relevance in contemporary osteopathic care
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/09
789

Wissenschaft und Forschung in der Osteopathie: Teil 1: Der Begriff der Wissenschaft in der Osteopathie
(Science and research in osteopathy - Part 1: The concept of science in osteopathy)
Stecker, D., Scheuchl, F.
Osteopathische Medizin, 2021/09
790

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text
791

Preventing progression from chronic to widespread pain and its impact on health-related quality of life: a historical cohort study of osteopathic medical care
Licciardone, J. C.
Journal of Osteopathic Medicine, 2021/09
Free full text
792

Embracing industry sponsored research to expand osteopathic medical student research experiences
Morehouse, Z. P., Nash, R. J.
Journal of Osteopathic Medicine, 2021/09
Free full text
793

An investigation of swimming coaches’ perceptions on injuries in swimming and their self-reported actions towards injury management and prevention
Tinneny-Phillips, A.
Unpublished MSc thesis, 2021/09
Free full text
794

Gait Analysis in Anterior Cruciate Ligament Reconstruction & Controls Across Different Levels of Visual Feedback
Bennison, J. C.
Unpublished MSc thesis, 2021/09
Free full text
795

Meaning Construction for Biodynamic Osteopathy Terms in Translation Practice
Kalinina, I.
Taikomoji Kalbotyra, 2021/09
Free full text
796

Recovery of Functional Mobility with a Long-Term Nursing Facility Patient Utilizing the Fascial Distortion Model: A Case Study
Kincheloe, T., Cherry, C., Yoo, F.
The AAO Journal, 2021/09
Free full text
797

Intertester Reliabilität des costoclaviculären Manövers bei symptomatischen und asymptomatischen Erwachsenen
(Interrater Reliability for the costoclavicular maneuver in symptomatic and asymptomatic adults)
Puhr, M.
Unpublished MSc thesis, 2021/09
798

Durchführung von Listening-Tests im Rahmen der osteopathischen Routinebefundung – Eine videobasierte Beobachtungsstudie.
Intertester Reliabilität des costoclaviculären Manövers bei symptomatischen und asymptomatischen Erwachsenen
Puhr, M.
Unpublished MSc thesis, 2021/09
Free full text
799

Wertesysteme in der osteopathischen Palpation – Gespräche mit OsteopathInnen über subjektive Wertesysteme in der osteopathischen Befundung und Behandlung
(Value systems in osteopathic palpation – Interviews with osteopaths about subjective value systems in osteopathic diagnosis and treatment)
Müller, F.
Unpublished MSc thesis, 2021/09
Free full text
800

Interrater Reliabilitätstestung des Flexionstests der ersten Rippe bei symptomatischen und asymptomatischen Erwachsenen
(Interrater reliability of the flexion test for the first rib in symptomatic and asymptomatic adults)
Kondler, V.
Unpublished MSc thesis, 2021/09
801

Osteopaths’ Perspectives on Patient Adherence to Self-Management Strategies: A Qualitative Content Analysis
Tripodi, N., Krajina, T., Lea, N., Giudice, H., Eskaf, S., Ojea, M., D&rsquo, Souza, T., McLeod, G., Feehan, J.
International Journal of Osteopathic Medicine, 2021/09
802

Resident opinions of diabetes management in training: a survey
Healy, A. M., Uhrig, J. L., Shubrook, J. H., Aung, N. L., Sadhu, A. R.
Journal of Osteopathic Medicine, 2021/09
Free full text
803

Osteopatia na atenção primária à saúde: resultados parciais de uma experiência de educação permanente e alguns efeitos iniciais.
Osteopathy in primary health care: partial results of continuing education experience and some initial outcomes
Schneider, L. M., Tesser, C. D.
Ciencia & Saude Coletiva, 2021/09
Free full text
804

Osteopaths’ Perspectives on Patient Adherence to Self-Management Strategies: A Qualitative Content Analysis
Tripodi, N., Krajina, T., Lea, N., Giudice, H., Eskaf, S., Ojea, M., D&rsquo, Souza, T., McLeod, G., Feehan, J.
International Journal of Osteopathic Medicine, 2021/09
805

Practicing Medicine in Underserved Areas: Differences that Make a Difference in Vocational Anticipatory Socialization
Walker, T. M.
Unpublished PhD thesis, 2021/08
Free full text
806

Single Accreditation Does Not Mean Double Jeopardy for Osteopathic Medical Students
Gimpel, J. R.
Academic Medicine, 2021/08
Free full text
807

An investigation of osteopaths’ attitudes and self-reported practices towards psychosocial content in sports-injury rehabilitation
Ferguson, S.
Unpublished MSc thesis, 2021/08
Free full text
808

Comparing the effect of thrust manipulation and muscle energy technique on pain and disability in patients with sacroiliac joint dysfunction
Fatima, I., Goyal, M., Singh, G.
Physiotherapy Quarterly, 2021/08
Free full text
809

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text
810

White Coat Remediation: Understanding Medical Students’ Academic Remediation Experiences
Daly, L. E.
Unpublished PhD thesis, 2021/08
Free full text
811

Reconsidering the Role of Synchronous Feedback in Learning Diagnostic Skills: Identifying the Impact of the Instructor
Jarman, S.
Unpublished MSc thesis, 2021/07
Free full text
812

Osteopathie bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom
(Osteopathy for chronic prostatitis/chronic pelvic pain syndrome)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
813

Nachruf auf James Jealous
(James Jealous obituary)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
814

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07
815

Muscle Energy Technique in the Rehabilitative Treatment for Acute and Chronic Non-Specific Neck Pain: A Systematic Review
Sbardella, S., La Russa, C., Bernetti, A., Mangone, M., Guarnera, A., Pezzi, L., Paoloni, M., Agostini, F., Santilli, V., Saggini, R., Paolucci, T.
Healthcare, 2021/07
Free full text
816

Possibility of osteopathic correction in the complex therapy of patients with Parkinson′s disease
(Возможность применения остеопатической коррекции в комплексной терапии пациентов с болезнью Паркинсона)
Belash, V. O., Batenina, A. M., Machulina, A. I.
Russian Osteopathic Journal, 2021/07
Free full text
817

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text
818

Assessment of the quality of life of respondents working on a rotational basis in the Far North (on the example of the Khanty-Mansiysk Autonomous Okrug — Ugra
(Оценка качества жизни респондентов, работающих вахтовым методом в условиях Крайнего Севера (на примере Ханты-Мансийского автономного округа — Югра)
Ivanova, E. G., Makarova, E. V.
Russian Osteopathic Journal, 2021/07
Free full text
819

Possibility of osteopathic correction inclusion in the complex treatment of anal incontinence in teenagers
(Возможность включения остеопатической коррекции в комплексное лечение недостаточности анального сфинктера у подростков)
Kovalchuk, T. S., Enaleev, R. R., Kuzmina, Y. O.
Russian Osteopathic Journal, 2021/07
Free full text
820

Study of the peculiarities of the osteopathic status in patients with planovalgus deformity of the feet in combination with a history of placement torticollis and without such a combination
(Исследование особенностей остеопатического статуса у пациентов с плосковальгусной деформацией стоп в сочетании с установочной кривошеей в анамнезе и без такого сочетания)
Mukhammadieva, Y. R., Alshina, A. N., Gainetdinov, I. I., Safin, R. F.
Russian Osteopathic Journal, 2021/07
Free full text
821

Possibility of using of osteopathic methods of correction in the therapy of symphysiopathy in pregnant women
(Возможность применения остеопатических методов коррекции в терапии симфизиопатии у беременных)
Nenashkina, E. N., Belash, V. O.
Russian Osteopathic Journal, 2021/07
Free full text
822

Quantative assessment of the position of the sacrum in young, elderly and senile patients
(Количественная оценка положения крестца у пациентов молодого, пожилого и старческого возраста)
Orel, A. M.
Russian Osteopathic Journal, 2021/07
Free full text
823

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text
824

Effect of mulligan’s mobilization with movement and post isometric relaxation technique on pain, range of motion and functional outcome in subjects with adhesive capsulitis
Nithya, N., Sathish Prabu, S. R., Arun, B., Abraham, M. M.
Indian Journal of Public Health Research and Development, 2021/06
Free full text
825

“Understanding patients' narratives” A qualitative study of osteopathic educators’ opinions about using Medical Humanities poetry in undergraduate education
Maretic, S., Abbey, H.
International Journal of Osteopathic Medicine, 2021/06
826

Non-surgical management and return to play of an anterior cruciate ligament rupture: A case report
Bibby, L., Tripodi, N.
International Journal of Osteopathic Medicine, 2021/06
827

Osteopathy: Italian professional profile. A professional commentary by a group of experts of the European community of practice
Cerritelli, F., Lunghi, C., Esteves, J. E., Vaucher, P., van Dun, P. L. S., Alvarez, G., Biberschick, M., Wagner, A., Merdy, O., Menard, M., Tavernier, P., Clouzeau, C., Risch, A., Ruffini, Nuria, Nunes, A., Santiago, R., Marett, P., Grech, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06
828

Inclusivity and accessibility in undergraduate osteopathic education for students with disability: A scoping review
MacMillan, A., Corser, A., Clark, Z.
International Journal of Osteopathic Medicine, 2021/06
829

“Who am I to disagree?” A qualitative study of how patients interpret the consent process prior to manual therapy of the cervical spine
Reed, B. R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06
830

Туннельная невропатия локтевого нерва: влияние остеопатической коррекции на снижение болевого синдрома
(Cubital tunnel neuropathy: Impact of osteopathic manipulative treatment on pain syndrome relief)
Belyaev, A. F., Belomestnov, P. V.
Russian Journal of Pain, 2021/06
Free full text
831

Establishing osteopathic assessments to fulfill osteopathic recognition standards: a model for dermatology and other subspecialties
Mahlberg, S. J., Liou, Y. L., Lloyd, J.
Journal of Osteopathic Medicine, 2021/06
Free full text
832

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 2: Diagnostik und Therapie
(Positional plagiocephaly and its osteopathic intervention. Part 2: Diagnostics and therapy)
Engel, M.
Osteopathische Medizin, 2021/06
833

Ersthelferinnen mit posttraumatischer Belastungsstörung: Auswirkung einer globalen osteopathischen Behandlung
(Female first responders with post-traumatic stress disorder: Effect of a global osteopathic treatment)
König, V.
Osteopathische Medizin, 2021/06
834

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06
835

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text
836

“Understanding patients' narratives” A qualitative study of osteopathic educators’ opinions about using Medical Humanities poetry in undergraduate education
Maretic, S., Abbey, H.
International Journal of Osteopathic Medicine, 2021/06
837

‘Don’t focus on the finger, look at the moon’ - The importance of contextual factors for clinical practice and research
Thomson, O. P., Rossettini, G.
International Journal of Osteopathic Medicine, 2021/06
838

Current state of nutrition and nutritional supplement training in medical schools
Lowther, D. P.
Unpublished PhD thesis, 2021/05
Free full text
839

Effects of CranioSacral Therapy upon Symptoms of Post-Acute Concussion and Post-Concussion Syndrome: A Pilot Study
Kratz, S. V., Kratz, D. J.
Journal of Bodywork and Movement Therapies, 2021/05
840

Examining concurrent validity between COMLEX-USA Level 2-Cognitive Evaluation and COMLEX-USA Level 2-Performance Evaluation
Craig, B., Wang, X., Sandella, J., Tsai, T. H., Kuo, D., Finch, C.
Journal of Osteopathic Medicine, 2021/05
Free full text
841

Effect of integrated neuromuscular inhibition technique compared with positional release technique in the management of piriformis syndrome
Danazumi, M. S., Yakasai, A. M., Ibrahim, A. A., Shehu, U. T., Ibrahim, S. U.
Journal of Osteopathic Medicine, 2021/05
Free full text
842

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
843

Gnathological and osteopathic treatments with digital evaluations before and after therapies: a case report of a patient with ehlers-danlos syndrome
Di Giacomo, P., Cerignoli, E., D'Ermes, V., Ferrato, G., Polimeni, A., Di Paolo, C.
La Clinica Terapeutica, 2021/05
Free full text
844

Effects of Osteopathic Manipulative Treatment on Parkinsonian Gait: A Statistical Parametric Mapping Analysis
Terrell, Z. T.
Unpublished MSc thesis, 2021/05
845

Direct and mediated effects of treatment context on low back pain outcome: a prospective cohort study
Bishop, F., Al-Abbadey, M., Roberts, L., MacPherson, H., Stuart, B., Carnes, D., Fawkes, C., Yardley, L., Bradbury, K.
BMJ Open, 2021/05
Free full text
846

Quels sont les modèles utilisés par les ostéopathes dans leur pratique pour interpréter leurs perceptions lors d’un test palpatoire fascial, viscéral et crânien ?
(What models do osteopaths use in their practice to interpret their perceptions during fascial, visceral and cranial palpatory testing?)
Hêche, M.
Unpublished MSc thesis, 2021/04
Free full text
847

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text
848

Principes, déterminants et processus de l’examen physique ostéopathique : une étude qualitative
(Principles, determinants and processes of the osteopathic physical examination: a qualitative study)
Pittet, E.
Unpublished MSc thesis, 2021/04
Free full text
849

Evidence-based assessment of potential therapeutic effects of adjunct osteopathic medicine for multidisciplinary care of acute and convalescent COVID-19 patients
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/04
Free full text
850

Effects of Osteopathic T9-T10 Vertebral Manipulation in Tonsillitis: A Randomized Clinical Trial
Luceño-Mardones, A., Luceño-Rodríguez, I., Rodríguez-López, E. S., Oliva-Pascual-Vaca, J., Rosety, I., Oliva-Pascual-Vaca, Á
Healthcare, 2021/04
Free full text
851

The effect of visceral manipulation on Diastasis Recti Abdominis (DRA): A case series
Kirk, B., Elliott-Burke, T.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text
852

Telemanagement of Home-Isolated COVID-19 Patients Using Oxygen Therapy With Noninvasive Positive Pressure Ventilation and Physical Therapy Techniques: Randomized Clinical Trial
Adly, A. S., Adly, M. S., Adly, A. S.
Journal of Medical Internet Research, 2021/04
Free full text
853

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
854

Osteopathic manipulative medicine in the management of headaches associated with postconcussion syndrome
Esterov, D., Thomas, A., Weiss, K.
Journal of Osteopathic Medicine, 2021/04
Free full text
855

Osteopathy and International classification of functionning, disability and health (part 1
(Остеопатия и Международная классификация функционирования, ограничений жизнедеятельности и здоровья (часть 1)
Belyaev, A. F.
Russian Osteopathic Journal, 2021/04
Free full text
856

Results of the inclusion of osteopathic correction in the complex therapy of patients with chronic gastritis
(Результаты включения остеопатической коррекции в состав комплексной терапии пациентов с хроническим гастритом)
Fazlyakhmetov, R. T., Safiullin, R. R., Ustinov, A. V.
Russian Osteopathic Journal, 2021/04
Free full text
857

The role of extracurricular activities and lectures in mitigating medical student burnout
Sepede, J. C., Petrides, J., Collins, P. B., Jones, M. C., Cantor, N., Boyd, L.
Journal of Osteopathic Medicine, 2021/04
Free full text
858

Substantiation of the possibility of osteopathic correction inclusion in the measures complex for the preoperative preparation of patients planned for extended abdominal surgery
(Обоснование возможности включения остеопатической коррекции в комплекс мер по предоперационной подготовке пациентов, планируемых на расширенные абдоминальные операции)
Volkov, P. A., Litvinov, N. I., Bolotov, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
859

Osteopathic medicine for fibromyalgia: a sham-controlled randomized clinical trial
Coste, J., Medkour, T., Maigne, J., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/04
Free full text
860

Durchführung von Listening-Tests im Rahmen der osteopathischen Routinebefundung – Eine videobasierte Beobachtungsstudie
(Performance of Listening-Tests in the Context of Routine Osteopathic Findings – A Video-Based Observational Study)
Pakanecz, K.
Unpublished MSc thesis, 2021/04
Free full text
861

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04
862

Der Effekt des osteopathischen Ansatzes und osteopathischer Techniken auf Symptome, insbesondere Schmerz, und Lebensqualität bei CMD – ein systematischer Review
(Efficacy of osteopathic approach and osteopathic techniques on pain, symptoms and quality of life in temporomandibular joint disorder: a systematic review)
Ixenmaier, D.
Unpublished MSc thesis, 2021/04
Free full text
863

Auswirkungen eines auf dem Fasziendistorsionsmodell basierenden osteopathischen Interventionsprogramms auf die Hüftmobilität und subjektiv empfundene Lebensqualität von Coxarthrosepatienten im Vergleich zur physiotherapeutischen Standardbehandlung Eine randomisiert kontrollierte Studie
(A randomized controlled trial on the effects of an osteopathic treatment method according to the Fascial Distortion Model on the hip mobility and subjectively perceived quality of life of coxarthrosis patients)
Holzer-Jüttner, S.
Unpublished MSc thesis, 2021/04
864

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text
865

La collaboration entre ostéopathes et logopédistes en Suisse romande, sa qualité, ses freins, les signes et symptômes cliniques qui appellent à collaborer : une étude quantitative
(Collaboration between osteopaths and speech therapists in French-speaking Switzerland, its quality, its obstacles, the clinical signs and symptoms that call for collaboration: a quantitative study)
Dahinden, L., Sieber, L.
Unpublished MSc thesis, 2021/04
Free full text
866

Opposing vaccine hesitancy during the COVID-19 pandemic - A critical commentary and united statement of an international osteopathic research community
Thomson, O. P., MacMillan, A., Draper-Rodi, J., Vaucher, P., Ménard, M., Vaughan, B., Morin, C., Alvarez, G., Sampath, K. K., Cerritelli, F., Shaw, R., Cymet, T. C., Bright, P., Hohenschurz-Schmidt, D., Vogel, S.
International Journal of Osteopathic Medicine, 2021/03
Free full text
867

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 1: Die Grundlagen
(Positional plagiocephaly and its osteopathic intervention. Part 1: Basics)
Engel, M.
Osteopathische Medizin, 2021/03
868

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Expert*inneninterviews – Teil 2: Qualitative empirische Daten
(The osteopathic treatment of interosseous lesions: A qualitative content analysis of experts' interviews - Part 2: Qualitative empirical data)
Stecker, D.
Osteopathische Medizin, 2021/03
869

Actions Speak Louder Than Words: Exploring Pragmatism in Osteopathy
Macfarlane, C.
Unpublished PhD thesis, 2021/03
Free full text
870

Developing a psychologically-informed pain management course for use in osteopathic practice: The OsteoMAP cohort study
Abbey, H., Nanke, L., Brownhill, K.
International Journal of Osteopathic Medicine, 2021/03
871

Knochen und Immunität: Die leitende Funktion des Knochens in der generellen Immunität des Organismus aus osteopathischer Sicht
(Bone and immunity: The central function of the bone in the general immunity of the organism from osteopathic point of view)
Buekens, Jo
Osteopathische Medizin, 2021/03
872

Moderate to Substantial Inter-Rater Reliability in the Assessment of Cranial Bone Mobility Restrictions
Demers, K., Morin, C., Collette, L., DeMont, R.
The Journal of Alternative and Complementary Medicine, 2021/03
873

The validity of lumbo-pelvic landmark palpation by manual practitioners: a systematic review
Alexander, N., Rastelli, A., Webb, T., Rajendran, D.
International Journal of Osteopathic Medicine, 2021/03
874

Healthier together: a pilot study on the implementation of a novel family centered pediatric obesity prevention program
Bach, M., Shenoi, S., Winger, K., Hendriksz, T.
Journal of Osteopathic Medicine, 2021/03
Free full text
875

Teaching and use of cervical high-velocity, low-amplitude manipulation at colleges of osteopathic medicine
Hu, A., Motyka, T., Gish, E., Dogbey, G.
Journal of Osteopathic Medicine, 2021/03
Free full text
876

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03
877

Manual treatment for kidney mobility and symptoms in women with nonspecific low back pain and urinary infections
Lo Basso, F., Pilzer, A., Ferrero, G., Fiz, F., Fabbro, E., Oliva, D., Cazzarolli, C., Turrina, A.
Journal of Osteopathic Medicine, 2021/03
Free full text
878

The use of 3D printing for osteopathic medical education of rib disorders
Moriles, K., Ramnot, A., Lai, M., Jacobs, R. J., Qureshi, Y.
Journal of Osteopathic Medicine, 2021/03
Free full text
879

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03
880

The Impact of the ACGME/AOA Single Accreditation System on Osteopathic Surgical Specialties, Residents, and DO Students
Cummings, M.
Journal of Surgical Education, 2021/03
881

Radiation oncology education and experience in the undergraduate medical setting
Odiase, O. M., Huang, D., Sura, K. T.
Medical Education Online, 2021/03
Free full text
882

Objectivation of an Educational Model in Cranial Osteopathy Based on Experience
Requena-García, J., García-Nieto, E., Varillas-Delgado, D.
Medicina (Kaunas), 2021/03
883

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text
884

Der tiefsitzende Beckenschmerz: Ein osteopathischer Behandlungsalgorithmus in sieben Schritten
(The chronic pelvic pain: An osteopathic treatment algorithm in seven steps)
Liedtke, H.
Osteopathische Medizin, 2021/03
885

Effect of Autonomic Nervous System Recovery from Sympathetic Challenge Using Osteopathic Cranial Manipulative Medicine – A Pilot Study
Blumer, J. U.
The AAO Journal, 2021/03
Free full text
886

Thomas L. Northup Lecture: Accepting the Death of Osteopathy: A New Beginning
Jealous, J. S.
The AAO Journal, 2021/03
Free full text
887

Breathing and the Center of Command - The influence of respiration on the Central Nervous System
Auer-Rizzi, K.
Unpublished MSc thesis, 2021/03
Free full text
888

Diversity in osteopathic medical school admissions and the COMPASS program
Dady, N., Mungroo, K. A., Young, T., Akinsanya, J., Forstein, D.
Journal of Osteopathic Medicine, 2021/02
Free full text
889

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text
890

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
891

Effect of occipitoatlantal decompression on cerebral blood flow dynamics as evaluated by Doppler ultrasonography
Roberts, B., Makar, A. E., Canaan, R., Pazdernik, V., Kondrashova, T.
Journal of Osteopathic Medicine, 2021/02
Free full text
892

Supportive care and osteopathic medicine in pediatric oncology: perspectives of current oncology clinicians, caregivers, and patients
Belsky, J. A., Stanek, J., Skeens, M. A., Gerhardt, C. A., Rose, M. J.
Supportive Care in Cancer, 2021/02
Free full text
893

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text
894

Die osteopathische Anwendung der CV4 Technik bei Patientinnen und Patienten mit chemoinduzierter Polyneuropathie nach zytostatischer Chemotherapie
(The Osteopathic Application of the CV4 Technique in Patients with Chemotherapy-induced Polyneuropathy after Cytostatic Chemotherapy)
Flaschberger, P.
Unpublished MSc thesis, 2021/02
Free full text
895

Die Auswirkungen einer osteopathischen Technik am Ganglion Stellatum auf die sympathische Nervenaktivität
(The effects of an osteopathic technique on the stellate ganglion on the sympathethic nerve activity)
Böhlen, N.
Unpublished MSc thesis, 2021/02
Free full text
896

Einfluss einer osteopathischen Behandlung auf chemotherapeutisch induzierte Nausea und Vomiting (CINV) und auf die gesundheitsbezogene Lebensqualität während emetogen wirkender Chemotherapie
(The Influence of Osteopathic Treatment on Chemotherapy Induced Nausea and Vomiting (CINV) and Health Related Quality of Life (QoL) in Patients with Cancer treated with Emetogenic Chemotherapy)
Aranya-Mayr, J.
Unpublished MSc thesis, 2021/02
897

Osteopathic neuromuscular rehabilitation: A novel approach to treat spasticity following systemic illness, brain tumour, and traumatic brain injury in general population
Ali, I.
Unpublished PhD thesis, 2021/02
Free full text
898

Forschung in der Osteopathie. Eine qualitative, phänomenologische und systematische Studie.
(Research in Osteopathy. A qualitative, phenomenological and systematic study.)
Stecker, D.
unpublished MSc thesis, 2021/02
Free full text
899

Die Osteopathie aus Sicht der Allgemeinmediziner – eine qualitative Interviewstudie
(Osteopathy from the point of view of general practitioners - a qualitative interview study)
Waubert de Puiseau, A., Hörcher, M., Belz, S., Esch, S.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
900

Palpation, Interraterreliabilität und Soft Skills
(Palpation, interrater reliability and soft skills)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
901

Ist kraniale Osteopathie zuverlässig und wirksam?
(Is cranial osteopathy reliable and effective?)
Reißmann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
902

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01
903

Impact of an osteopathic presence in a large categorical pediatric residency training program
Barnhardt, E. W., Comer, F., Zmuda, E., Rakowsky, A.
Journal of Osteopathic Medicine, 2021/01
Free full text
904

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text
905

Patients’ understanding of their presenting conditions following a consultation with a student osteopath
Turner, A.
Unpublished MSc thesis, 2021/01
Free full text
906

Perceptions of the Osteopathic Profession in New York City's Korean Communities
Justin Chin, D. O., Haeinn Woo, Oms-Iv, Diane Choi, O. M. S., III, Emily Dube, M. S., Mikhail Volokitin, Md Do, Christine Lomiguen
Osteopathic Family Physician, 2021/01
Free full text
907

Inanspruchnahme osteopathischer Medizin bei chronisch und Langzeit-Erkrankten
(Use of osteopathic medicine for chronic and long-term patients)
Beer, A.M., Kiseier, P., Weber, H.
Journal für Pharmakologie und Therapie, 2021
Free full text
908

Veränderungen des Visus durch Therapie der Synchondrosis sphenooccipitalis an Kurzsichtigen - eine doppelblindierte Studie
(Changes in visual acuity due to therapy of sphenooccipital synchondrosis in myopic patients - a double-blind study)
Angerer, S.
Unpublished MSc thesis, 2020/12
Free full text
909

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text
910

Knowledge of Nutritional Issues among Osteopaths in Austria: A Cross-Sectional Study
Putschögl, J., Woisetschläger, G.
European Journal of Osteopathic Research, 2020/12
Free full text
911

The Use of Osteopathic Manipulative Medicine in the Management of Recurrent Mastitis
Jackson, C., Loveless, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
912

Mobitz Type II Atrioventricular Heart Block After Candlenut Ingestion
Koons, A. L., Laubach, L. T., Katz, K. D., Beauchamp, G. A.
The Journal of the American Osteopathic Association, 2020/12
Free full text
913

Brain Connectivity Changes after Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tramontano, M., Cerritelli, F., Piras, F., Spanò, B., Tamburella, F., Piras, F., Caltagirone, C., Gili, T.
Brain Sciences, 2020/12
Free full text
914

Remdesivir for the Treatment of Severe COVID-19: A Community Hospital's Experience
Lee, S., Santarelli, A., Caine, K., Schritter, S., Dietrich, T., Ashurst, J.
The Journal of the American Osteopathic Association, 2020/12
Free full text
915

Cranial Manipulation Affects Neuronal Gene Expression, Explaining the Improved Cognitive Ability in an Animal Model of Age-related Cognitive Decline
Anandakrishnan, R.
The Journal of the American Osteopathic Association, 2020/12
916

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12
917

The Effect of Facial Effleurage on Serum Complement C3 During Acute Rhinosinusitis: A Randomized, Controlled Study
Burke, K. S., Weidman, C., Bradley, J. H.
The Journal of the American Osteopathic Association, 2020/12
918

Burn-out in Osteopathic Medical Students: The Effects of Meditation Before and After the Arrival of the COVID-19 Pandemic
Krishnamachari, B., Morris, A., Chinsky, R., Pendyala, R., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2020/12
919

The Efficacy of Facial Effleurage, a Lymphatic Pump Technique, on Immune Response and Symptoms in Acute Rhinosinusitis: A Randomized, Controlled Study
Weidman, C., Boyd, M., Pepper, E., Hsieh, K., Kunda, D. T., Burke, K. S., Carrasco, M., Escamilla, O., Cheng, N., Bradley, J. H.
The Journal of the American Osteopathic Association, 2020/12
920

Comparison of the effects of a Mitchell’s myotensive technique and the strain-shortening technique on passive axial rotation of the cervical spine
(Сравнение влияния миотензивной техники Митчелла и так называемой техники укорочения с сопротивлением на пассивную осевую ротацию шейного отдела позвоночника)
Dehiles, R., Salem, W., Klein, P.
Russian Osteopathic Journal, 2020/12
Free full text
921

Utilizing Osteopathic Manipulative Treatment as a Non-Surgical Approach to Severs Disease in a Growing Adolescent
Madhu, B., Goldenhart, A.
Southern Medical Journal, 2020/12
922

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
923

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
924

The Effect of Osteopathic Manipulative Treatment on Lower Limb Muscle Rigidity in a Parkinson's Patient
Vemuri, A., Xu, E., Downing, M., Widboom, N.
Southern Medical Journal, 2020/12
925

Osteopathic correction as part of the complex treatment of primary biliary cholangitis
(Остеопатическая коррекция в составе комплексного лечения первичного билиарного холангита)
Lebedev, D. S., Nizamova, A. H.
Russian Osteopathic Journal, 2020/12
Free full text
926

Kikuchi-Fujimoto Disease Heralding Systemic Lupus Erythematosus
Aun, J. A., Hubbard, M. J.
The Journal of the American Osteopathic Association, 2020/12
Free full text
927

Psychosomatic disorders: influence of white noise on disease in patients with cervicalgia (Message 1
(Психосоматические нарушения: влияние белого шума на проявления заболевания у пациентов с цервикалгией (сообщение 1)
Novikov, Y. O., Tregubova, E. S., Kantor, O. G., Shaiakhmetov, A. R., Andreeva, I. S.
Russian Osteopathic Journal, 2020/12
Free full text
928

Die Brustdrüse aus osteopathischer Sicht: Teil 2: Praktische Anwendung
(The mammary gland from an osteopathic point of view - Part 2: Practical application)
Frühwein, J.
Osteopathische Medizin, 2020/12
929

Einzelfallstudie über den Einfluss einer osteopathischen Behandlung eines Mannes mit unerfülltem Kinderwunsch
(Single Case Study on the Influence of an Osteopathic Treatment of One Man with the Unfulfilled Desire To Have a Child)
Mayrhofer, M.
Unpublished MSc thesis, 2020/12
Free full text
930

Acute Suppurative Thyroiditis
Desai, P., Mbachi, C., Singh, A.
The Journal of the American Osteopathic Association, 2020/11
Free full text
931

[PREPRINT] “Somebody Who Does Something Other Than Osteopathy“
Sajjadi, N. B., Shepard, S.
The Journal of the American Osteopathic Association, 2020/11
Free full text
932

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
933

The Battle Between Politics and Science Is Costing Us a Timely Victory Over the COVID-19 Pandemic
Hahn, M. B.
The Journal of the American Osteopathic Association, 2020/11
Free full text
934

Associations Between Social Support and Diabetes-Related Distress in People With Type 2 Diabetes Mellitus
Young, C. F., Shubrook, J. H., Valencerina, E., Wong, S., Henry Lo, S. N., Dugan, J. A.
The Journal of the American Osteopathic Association, 2020/11
Free full text
935

Status of Entrustable Professional Activities (EPA) Implementation at Colleges of Osteopathic Medicine in the United States and Future Considerations
Linsenmeyer, M., Wimsatt, L., Speicher, M., Basehore, P., Sexton, P. S.
The Journal of the American Osteopathic Association, 2020/11
936

Neurophysiologische Aspekte der osteopathischen Palpation gemessen mit der Herzratenvariabilitätsmessung
(Neurophysiological aspects of osteopathic palpation measured with the heart rate variability measurement)
Strohmaier, B.
Unpublished MSc thesis, 2020/11
Free full text
937

Osteopathische Anwendung bei Aufmrksamkeits - Defizit - Syndrom
(Osteopathic application in case of lack of concentration)
Werth, B.
Unpublished MSc thesis, 2020/11
938

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text
939

Osteopathic manipulative treatment in a general pediatric setting: An account of reflective practice
Mills, M. V.
Complementary Therapies in Clinical Practice, 2020/11
940

Referring Patients with Type 2 Diabetes to a Registered Dietitian Nutritionist in New Mexico
Lamoreux, R. A.
Unpublished MSc thesis, 2020/11
Free full text
941

Der sternale Recoil als Alternative zu einer hochthorakalen HVLA-Technik bei unspezifischen Nackenschmerzen?
(Sternal Recoil as an alternative to thoracic HVLA?)
Rauch, B.
Unpublished MSc thesis, 2020/11
942

Validität und Interrater-Reliabilität des Grynfeltt-Tests
(Validity and inter-rater reliability of the Grynfeltt-test)
Drobe, W.
Unpublished MSc thesis, 2020/10
943

Postoperative peritoneale Adhäsionen
(Postoperative peritoneal adhäsionen)
Liedler, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
944

QTc Interval Prolongation Associated With Inpatient Azithromycin Therapy for Pneumonia
Cruz, M. D., Ershad, M., Mostafa, A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
945

Situation, Chancen und Herausforderungen der Osteopathie in der Schweiz
(Characteristics, Opportunities and Challenges of Osteopathy in Switzerland)
Meier, M. D., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
946

Musculoskeletal Conditions in Patients With Diabetes: A Narrative Review
Shafer, D., Gooing, J., Lee, V., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
947

Osteopathic Manipulative Treatment in Individuals With Vertigo and Somatic Dysfunction: A Randomized, Controlled, Comparative Feasibility Study
Fraix, M., Badran, S., Graham, V., Redman-Bentley, D., Hurwitz, E. L., Quan, V. L., Yim, M., Hudson-McKinney, M., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
948

Anwendung des Viszeroletic-Konzeptes beim Reizdarmsyndrom
(Applying the Visceroletic-Concept to the Irritable Bowel Syndrome)
Ryback, S.
Unpublished MSc thesis, 2020/10
Free full text
949

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text
950

New investigator editorial: the osteopathic medical student perspective on research
Persand, D., Maddie, N.
American Journal of Physiology. Heart and Circulatory Physiology, 2020/10
Free full text
951

Effektivität von Osteopathie bei Patient/en/innen mit gastrointestinalen Erkrankungen; Eine systematische Übersichtsarbeit
(Effectiveness of Osteopathy in Patients with Gastrointestinal Diseases - A Systematic Review)
Schönberger, B.
Unpublished MSc thesis, 2020/10
Free full text
952

Sample size, study length and inadequate controls were the most common self-acknowledged limitations in manual therapy trials: A methodological review
Alvarez, G., Núñez-Cortés, R., Solà, I., Sitjà-Rabert, M., Fort-Vanmeerhaeghe, A., Fernández, C., Bonfill, X., Urrutia, G.
Journal of Clinical Epidemiology, 2020/10
953

A phenomenological investigation into the influences on the development of professional identity in novice osteopaths
Razon, C. J.
Unpublished MSc thesis, 2020/10
Free full text
954

Dysphagia Lusoria
Andersen, K., Hoff, R., Silas, D.
The Journal of the American Osteopathic Association, 2020/10
Free full text
955

The Role of Musculoskeletal Disorders in Chronic Disease: A Narrative Review
Asahi, M. G., Briganti, D., Cam, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
956

Osteopathic Manipulative Treatments for Pediatric Conditions
Raines, S. G. M., Ramey, A. L.
Osteopathic Family Physician, 2020/10
Free full text
957

Gonococcal Arthritis
Mills, K., Jadav, P.
The Journal of the American Osteopathic Association, 2020/10
Free full text
958

“I do it my way” - Italian osteopaths’ beliefs and attitudes about five osteopathic models: A qualitative study
Bettelli, L., Pisa, V., Formica, A.
International Journal of Osteopathic Medicine, 2020/10
959

Auswirkungen von osteopathischen Behandlungen im Vergleich zur Anwendung eines Entspannungsverfahrens auf die Lebensqualität von Endometriose-Patientinnen
(Effects of Osteopathic Treatments in Comparison to a Relaxation-Method on the Quality of Life of Endometriosis Patients)
Kremen-Pilz, I.
Unpublished MSc thesis, 2020/10
Free full text
960

Intertester-Reliabilitätsstudie - ist das Ergebnis der Oszillationstestung der Brustwirbelsäule in Bauchlage abhängig von dem/der testenden Osteopathen/in
(Interexaminer reliability of the oscillation test in the thoracic spine in prone position)
Kössler, M.
Unpublished MSc thesis, 2020/10
Free full text
961

Die kranio-kaudale Bewegung im Articulatio tibiofibulare proximalis bei einer Dorsalextension und Plantarflexion im Articulatio talocruralis
(The cranial and caudal movement of the Art. Tibiofibularis proximalis during dorsalextension and plantarflexion)
Bernhardt, M.
Unpublished MSc thesis, 2020/09
Free full text
962

Continuing debates about models of practice
Vogel, S.
International Journal of Osteopathic Medicine, 2020/09
963

Erweiterung des biopsychosozialen Modells für die muskuloskelettale Praxis: Teil 2: Klinische Bedeutung für die muskuloskelettale Behandlung (German translation)
(Extension of the biopsychosocial model for musculoskeletal practice. Part 2: Clinical significance for musculoskeletal treatment)
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
Osteopathische Medizin, 2020/09
964

What Makes an Osteopathic Treatment Effective From a Patient's Perspective: A Descriptive Phenomenological Study
Consorti, G., Marchetti, A., De Marinis, M. G.
Journal of Manipulative and Physiological Therapeutics, 2020/09
965

Short- and medium-term outcomes of patients with subacromial-subdeltoid bursitis following ultrasound-guided corticosteroid injection: a prospective single-group cohort study
Reumers, L.
Unpublished MSc thesis, 2020/09
Free full text
966

Assessing the feasibility of a therapy package application on reducing psychological and physiological stress in men: a pilot study
Rahier, A.
Unpublished MSc thesis, 2020/09
Free full text
967

The structure of somatic dysfunctions in women with a nodular form of uterine myoma
(Структура соматических дисфункций у женщин с узловой формой миомы матки)
Chebotaeva, G. N., Lebedev, D. S.
Russian Osteopathic Journal, 2020/09
Free full text
968

„Der Dampf des Lebens“: Das Blut im Kontext der (klassischen) Osteopathie
“The steam of life“: The blood in the context of (classical) osteopathy
Engel, M.
Osteopathische Medizin, 2020/09
969

The application of physical therapy and balneology of the patients with non-specific low back pain (literature review
(Применение физио- и бальнеотерапии у пациентов с неспецифической болью в нижней части спины (обзор литературы)
Novikov, A. Y., Shaiakhmetov, A. R., Novikov, Y. O.
Russian Osteopathic Journal, 2020/09
Free full text
970

The osteopathic status specific of the practically healthy group of the military age male population
(Особенности остеопатического статуса у практически здоровой группы мужского населения призывного возраста)
Petrova, G. V., Pushkarev, I. M., Savel′yeva, N. V., Solovey, N. L., Shiryayeva, E. E., Yanushanets, O. I.
Russian Osteopathic Journal, 2020/09
Free full text
971

Osteopathie für Neugeborene in der Klinik?: Eine qualitative Studie
Osteopathy for newborns in hospitals?: A qualitative study
Brintrup, V., Hartmann, M., Herrmann, H., Belz, S., Esch, S.
Osteopathische Medizin, 2020/09
972

Instrumentation used to assess pain in osteopathic interventions: A critical literature review
Santiago, R. J., Esteves, J., Baptista, J. S., Marques, A. T., Costa, J. T.
International Journal of Osteopathic Medicine, 2020/09
973

What do UK osteopaths view as the safest lifting posture, and how are these views influenced by their back pain beliefs?
Smith, K., Thomson, O. P.
International Journal of Osteopathic Medicine, 2020/09
974

Die Brustdrüse aus osteopathischer Sicht: Teil 1: Grundlagen
(The mammary gland from an osteopathic point of view. Part 1: Fundamentals)
Frühwein, J.
Osteopathische Medizin, 2020/09
975

Recognizing Postoperative Nutritional Complications of Bariatric Surgery in the Primary Care Patient: A Narrative Review
Chamberlain, C., Terry, R., Shtayyeh, T., Martinez, C.
The Journal of the American Osteopathic Association, 2020/09
Free full text
976

Geburtsmerkmal Storchenbiss - Der Zusammenhang zwischen occipitalen Dysfunktionen und einem suboccipitalen Nävus Unna beim Säugling
(Stork bite birthmark - the connection between occipital dysfunction and a suboccipital Unna nevus in infants)
Oberger, I.
Unpublished MSc thesis, 2020/09
Free full text
977

Biomedical origins of the term 'osteopathic lesion' and its impact on people in pain
Noy, M., Macedo, L., Carlesso, L.
International Journal of Osteopathic Medicine, 2020/09
978

The development and exploratory analysis of the Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ)
Thomson, O. P., Anstiss, V.
International Journal of Osteopathic Medicine, 2020/09
979

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
980

Trichoepithelioma
Skorin, L., Bauer, S. A.
The Journal of the American Osteopathic Association, 2020/08
Free full text
981

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text
982

Treatment Modalities for Notalgia Paresthetica Including OMT
Cooley, D., McAree, M., Joshi, N., Peerzada, W.
Osteopathic Family Physician, 2020/08
Free full text
983

Time-Restricted Feeding and Potential for Type 2 Diabetes Mellitus: A Narrative Review
Lustig, E., Shubrook, J. H., Pfotenhauer, K. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text
984

Clinical Efficacy of Mesenteric Lift to Relieve Constipation in Traumatic Brain Injury Patients
Berry, J. A. D., Ogunlade, J., Kashyap, S., Berry, D. K., Wacker, M., Miulli, D. E., Saini, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
985

Positional plagiocephaly from structure to function: Clinical experience of the service of pediatric osteopathy in Italy
Filisetti, M., Cattarelli, D., Bonomi, S.
Early Human Development, 2020/07
986

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07
987

Evaluating Financial Conflicts of Interest Among Contributors to Clinical Practice Guidelines of the American College of Obstetricians and Gynecologists
Wright, M. R., Frye, L., Vo Solis, L., Checketts, J. X., Guevara, C., Smith, L., Vassar, M.
The Journal of the American Osteopathic Association, 2020/07
Free full text
988

Osteopathic Treatment leads to significantly greater reductions in chronic thoracic pain after CABG surgery: a randomised controlled trial
Roncada, Gert
Journal of Bodywork and Movement Therapies, 2020/07
989

Novel Dual-Fluorescent Mitophagy Reporter Reveals a Reduced Mitophagy Flux in Type 1 Diabetic Mouse Heart
Kobayashi, S., Patel, J., Zhao, F., Huang, Y., Kobayashi, T., Liang, Q.
The Journal of the American Osteopathic Association, 2020/07
Free full text
990

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
991

(Corporeality of the heart)
Kozljanič, R. J., Scheuchl, F., Rösing, S.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
992

A guide to writing a case report of an osteopathic patient
Vaughan, B., Fleischmann, M.
International Journal of Osteopathic Medicine, 2020/06
993

OMT bei der Behandlung von Infektionskrankheiten zu Beginn des 20. Jahrhunderts: Mit Anmerkungen aus aktuellen Forschungen und Behandlungsmodalitäten
(OMT in the treatment of infectious diseases at the beginning of the 20th century: With comments from current research and treatment modalities)
Liem, T.
Osteopathische Medizin, 2020/06
994

Empathy in Medicine Self and Other in Medical Education: Initial Emotional Intelligence Trend Analysis Widens the Lens Around Empathy and Burnout
Singer-Chang, G., Dong, F., Seffinger, M., Nevins, N., Blumer, J., Musharbash, H., Helf, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
995

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06
996

Implied Evidence of the Functional Role of the Rectus Capitis Posterior Muscles
Hallgren, R. C., Rowan, J. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text
997

Pain knowledge, attitudes and beliefs of Australian osteopaths drawn from a nationally representative sample of the profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Austin, P.
Journal of Bodywork and Movement Therapies, 2020/06
998

Professional identity in the evolution of osteopathic models: Response to Esteves et al
Alvarez, G., Van Biesen, T., Roura, S.
International Journal of Osteopathic Medicine, 2020/06
999

Erweiterung des biopsychosozialen Modells für die muskuloskelettale Praxis: Teil 1: Einführung religiöser und spiritueller Dimensionen in das biopsychosoziale Modell
(Extension of the biopsychosocial model for the musculoskeletal practice. Part 1: Introduction of religious and spiritual dimensions into the biopsychosocial model)
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
Osteopathische Medizin, 2020/06
1000

Osteopathic medicine: A judicial section for one specific profession
Beaume, S.
Medecine et Droit, 2020/06
1001

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text
1002

Inter-examiner agreement of musculoskeletal and visceral tests to assess the pelvic region in women with stress urinary incontinence
Arcanjo, G. N., Mendes, M. R., Cavalcante, A., Lima, . O., Vilaça-Alves, J., Rocha, M.
Motricidade, 2020/06
Free full text
1003

The Role of Sphenobasilar Synchondrosis in Disease and Health
Liem, T.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1004

PROMIS® General Life Satisfaction scale: construct validity in musculoskeletal pain patients
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/06
Free full text
1005

Sudeck syndrome — current understanding of pathogenesis, risk factors, diagnosis and treatment (literature review
(Синдром Зудека — современные представления о патогенезе, факторах риска, диагностике и лечении (обзор литературы)
Mikhnov, G. I., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/06
Free full text
1006

Influence of osteopathic correction on the psychoemotional state and quality of life of pregnant women with concomitant pathology of the urinary system
(Влияние остеопатической коррекции на психоэмоциональное состояние и качество жизни беременных с сопутствующей патологией мочевыводящей системы)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/06
Free full text
1007

Types of the statics of the spine in patients of young, elderly and senile age
(Типы статики позвоночника у пациентов молодого, пожилого и старческого возраста)
Orel, A. M.
Russian Osteopathic Journal, 2020/06
Free full text
1008

Graves Orbitopathy
Natali, S., Shogan, P.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1009

The Five Diaphragms in Osteopathic Manipulative Medicine: Myofascial Relationships, Part 2
Bordoni, B.
Cureus, 2020/06
Free full text
1010

Rationale for the use of osteopathic correction in the treatment of patients with chronic lower limb vein disease
(Обоснование применения остеопатической коррекции при лечении пациенток с хроническим заболеванием вен нижних конечностей)
Shmeleva, A. S., Mizonova, I. B.
Russian Osteopathic Journal, 2020/06
Free full text
1011

Die Ossifikation der Synchondrosis Sphenobasilaris
(The Ossification of the spheno-occipital synchondrose)
Hödl-Majcenovic, E.
Unpublished MSc thesis, 2020/06
Free full text
1012

Antithrombotic Therapy for Patients With Atrial Fibrillation and Acute Coronary Syndrome or Percutaneous Coronary Intervention
Tseng, A. S., Shamoun, F. E., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/05
Free full text
1013

Does the Halo Effect for Level 1 Trauma Centers Apply to High-Acuity Nonsurgical Admissions?
Hwalek, A. E., Kothari, A. N., Wood, E. H., Blanco, B. A., Brown, M., Plackett, T. P., Kuo, P. C., Posluszny, J.
The Journal of the American Osteopathic Association, 2020/05
Free full text
1014

Effects of static stretching as compared to autogenic inhibition and reciprocal inhibition muscle energy techniques in the management of mechanical neck pain: a randomized controlled trial
Osama, M., Shakil Ur Rehman, S.
Journal of the Pakistan Medical Association, 2020/05
Free full text
1015

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text
1016

Eine deskriptive Studie der osteopathischen Praxistätigkeit der Schweizer Ärztegesellschaft für Osteopathische Medizin
(A descriptive study of osteopathic practice activity by the Swiss Medical Association for Osteopathic Medicine)
Good, L.
Unpublished MSc thesis, 2020/04
Free full text
1017

Obstacles rencontres et stratégies mises en place a l'obtention du consentement éclaire du patient à la manipulation structurelle dans une consultation ostéopathique : projet de recherche
(Obstacles encountered and strategies implemented to obtain the patient's informed consent to structural manipulation in an osteopathic consultation: a research project)
Grandjean-Perrenoud-Contesse, C.
Unpublished MSc thesis, 2020/04
Free full text
1018

Medizinischer Notfall in der Praxis: Ich packe meinen Koffer …
(Medical emergency in the practice: I pack my suitcase ...)
Merkt, P., Grasmück, J., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1019

Deutschschweizer Osteopath*innen und das Verschreiben von Übungen und Ratschlägen zu physischer Aktivität
(Swiss-German osteopaths and the prescription of exercises and advice on physical activity)
Jäger, G. I.
Unpublished MSc thesis, 2020/04
Free full text
1020

Wie erleben Cancer Survivors eine osteopathische Behandlung und wie hat diese zum allgemeinen Wohlbefinden (well-being) beigetragen? : eine qualitative Studie
(How do cancer survivors experience osteopathic treatment and how has it contributed to their overall well-being? : a qualitative study)
Meuwly, N.
Unpublished MSc thesis, 2020/04
Free full text
1021

Perceptions of the nurse practitioner in the hosptial setting
Cunningham, M. R.
Unpublished Dissertation, 2020/04
Free full text
1022

Quels rôles pensent jouer les ostéopathes dans la prise en charge d’un patient pédiatrique : une étude qualitative
(What roles do osteopaths think they play in the management of a paediatric patient: a qualitative study)
Rohrbach, C.
Unpublished MSc thesis, 2020/04
Free full text
1023

Quelle tenue les ostéopathes portent-ils en cabinet en suisse et pourquoi ? Traduit-elle un positionnement par rapport au monde médical conventionnel ? : une étude qualitative
(What kind of dress do osteopaths wear in their Swiss practices, and why? Does it reflect a positioning in relation to the conventional medical world? A qualitative study)
Roth, T.
Unpublished MSc thesis, 2020/04
Free full text
1024

Understanding the professional identity development of undergraduate osteopathic students in the UK
McKenna, B.
Unpublished PhD thesis, 2020/04
Free full text
1025

Helping Students Navigate the Single Graduate Medical Education Accreditation System
Díaz, S. R., Baker, S. D., Medio, F. J.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1026

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1027

More Information on Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1028

Osteopathic Primary Care Treatment Options for Ulcerative Colitis
Fernandez, A., Januchowski, R.
Osteopathic Family Physician, 2020/04
Free full text
1029

Urticaria: Diagnosis and Treatment with Osteopathic Considerations
Stacey, S.., Burke, D., Brininger, T.
Osteopathic Family Physician, 2020/04
Free full text
1030

Inhibitory Tests as Assessment Tools for Somatic Dysfunctions: Mechanisms and Practical Applications
Bicalho, E., Vieira, L., Makita, D. K., Rivas, L.
Cureus, 2020/04
Free full text
1031

Empathy in MedicineCultivating an Empathetic Professional Identity in Osteopathic Medical Students Through Service Learning: A Qualitative Analysis of Reflective Essays
Chrisman-Khawam, L. M., Manzi, J. A.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1032

Perception des effets d'un traitement ostéopathique sur la qualité et la pratique du chant : une étude qualitative
(Perceived effects of osteopathic treatment on the quality and practice of singing: a qualitative study)
Christe, C.
Unpublished MSc thesis, 2020/03
Free full text
1033

Gesundheit entsteht?: Die Bedeutung der sensomotorischen und psychischen Stabilität in der Entwicklung von Gesundheit
(Does health develop?: The importance of sensorimotor and psychological stability in the development of health)
Levin, Valbona A., Levin, P.
Osteopathische Medizin, 2020/03
1034

Chronically Exposed Knee Hardware
Dobracki, A.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1035

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1036

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1037

CATALYST: Piloting a Longitudinal Assessment and Learning Program for Board Recertification and Continuous Professional Development
Horber, D. T., Flamini, J., Gimpel, J. R., Tsai, T. E., Shrum, K., Hudson, K.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1038

Characteristics and Treatment of Pediatric Patients in an Osteopathic Manipulative Medicine Clinic
Kaiser, G., Degenhardt, B. F., Michael Menke, J., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1039

Barriers and facilitators experienced by osteopaths in implementing a biopsychosocial (BPS) framework of care when managing people with musculoskeletal pain – A mixed methods systematic review protocol
Kovanur Sampath, K., Darlow, B., Tumilty, S., Shillito, W., Hanses, M., Devan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2020/03
Free full text
1040

Life satisfaction and musculoskeletal complaints in a population seeking osteopathy care: consecutive sample of 611 patients
Vaughan, B., Mulcahy, J., Allen, T., Coupe, E., Gobbo, D., Nasser, L., Pain, K., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/03
1041

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text
1042

Combining psychotherapy with craniosacral therapy for severe traumatized patients: A qualitative study from an outpatient clinic in Norway
Stub, T., Kiil, M., Lie, B., Kristoffersen, A., Weiss, T., Hervik, J., Musial, F.
Complementary Therapies in Medicine, 2020/03
1043

Kinderfußfunktion und spätere Haltungsgesundheit des Erwachsenen: Ursache und Wirkung – zwei Seiten einer Medaille
(Children's foot function and subsequent adult's postural health: Cause and effect - Two sides of a single coin)
Bäumer, C. J.
Osteopathische Medizin, 2020/03
1044

The Intraosseous Dysfunction in the Osteopathic Perspective: Mechanisms Implicating the Bone Tissue
Bicalho, E.
Cureus, 2020/03
Free full text
1045

Osteopathie zur Therapie bei unspezifischen Rückenschmerzen: Kritische Anmerkungen zu den Ergebnissen des IGeL-Monitors
(Osteopathy for the treatment of non-specific back pain: Critical comments on the results of the IGeL-Monitor)
Franke, H.
Osteopathische Medizin, 2020/03
1046

A study of the factors impacting on workforce distribution of Australian osteopaths: The perspectives of osteopathic students, academics and clinicians
Steel, A., Dingle, T., Wardle, J., Adams, J.
International Journal of Osteopathic Medicine, 2020/03
1047

‘Tell me your story’ - How osteopaths apply the BPS model when managing low back pain - A qualitative study
Abrosimoff, M., Rajendran, D.
International Journal of Osteopathic Medicine, 2020/03
1048

Funktionsstörungen der Kopfgelenke – ein wenig bekanntes Untersuchungs- und Behandlungskonzept
(Functional disorders of the craniovertebral joints—a little known examination and treatment concept)
Heidrich, Dr, Buchmann, Joachim
Manuelle Medizin, 2020/02
1049

Effect of manual approaches with osteopathic modality on brain correlates of interoception: an fMRI study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Perrucci, M. G., Barassi, G., Visciano, C., Bellomo, R. G., Saggini, R., Ferretti, A.
Scientific Reports, 2020/02
Free full text
1050

Osteopathic Medical Care With and Without Osteopathic Manipulative Treatment in Patients With Chronic Low Back Pain: A Pain Registry-Based Study
Licciardone, J. C., Gatchel, R. J.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1051

Evidence and recommendations for the use of segmental motion testing for patients with LBP – A systematic review
Stolz, M., von Piekartz, H., Hall, T., Schindler, A., Ballenberger, N.
Musculoskeletal Science and Practice, 2020/02
Free full text
1052

Stretching exercises combined with ischemic compression in pectoralis minor muscle with latent trigger points: A single-blind, randomized, controlled pilot trial
Birinci, T., Mustafaoglu, R., Kaya Mutlu, E., Razak Ozdincler, A.
Complementary Therapies in Clinical Practice, 2020/02
Free full text
1053

Das „Wo“ und „Wie“ der Wissensbeschaffung – die systematische Literaturrecherche
(The “where“ and “how“ of knowledge generation - the systematic literature search)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1054

The Many Facets of Hypermobile Ehlers-Danlos Syndrome
Riley, B.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1055

Perceptions of the osteopathic profession in New York City’s Chinese Communities
Chin, J., Li, S., Yim, G., Zhou, Y. Q., Wan, P., Dube, E., Volokitin, M., Sahni, S., Terrell, M., Lomiguen, C.
Family Medicine and Community Health, 2020/01
Free full text
1056

Food Sensitivity Testing and Elimination Diets in the Management of Irritable Bowel Syndrome
Smith, E., Foxx-Orenstein, A., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1057

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1058

High-velocity, low-amplitude manipulation (HVLA) does not alter three-dimensional position of sacroiliac joint in healthy men: A quasi-experimental study
de Toledo, D., Kochem, F. B., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2020/01
1059

The labor study: Labor length and birth outcomes osteopathic research
Martingano, D., Mitrofanova, A., Kim, A. F., Ulfers, A., Mersch, M., Stevenson, R., Singh, S.
American Journal of Obstetrics & Gynecology, 2020/01
1060

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01
1061

A methodological review revealed that reporting of trials in manual therapy has not improved over time
Alvarez, G., Sola, I., Sitja-Rabert, M., Fort-Vanmeerhaeghe, A., Gich, I., Fernandez, C., Bonfill, X., Urrutia, G.
Journal of Clinical Epidemiology, 2020/01
1062

Tratamento manipulativo osteopático em Unidade de Terapia Intensiva Neonatal / Osteopathic manipulative treatment in a neonatal intensive care unit
(Osteopathic manipulative treatment in a neonatal intensive care unit)
dos Santos Varela, A. P. A., Yasojima, E. Y., Gonçalves, H. M. T., Silvestre, L. C., Tannus, L. O.
Brazilian Journals Publicações de Periódicos e Editora Ltda, 2020/01
1063

It is time to move beyond ‘body region silos’ to manage musculoskeletal pain: five actions to change clinical practice
Caneiro, J. P., Roos, E. M., Barton, C. J., Sullivan, K., Kent, P., Lin, I., Choong, P., Crossley, K. M., Hartvigsen, J., Smith, A. J., Sullivan, P.
British Journal of Sports Medicine, 2020/01
1064

HWS-Meersseman-Test bei CMD
(The Link between Temporomandibular Joint Position and Rotation in the Cervical Vertebrae in Patients with Temporomandibular Joint Dysfunction (TMD))
Seidl, G.
Unpublished MSc thesis, 2020/01
Free full text
1065

Determinants of health, health behaviours and demographic profile of patients attending an Australian university student-led osteopathy clinic
Vaughan, B., Fitzgerald, K., Fleischmann, M., Mulcahy, J.
Chiropractic & Manual Therapies, 2020/01
Free full text
1066

Isometric osteopathic manipulation influences on cervical ranges of motion and correlation with osteopathic palpatory diagnosis: A randomized trial
Niewiadomski, C., Bianco, R. J., Arnoux, P. J., Evin, M.
Complementary Therapies in Medicine, 2020/01
1067

Fitz-Hugh-Curtis Syndrome
Mersch, M., Martingano, D.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1068

Lateral Strain Patterns at the Sphenobasilar Synchondrosis
Burruano, M. P.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1069

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020
1070

A Comparative Study of the Heart as a Fulcrum in Relation to the Central Chain and the Ancient Wisdom of the Pervuvian Healers
Friesecke, D.
Unpublished D.O. thesis, 2019/5
Free full text
1071

Efficacy of Muscle Energy Technique as an adjunct with Mulligans Mobilization in adhesive Capsulitis of Shoulder
Jaiswal, N., Saketa, J., Rajsekhar, H.
International Journal of Physiotherapy, 2019/2
Free full text
1072

Efficacy of spinal extension exercise program versus muscle energy technique in treatment of chronic mechanical low back pain
Fahmy, E., Shaker, H., Ragab, W., Helmy, H., Gaber, M.
Egyptian Journal of Neurology, Psychiatry and Neurosurgery, 2019/12
Free full text
1073

Influence of Future Prescribers’ Personal and Clinical Experiences With Opioids on Plans to Treat Patients With Opioid Use Disorder
Mort, S. C., Díaz, S. R., Miller, C., Bowlby, M., Henderson, D., Beverly, E. A.
The Journal of the American Osteopathic Association, 2019/12
Free full text
1074

Influence of postoperative adhesions after caesarean section on chronic lower back pain – A pilot study of osteopathic manipulative treatment
Liedler, M., Woisetschläger, G.
European Journal of Osteopathic Research, 2019/12
Free full text
1075

Characteristics, Opportunities, and Challenges of Osteopathy (COCO) in the Perceptions of Osteopaths in Germany, Austria, and Switzerland: Protocol for a Comprehensive Mixed Methods Study
Porthun, J., Manschel, J.
JMIR Research Protocols, 2019/12
Free full text
1076

Forschungsinstitute
(Research institutes in Germany)
Newiger, C., Eichhorn, V.
Osteopathische Medizin, 2019/12
1077

Eine überlebenswichtige Warnung … interessiert?
(A vital warning... interested?)
Schleusener, R.
Osteopathische Medizin, 2019/12
1078

Self-directed learning and practice of Italian osteopathic students during summer break: a cross-sectional survey
D'Alessandro, G., Consorti, G., Cerritelli, F.
BMC Complementary and Alternative Medicine, 2019/12
Free full text
1079

Comparing the efficacy of first rib maitland mobilisation and muscle energy technique on pain, disability and head position sense in patients with chronic mechanical neck pain
Sachdeva, S., Yadav, J., Gulati, M.
Journal of Clinical and Diagnostic Research, 2019/12
Free full text
1080

Craniosacral therapy for chronic pain: a systematic review and meta-analysis of randomized controlled trials
Haller, H., Lauche, R., Sundberg, T., Dobos, G., Cramer, H.
BMC Musculoskeletal Disorders, 2019/12
Free full text
1081

Craniosacral system and primary respiration in Chinese medicine
(Краниосакральная система и первичное дыхание в китайской медицине)
Akhmetsafin, A. N.
Russian Osteopathic Journal, 2019/12
Free full text
1082

Justification of the use of osteopathic correction in the complex rehabilitation of patients with consolidated fractures of the large tubercle of the humerus
(Обоснование применения остеопатической коррекции в комплексной реабилитации больных с консолидированными переломами большого бугорка плечевой кости)
Bogachev, A. A., Kutuzov, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1083

The role of generalized muscule hyperfacilitation in pathogenesis and clinical picture of myofascial pain syndrome. Possible option of its correction
(Роль генерализованной мышечной гиперфасилитации в патогенезе и клинической картине миофасциального болевого синдрома. Возможный вариант её коррекции)
Boldin, A. V., Agasarov, L. G., Tardov, M. V., Bokova, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1084

Research on the effectiveness and safety of kinesiotaping in middle-aged and elderly military patients for reducing acute and chronic myofascial pain
(Исследование эффективности и безопасности кинезиотейпирования в коррекции острого и хронического миофасциального болевого синдрома у пациентов военного контингента средней и старшей возрастных групп)
Bunin, A. V.
Russian Osteopathic Journal, 2019/12
Free full text
1085

Possibilities of osteopathic correction of somatic dysfunctions in children with chronic adenoiditis
(Возможности остеопатической коррекции соматических дисфункций у детей с хроническим аденоидитом)
Chaiko, E. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2019/12
Free full text
1086

Correlation between certain rhythms of the body in osteopathic patients
(Корреляционные связи между некоторыми ритмами организма у пациентов врача-остеопата)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/12
Free full text
1087

Secondary effects and quality of life with chemotherapy: assessing the impact of an osteopathic treatment (multicentric randomized clinical trial
(Побочные эффекты и качество жизни пациентов при химиотерапии: оценка влияния остеопатической коррекции (многоцентровое рандомизированное клиническое исследование)
Favier, N., Guinet, A. G., Nageleisen, M., Ceccaldi, B., Pujade-Lauraine, E., LeFoll, C., Soudain-Pineau, M., Turlin, C., Stubbe, L.
Russian Osteopathic Journal, 2019/12
Free full text
1088

The role of the musculoskeletal system in maintaining postural balance: literature review
(Роль опорно-двигательного аппарата в поддержании постурального баланса: обзор литературы)
Kurnikova, A. A., Potekhina, Y. P., Filatov, A. A., Kalinina, E. A., Pervushkin, E. S.
Russian Osteopathic Journal, 2019/12
Free full text
1089

The Effect of Facial Effleurage on Acute Rhinosinusitis
Bradley, J. H., Weidman, C.
The Journal of the American Osteopathic Association, 2019/12
1090

Possibilities of using osteopathic correction in treatment of combined forms of infertility
(Возможности применения остеопатической коррекции в лечении сочетанной формы бесплодия)
Nenashkina, E. N.
Russian Osteopathic Journal, 2019/12
Free full text
1091

Epidemiological and clinical aspects of chronic pyelonephritis in pregnant women and osteopathic follow-up of pregnant women with chronic pyelonephritis
(Эпидемиологические и клинические аспекты хронического пиелонефрита у беременных и остеопатическое сопровождение беременных, страдающих хроническим пиелонефритом)
Nenashkina, E. N., Tregubova, E. S., Belash, V. O.
Russian Osteopathic Journal, 2019/12
Free full text
1092

Meditation and Empathy in Osteopathic Medical Students: A Longitudinal Randomized Controlled Trial
Krishnamachari, B., Ramya, P., Shermon, S., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2019/12
1093

Facial Effleurage Treatment Increases Serum TNFα Levels in Patients with Acute Rhinosinusitis
White, A., Weidman, C., Bradley, J. H.
The Journal of the American Osteopathic Association, 2019/12
1094

Osteopathic support of sportsmen during the annual training process
(Остеопатическое сопровождение спортсменов в годовом тренировочном процессе)
Yakupov, R. A., Safiullina, G. I., Safiullina, A. A., Burganov, E. R.
Russian Osteopathic Journal, 2019/12
Free full text
1095

The Role of Mental Imagery in Osteopathic Palpation: a qualitative study
Kraml, M. M., Besse, J.P.
European Journal of Osteopathic Research, 2019/11
Free full text
1096

Effectiveness of the muscle energy technique on respiratory muscle strength and endurance in patients with fibromyalgia
Uysal, S. C., Tuzun, E. H., Eker, L., Angin, E.
Journal of Back and Musculoskeletal Rehabilitation, 2019/11
Free full text
1097

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11
1098

Einfluss von Osteopathie auf die gesundheitsbezogene Lebensqualität von Frauen nach Sectio caesarea
(Influence of osteopathy on the health-related quality of life of women after caesarean section)
Rehak, M.
Unpublished MSc thesis, 2019/10
1099

Auswirkung der Osteopathie bei Postcholezystektomiebeschwerden auf Schmerz und gesundheitsbezogener Lebensqualität
(The impact of osteopathy on post-cholecystectomy complaints assessed by the parameters of pain and the health-related quality of life)
Noppinger, M. E.
Unpublished MSc thesis, 2019/10
Free full text
1100

Herzratenvariabilitätsanalyse in der Osteopathie und Manualmedizin
(Heart rate variability in manual medicine)
Klumpp, M.
Unpublished MSc thesis, 2019/10
Free full text
1101

Visceral osteopathic manipulative treatment reduces patient reported digestive toxicities induced by adjuvant chemotherapy in breast cancer: A randomized controlled clinical study
Lagrange, A., Decoux, D., Briot, N., Hennequin, A., Coudert, B., Desmoulins, I., Bertaut, A.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2019/10
1102

A.T. Still und der Methodismus. Einfluss des Methodismus auf A.T. Stills Entwicklung der osteopathischen Lehre und Praxis im Amerika des 19. Jahrhunderts
(A.T. Still and the Methodism)
Liem, T.
Osteopathische Medizin, 2019/10
1103

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10
1104

A comprehensive physical therapy evaluation for Male Chronic Pelvic Pain Syndrome: A case series exploring common findings
Archambault-Ezenwa, L., Markowski, A., Barral, J-P.
Journal of Bodywork and Movement Therapies, 2019/10
1105

Medical Students' Knowledge About Children With Disabilities, Special Education Laws, and Social Services: A Preliminary Scale Development and Pilot Study
Vitalone-Raccaro, N., Sheppard, M. E., Kaari, J. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1106

Osteopathie bei Spondylitis ankylosans (Morbus Bechterew)
(Osteopathy in ankylosing spondylitis (Bechterew's disease))
Gugganig, K.
Unpublished MSc thesis, 2019/10
Free full text
1107

Awareness of axial spondyloarthritis among chiropractors and osteopaths: findings from a UK Web-based survey
Yong, C. Y., Hamilton, J., Benepal, J., Griffiths, K., Clark, Z. E., Rush, A., Sengupta, R., Martindale, J., Gaffney, K.
Rheumatology Advances in Practice, 2019/10
Free full text
1108

Einfluss der osteopathischen Behandlung im Rahmen der stationären Anschlussheilbehandlung bei Patienten mit Zustand nach Hüft-TEP-Implantation. Randomisierte kontrollierte Studie.
(Influence of osteopathic treatment during post-hospital curative treatment in patients after total hip arthroplasty. A randomized controlled trial)
Behm, B., Mattern, E. R.
Unpublished D.O. thesis, 2019/10
1109

Toward a Theory of the Mechanism of High-Velocity, Low-Amplitude Technique: A Literature Review
Hennenhoefer, K., Schmidt, D.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1110

Rezidivierende Harnwegsinfekte und Reizblase
(Recurrent urinary tract infections and irritable bladder)
Kilian-von Hofe, K.
Osteopathische Medizin, 2019/09
1111

Developing teamwork skills in pre-registration osteopathy education: A qualitative pilot investigation
Vaughan, B., Grace, S., Yoxall, J.
International Journal of Osteopathic Medicine, 2019/09
1112

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09
1113

Osteopathic Approach for Lateral Knee Pain Caused by Iliotibial Band Friction Syndrome: A Case Report
Kostanjevec, J., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
1114

Balancierte Impakt-Tension – eine erweiterte osteopathische Technik
(Balanced Impact Tension - An advanced osteopathic technique)
Muntinga, E.
Osteopathische Medizin, 2019/09
1115

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09
1116

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text
1117

The effects of a 4-week barefoot exercise intervention on plantar pressure, impact, balance and pain in injured recreational runners: A pilot study
Rowlands, C., Plumb, M. S.
International Journal of Osteopathic Medicine, 2019/09
1118

Is visceral manipulation beneficial for patients with low back pain? A systematic review of the literature
Switters, Jacob Marten, Podar, Stefan, Perraton, Luke, Machotka, Zuzana
International Journal of Osteopathic Medicine, 2019/09
1119

Using the Multitheory Model to Predict Initiation and Sustenance of Physical Activity Behavior Among Osteopathic Medical Students
Nahar, V. K., Wilkerson, A. H., Stephens, P. M., Kim, R. W., Sharma, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1120

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1121

Influence of Osteopathic Medical Students’ Personal Health on Attitudes Toward Counseling Obese Pediatric Patients
Whipps, J., Mort, S. C., Beverly, E. A., Guseman, E. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1122

Efficacy of osteopathic treatment in patients with stable moderate-to-severe chronic obstructive pulmonary disease: a randomized controlled pilot study
Buscemi, A., Pennisi, V., Rapisarda, A., Pennisi, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2019/08
1123

Understanding Myalgic Encephalomyelitis/Chronic Fatigue Syndrome and the Emerging Osteopathic Approach: A Narrative Review
Larrimore, C., Ramnot, A., Jaghab, A., Sarduy, S., Guerrero, G., Troccoli, P., Hilton, K., Bested, A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1124

Effect of muscle energy technique on pain pressure threshold in sacroiliac joint dysfunction
Srivastava, S., U., Dhanesh K. K., Mittal, H.
International Journal of Research in Pharmaceutical Sciences, 2019/07
Free full text
1125

Differences in Function and Comorbidities Between Older Adult Users and Nonusers of Chiropractic and Osteopathic Manipulation: A Cross-sectional Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2019/07
1126

Results of osteopathic correction of patients with post-traumatic coccygodynia
(Результаты остеопатической коррекции у пациентов с посттравматической кокцигодинией)
Antonova, Y. V., Iskandarov, A. M., Mizonova, I. B.
Russian Osteopathic Journal, 2019/07
1127

La lumbalgia: La visión desde la osteopatía y medicina tradicional del Palenque San Basilio
(Low back pain: The vision of osteopathy and traditional medicine of Palenque San Basilio)
Ayala Ardila, D. P.
Unpublished MSc thesis, 2019/07
Free full text
1128

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text
1129

The influence of osteopathic correction on the rate of various rhythms of the body
(Влияние остеопатической коррекции на частоту различных ритмов организма)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
1130

Reflective practice enhances osteopathic clinical reasoning
McIntyre, C., Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2019/07
1131

Dependence of the joint configuration on the dynamic immobility fulcrum
(Зависимость конфигурации сустава от фулькрума динамичной неподвижности)
Kozlov, A. D., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
1132

Quantitative evaluation of slow fluctuations of the volume of liquids inside cranial cavity
(Количественная оценка медленных колебаний объема жидкой среды внутри черепа)
Moskalenko, Y. E., Kravchenko, T. I., Novozhilova, Y. V.
Russian Osteopathic Journal, 2019/07
1133

Randomized controlled study of the effectiveness of osteopathic manipulative correction for muscular torticollis due to birth injury
(Рандоминизированное контролируемое исследование эффективности остеопатической манипуляционной коррекции при мышечной кривошее вследствие родовой травмы)
Novikov, Y. O., Mokhov, D. E., Amigues, J.P., Musina, G. M., Shaiakhmetov, A. R.
Russian Osteopathic Journal, 2019/07
1134

Change of skin electrical activity during osteopathic correction with the use of biodynamical approach
(Изменение электрической активности кожи во время остеопатического воздействия с применением биодинамического подхода)
Novikov, Y. O., Shaiakhmetov, A. R., Musina, G. M.
Russian Osteopathic Journal, 2019/07
1135

Frequency of spinal anomalies in young and middle-aged patients with dorsopathy according to system analysis of roentgenograms
(Частота аномалий развития позвоночника у пациентов молодого и среднего возраста с дорсопатией по данным системного анализа рентгенограмм)
Orel, A. M., Malakhovsky, V. V., Semenova, O. K.
Russian Osteopathic Journal, 2019/07
1136

The concept of biotensegrity and its use in osteopathy
(Le concept de la biotenségrité et son utilisation en ostéopathie)
Tarento, M.
Russian Osteopathic Journal, 2019/07
1137

The influence of osteopathic correction on the viscoelastic characteristics of the lower leg muscles
(Влияние остеопатической коррекции на вязкоупругие характеристики мышц голени)
Timanin, E. M., Sydneva, N. S., Zakharova, A. A.
Russian Osteopathic Journal, 2019/07
1138

Specific Adjusting Technique
(Specific Adjusting Technique)
Lamb, Gez, Schabel, Kai
Osteopathische Medizin, 2019/06
1139

Refining the biopsychosocial model for musculoskeletal practice by introducing religion and spirituality dimensions into the clinical scenario
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/06
1140

Correlation between otitis media with effusion and cranial deformation in children
Orlando, M. P., Bonanno, M. A., Russo, F. Y., Ralli, M., Turchetta, R., Passali, F. M., Minni, A., Greco, A., De Vincentiis, M., Tattoli, M.
European Review for Medical and Pharmacological Sciences, 2019/06
Free full text
1141

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06
1142

Osteopathische Medizin: Versuch einer zeitgemäßen Definition
(Osteopathic medicine: Attempt at a contemporary definition)
Mayer, J., Pelz, H., Riedel, M.
Osteopathische Medizin, 2019/06
1143

The inter-rater reliability of the mobility tests of the cranial bones as assessed through manual therapy
Demers, K., Morin, C., Collette, L., DeMont, M. R.
Advances in Integrative Medicine, 2019/06
1144

A Study to Investigate the Effect of ‘Frontal Lift’ Osteopathic Manipulative Technique (OMT) in Patients with Chronic Sinusitis
Lintonbon, David
American Journal of Biomedical Science & Research, 2019/06
1145

¿La Manipulación Osteopática Mejora la Función Mecánica y Física y la Simetría Espinal en Golfistas?
(Does Osteopathic Manipulation Lead to Improvements in Physical and Muscle Mechanical Function and Spinal Symmetries in Golfers?)
Rojas-Valverde, D., Sánchez García, A., Sáez Ulloa, D., Gutiérrez-Vargas, R.
Kronos, 2019/06
Free full text
1146

Étude randomisée monocentrique évaluant l’efficacité de l’ostéopathie dans la prise en charge des douleurs chroniques après chirurgie mammaire en oncologie
(Osteopathy for chronic pain after breast cancer surgery: a monocentric randomised study)
Chvetzoff, G., Berthier, A., Blanc, E., Bourne Branchu, V., Millaret, A., Cropet, C., Pérol, D.
Bulletin du Cancer, 2019/06
1147

A systematic review of non-invasive manual therapies in the management of irritable bowel syndrome
Badenhorst, N.
Unpublished MSc thesis, 2019/06
1148

Effects of diaphragmatic myofascial release on gastroesophageal reflux disease: a preliminary randomized controlled trial
Martínez-Hurtado, I., Arguisuelas, M. D., Almela-Notari, P., Cortés, X., Barrasa-Shaw, A., Campos-González, J. C., Lisón, J. F.
Scientific Reports, 2019/05
Free full text
1149

A Comparative study on the Effectiveness of Muscle Energy Techniques and Maitland Mobilization Coupled with Ultrasound in Patients with Periarthritis of the Shoulder Joint
Devendran, M.
Unpublished MSc thesis, 2019/05
Free full text
1150

Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative pilot study of osteopathy and electrostimulation /biofeedback for pelvic floor
Bogner, D.
European Journal of Osteopathic Research, 2019/04
Free full text
1151

Osteopathic Manipulative Treatment in a Paediatric Patient with Oesophageal Atresia and Tracheo-Oesophageal Fistula
Barni, A., Zecchillo, D., Uberti, S., Ratti, S.
Gastroenterology, 2019/04
1152

The Impact of Spinal Manipulation on Migraine Pain and Disability: A Systematic Review and Meta-Analysis
Rist, P. M., Hernandez, A., Bernstein, C., Kowalski, M., Osypiuk, K., Vining, R., Long, C. R., Goertz, C., Song, R., Wayne, P. M.
Headache, 2019/04
Free full text
1153

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text
1154

The relationship between thoracic spine mobility and shoulder problems in a sample of surfers: a cross-sectional design
de Jong, S.
Unpublished MSc thesis, 2019/04
Free full text
1155

Allopathic supervision of osteopathic education: What support is needed?
James, S. J., Zakletskaia, L:
Osteopathic Family Physician, 2019/04
1156

Timing of oral feeding changes in premature infants who underwent osteopathic manipulative treatment
Vismara, L., Manzotti, A., Tarantino, A. G., Bianchi, G., Nonis, A., La Rocca, S., Lombardi, E., Lista, G., Agosti, M.
Complementary Therapies in Medicine, 2019/04
1157

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04
1158

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text
1159

Ernährungswissen von Osteopathinnen und Osteopathen
(Knowledge of Nutrition Issues among Osteopaths)
Putschögl, J.
Unpublished MSc thesis, 2019/03
Free full text
1160

Facteurs déterminants du processus décisionnel de la prise en charge du hallux valgus par les ostéopathes : une approche par la théorie du jugement social
(Determinants of the decision-making process in the management of hallux valgus by osteopaths: a social judgment theory approach)
Kaeppeli, C.
Unpublished MSc thesis, 2019/03
Free full text
1161

Die Rolle der mentalen Vorstellung in der Palpation von Osteopathen
(The role of mental imagery in osteopathic palpation)
Kraml, M.
Unpublished MSc thesis, 2019/03
Free full text
1162

Audit über das diagnostische Verfahren und Behandlungsstrategie bei Zervikalgien in einer Schweizer Gemeinschaftspraxis für Osteopathie
(Audit on the diagnostic procedure and treatment strategy for cervicalgia in a Swiss group practice for osteopathy)
Madjura, D.
Unpublished MSc thesis, 2019/03
Free full text
1163

Exploration des méthodes d’identification et des stratégies de gestion du stress et de l’anxiété des patients par l’ostéopathe : étude qualitative
(Exploring methods of identification and strategies for management of patient stress and anxiety by the osteopath: a qualitative study)
Piaget, B.
Unpublished MSc thesis, 2019/03
Free full text
1164

Dans quelle mesure la prise en charge ostéopathique des gonalgies chez les adolescents et les adultes est en concordance avec les bonnes pratiques ? : un sondage
(To what extent is osteopathic management of gonalgia in adolescents and adults in line with good practice? A survey)
Rossier, F.
Unpublished MSc thesis, 2019/03
Free full text
1165

Le modèle bio-psycho-social dans l’enseignement de l’ostéopathie : projet de recherche
(The bio-psycho-social model in osteopathic education: a research project)
Simonin, A.
Unpublished MSc thesis, 2019/03
Free full text
1166

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text
1167

Mechanischer Risikofaktor für Otitis media?
(Mechanical risk factor in otitis media?)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
Free full text
1168

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
1169

Magnetic Resonance Imaging Parameters Selected for Optimal Visualization of the Occipitoatlantal Interspace
Hallgren, R. C., Rowan, J. J.
The Journal of the American Osteopathic Association, 2019/03
Free full text
1170

Subokzipitalregion: Ergebnisse empirischer Arbeiten bezüglich lokaler Interventionen
(Suboccipital region: Findings of empirical studies regarding local interventions - A narrative review)
Reinhardt, R.
Osteopathische Medizin, 2019/03
1171

Ist Asymmetrie Dysfunktion?
(Is asymmetry dysfunction?)
Robert, V.
Osteopathische Medizin, 2019/03
1172

Die Kinderosteopathie aus Sicht der Kinderärzte. Eine qualitative Interview-Studie
(Pediatric osteopathy: What registered pediatricians think about it - A qualitative interview study)
Seidner, K., Belz, S.
Osteopathische Medizin, 2019/03
1173

Improvements in multi-dimensional measures of dysfunctional breathing in asthma patients after a combined manual therapy and breathing retraining protocol: a case series report
Courtney, R., Biland, G., Ryan, A., Grace, S., Gordge, R.
International Journal of Osteopathic Medicine, 2019/03
1174

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text
1175

Effects of myofascial release in erector spinae myoelectric activity and lumbar spine kinematics in non-specific chronic low back pain: Randomized controlled trial
Arguisuelas, M. D., Lison, J. F., Domenech-Fernandez, J., Martinez-Hurtado, I., Salvador Coloma, P., Sanchez-Zuriaga, D.
Clinical Biomechanics, 2019/03
1176

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text
1177

Effects of Practicing Osteopathic Manipulative Treatment (OMT) on Hand Function
Barnum, I. F. O., Chang, M. E., Patterson, R. M., Surve, S.
UNTHSC Scholarly Repository, 2019/03
1178

Reliabilitätsstudie des Befunds nach dem Mechanical Link
(Reliability study of the findings according to the mechanical link: Methodological study on the assessment of findings of the bones and joints of the extremities by the mechanical link method)
Hafen, G. I.
Osteopathische Medizin, 2019/03
1179

La connaissance et l’utilisation de l’ostéopathie par la population générale en suisse romande : une étude en ligne
(Knowledge and use of osteopathy by the general population in French-speaking Switzerland: an online study)
Emery, A.
Unpublished MSc thesis, 2019/03
Free full text
1180

Making sense of cranial osteopathy : an interpretative phenomenological analysis.
Banton, A
Unpublished PhD thesis, 2019/02
1181

Im Gespräch mit … Noori Mitha
(In dialog with ... Noori Mitha)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
1182

Fascial manipulation vs. standard physical therapy practice for low back pain diagnoses: A pragmatic study
Harper, B., Steinbeck, L., Aron, A.
Journal of Bodywork and Movement Therapies, 2019/01
1183

The Italian Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross sectional survey
Cerritelli, F., van Dun, P. L. S., Esteves, J. E., Consorti, G., Sciomachen, P., Lacorte, E., Vanacore, N.
PLoS One, 2019/01
Free full text
1184

Women’s experiences of osteopathic care whilst living with endometriosis
Waugh, M. D.
Unpublished MSc thesis, 2019/01
Free full text
1185

Osteopathic Physical Exam Findings in Chronic Hepatitis C: A Case Study
Chin, J., Francis, M., Lavalliere, J. M., Lomiguen, C. M.
Cureus, 2019/01
Free full text
1186

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1187

Die Zukunft der Osteopathie liegt in der Aktivität
(The future of osteopathy belongs to activity)
Levin, P.
Osteopathische Medizin, 2018/12
1188

Professor Stephen Tyreman 1952 – 2018
Vogel, S.
International Journal of Osteopathic Medicine, 2018/12
Free full text
1189

Der suprachiasmatische Nukleus und seine klinische Bedeutung
(The suprachiasmatic nucleus and its clinical significance)
Liem, T., Havel, M.
Osteopathische Medizin, 2018/12
1190

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12
1191

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text
1192

Challenges and opportunities for Australian osteopathy: A qualitative study of the perceptions of registered osteopaths
Blaich, R., Steel, A., Clark, D., Adams, J.
International Journal of Osteopathic Medicine, 2018/12
1193

Therapieblockaden durch Zahn- und Kieferstörfelder: Umgang mit Störfeldern aus Sicht der täglichen osteopathischen Praxis
(Therapy blockades due to interference fields of teeth and jawbone: Dealing with interference fields from the point of view of daily osteopathic practice)
Von Gimborn, G.
Osteopathische Medizin, 2018/12
1194

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text
1195

An overview of osteopathy graduates' perceived preparedness at transition from educational environment to clinic environment one year after graduation: a cross sectional study
Luciani, E., Consorti, G., van Dun, P. L. S., Merdy, O., Lunghi, C., Petracca, M., Esteves, J. E., Cerritelli, F.
BMC Medical Education, 2018/12
Free full text
1196

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1197

Can lateral epicondylitis be relief by osteopathic treatments targeting tensions from the thoracic region? Results of a case study
Brisson-Larouche, A., Kassab, G., Wehbe, W.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1198

The inter-rater reliability of the frontal, temporal, parietal bones, and the spheno-occipital synchrondrosis mobility test as assessed through manual therapy
Demers, K., Morin, C., Collette, L., DeMont, R.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1199

Effect of global osteopathic treatment on functional mobility in the parkinsonian patient: A quasi-experimental study
Devantéry, K., Bouchard, J.C.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1200

Fundamental study of a visceral pericardial osteopathic protocol on heart physiology
Fatisson, J., Mullie, Y., Oswald, V., Gauthier, M., Lalonde, F., Comtois, A. S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1201

Quality of randomized control trials and pilot trials in osteopathy according to the CONSORT checklist
Morin, C., Maclure, M., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
1202

The beliefs and attitudes of UK registered osteopaths towards chronic pain and the management of chronic pain sufferers - A cross-sectional questionnaire based survey
Macdonald, R. J. D., Vaucher, P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/12
Free full text
1203

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text
1204

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text
1205

Die Identität der Osteopathie in Deutschland – Spurensuche nach einem beruflichen Selbstverständnis
(The identity of osteopathy in Germany - Search for traces of a professional self-conception)
Ehmke, B.
Osteopathische Medizin, 2018/12
1206

Effektstärke: Ein Parameter für osteopathische Studien?
Effect size: A parameter for osteopathic studies?
Hartwig, B. J., Bock, I. S.
Osteopathische Medizin, 2018/12
1207

Moving Down the Road Less Traveled: The GROUPIE Program at Touro California
Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text
1208

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text
1209

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text
1210

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
The Journal of the American Osteopathic Association, 2018/11
1211

Osteopathy and patients who have experienced sexual violence: management, treatment and self-care
Michael-Anna, E.
Unpublished MSc thesis, 2018/11
Free full text
1212

The Influence of Medical School Debt on Specialty Choice: An Analysis of Colleges of Osteopathic Medicine
Dyches, R. P., Speicher, M. R.
The Journal of the American Osteopathic Association, 2018/11
1213

Regulatory and practice issues related to the acquisition of practical osteopathic skills for paediatric care
Evans, B.
Unpublished MSc thesis, 2018/11
Free full text
1214

Structure and Function in Medical Education: Trend Analysis of Osteopathic Medical Student Emotional Intelligence (EI) Suggests Curricular Modifications May Improve Functional Traits
Singer-Chang, G., Dong, F., Nevins, N., Seffinger, M., Blumer, J., Darmani, N., Helf, S.
The Journal of the American Osteopathic Association, 2018/11
1215

An Osteopathic Approach to Leveraging Community Support for Prevention and Management of Chronic Disease in Rural and Appalachian Virginia
Slaymaker, K. A., Meacham, S., Horn, R., Goessl, C., Meisha, D., Mahaney, J.
The Journal of the American Osteopathic Association, 2018/11
1216

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1217

Professional trust in osteopathy: a theory for educational practice
Mackay Tumber, L.
Unpublished Dissertation, 2018/10
Free full text
1218

Outpatient satisfaction with osteopathic manipulative treatment in a hospital center: A survey
Tramontano, M., Cinnera, A. M., Petracca, M., Gaeta, A., Tamburella, F., Audouard, M., Caltagirone, C.
Alternative Therapies in Health and Medicine, 2018/10
1219

Is mulligan’s sustained natural apophyseal glides (Snags) or muscle energy technique is effective in the non-surgical management of cervicogenic headache? a two-group pretest-posttest randomized controlled trial
Veena Kirthika, S., Padmanabhan, K., Sudhakar, Selvaraj, Vijaya Kumar, M.
Asian Journal of Pharmaceutical and Clinical Research, 2018/10
Free full text
1220

Die osteopathische Behandlung aus PatientInnensicht – Interviews mit PatientInnen über ihre subjektive Befindlichkeit während osteopathischen Behandlungen
(The osteopathic treatment from the patient's point of view - Interviews with patients about their subjective well-being during osteopathic treatments)
Hocher, J.
Unpublished MSc thesis, 2018/10
Free full text
1221

Changes on cervical range of motion in migraine patients after a strain counterstrain treatment
Giustino, V., Contrò, V., Brusa, J., Proia, P., Messina, G., Brighina, F.
The Journal of Headache and Pain, 2018/10
1222

Die Rolle der Eltern in der osteopathischen Säuglingsbehandlung innerhalb der ersten drei Lebensmonate aus Sicht von Eltern und OsteopathInnen
(The Role of the Parents in Osteopathic Care of Infants within the First Three Months of Life from the Parents’ and Practitioners’ Perspectives)
Bechinie, C.
Unpublished MSc thesis, 2018/10
Free full text
1223

Health literacy across all year levels of a cohort of Australian osteopathy students
Mulcahy, J., Vaughan, B.
Quality of Life Research, 2018/10
1224

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10
1225

Möglicher Erfolg einer individualisierten osteopathischen Behandlung für die Lebensqualität und das Angstbefinden bei einer Patientin mit einer chronischen Lungensarkoidose.
(Possible success of an individualized osteopathic treatment regarding the quality of life and the state of anxiety of a patient with a chronic lung sarcoidosis)
Origer, S.
Unpublished MSc thesis, 2018/10
Free full text
1226

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text
1227

The One Health Initiative as a Basis for Research Development in the Department of Pharmacology at Midwestern University
Prozialeck, W. C., Edwards, J. R.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1228

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1229

It depends on how things are to you
Vogel, S.
International Journal of Osteopathic Medicine, 2018/09
Free full text
1230

The Immediate Effect of Therapeutic Touch and Deep Touch Pressure on Range of Motion, Interoceptive Accuracy and Heart Rate Variability: A Randomized Controlled Trial With Moderation Analysis
Edwards, D. J., Young, H., Johnston, R.
Frontiers in Integrative Neuroscience, 2018/09
Free full text
1231

Subokzipitalregion: neurologische und vaskuläre Anatomie und Varianten
(Suboccipital region: neurological and vascular anatomy and variants)
Reinhardt, R.
Osteopathische Medizin, 2018/09
1232

Effect of gong’s mobilisation versus muscle energy technique on pain and functional ability of shoulder in phase II adhesive capsulitis
Gopinath, Y., Seenivasan, S. K., Veeraraghavan, S. N. C., Viswanathan, R., Govindaraj, M. K.
Journal of Clinical and Diagnostic Research, 2018/09
1233

Primary care physicians' attitude and reported prescribing behavior for chronic low back pain: An exploratory cross-sectional study
Rodondi, P. Y., Dubois, J., Bill, A. S., Koutaissoff, D., Ros, J., Aveni, E., Pasquier, J., Herzig, L., Decosterd, I., Burnand, B.
PLoS One, 2018/09
Free full text
1234

The role of osteopathy in the Swiss primary health care system: a practice review
Vaucher, P., Macdonald, R. J. D., Carnes, D.
BMJ Open, 2018/09
Free full text
1235

Effects of manual therapy on the diaphragm in asthmatic patients: A randomized pilot study
Leonés-Macías, E., Torres-Sánchez, I., Cabrera-Martos, I., Ortiz-Rubio, A., López-López, L., Valenza, Marie C.
International Journal of Osteopathic Medicine, 2018/09
1236

Preparing Osteopathic Students for the Single Graduate Medical Education Accreditation System: Evaluating Factors for Match Success in Emergency Medicine
Stobart-Gallagher, M., O', Connell, A.
Western Journal of Emergency Medicine, 2018/09
Free full text
1237

Is digital image correlation able to detect any mechanical effect of cranial osteopathic manipulation? – A preliminary study
Pellet, M., Chenel, A., Behr, M., Thollon, L.
International Journal of Osteopathic Medicine, 2018/09
1238

History of Research at Midwestern University/Chicago College of Osteopathic Medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1239

Ernährungswissen: Integrativer Bestandteil der Osteopathie in Deutschland?
(Nutritional Knowledge: An integrative part of osteopathy in Germany?)
Nier, R.
Unpublished MSc thesis, 2018/09
Free full text
1240

Investigating practitioners' perceptions of the role of spirituality in osteopathic practice using Interpretative Phenomenological Analysis
Bacon, S. W., Roe, C. A.
International Journal of Osteopathic Medicine, 2018/09
1241

University College of Osteopathy students' attitudes towards psychosocial risk factors and non-specific low back pain: A qualitative study
Delion, T. P. E., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2018/09
1242

Die Ausübung der Gesundheitsfürsorge aus Patienten- und Therapeutensicht – eine Grounded-Theory-Analyse
(The health care practice from a patient's and practitioner's perspective - A grounded theory analysis)
Günther, F., Belz, S.
Osteopathische Medizin, 2018/09
1243

Diabetes Fellowship in Primary Care: A Survey of Graduates
Healy, A. M., Tanenberg, R. J., Schwartz, F. L., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1244

Comparative Efficiency of Muscle Energy Technique and Static Stretching in Enhancing Triceps Surae Flexibility
Kumar, G. M., Rajalaxmi, V., Nathan, C. V. S., Ramachandran, S., Kirthika, V., Sudhakar, S., Padmanabhan, K., Yuvarani, G.
Journal of Clinical and Diagnostic Research, 2018/08
Free full text
1245

Evaluating the effectiveness of teaching osteopathy in a combined didactics setting
Eilerman, A., Keller, M. E., Hixson, D., II, Gupta
Osteopathic Family Physician, 2018/08
1246

Resident Duty Hour Restrictions: The Implications Behind the New Data Ahead of the Single Accreditation System
Berry, A. C., McClain, E. K.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1247

Die Kunst des Heilens: Wie man „Gesundheit findet“
(The art of healing: How to 'find health')
Lever, R.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07
1248

Treatment of bilateral dyshidrotic eczema with drugs versus nutritional and osteopathic treatment
Aceranti, A., Vernocchi, S.
Italian Journal of Medicine, 2018/07
Free full text
1249

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07
1250

Use of complementary health approaches at military treatment facilities, active component, U.S. Armed Forces, 2010-2015
Williams, V. F., Clark, L. L., McNellis, M. G.
Medical Surveillance Monthly Report, 2018/07
1251

Behavioural activation and inhibition systems in relation to pain intensity and duration in a large chronic musculoskeletal pain sample
Sanson, N.
Unpublished MSc thesis, 2018/07
Free full text
1252

Osteopathic Manipulative Therapy Potentiates Motor Cortical Plasticity
Ponzo, V., Cinnera, A. M., Mommo, F., Caltagirone, C., Koch, G., Tramontano, M.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1253

The immediate effects of two manual therapy techniques on ankle musculoarticular stiffness and dorsiflexion range of motion in people with chronic ankle rigidity: A randomized clinical trial
Hidalgo, B., Hall, T., Berwart, M., Biernaux, E., Detrembleur, C.
Journal of Back and Musculoskeletal Rehabilitation, 2018/06
1254

The attitudes and beliefs of UK osteopaths towards the management of low back pain: A cross-sectional study
Bar-Zaccay, A., Bailey, D.
International Journal of Osteopathic Medicine, 2018/06
1255

The use of osteopathic manipulative medicine in the treatment of headaches for a patient with subdural hematomas in the setting of traumatic brain injury
Bonthala, S., Falco, C.
The Journal of Head Trauma Rehabilitation, 2018/06
1256

Clinical reasoning in osteopathy: Experiences of novice and experienced practitioners
King, L., Kremser, S., Deam, P., Henry, J., Reid, D., Orrock, P., Grace, S.
International Journal of Osteopathic Medicine, 2018/06
1257

Osteopathic clinical reasoning: An ethnographic study of perceptual diagnostic judgments, and metacognition
McIntyre, C, Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/06
1258

Reducing Health Disparities: Understanding the Unintended Effects of Health Care Professional and Patient Characteristics on Treatment
Nazione, S., Nazione, A.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1259

An exploration of osteopaths' views and experiences regarding the identification of, and provision of advice for, urinary incontinence in women: A qualitative study using framework analysis
Robinson, M. E., Ford, S. L., Goodman, L. B.
International Journal of Osteopathic Medicine, 2018/06
1260

Evidence, alternative facts and narrative: A personal reflection on person-centred care and the role of stories in healthcare
Tyreman, S.
International Journal of Osteopathic Medicine, 2018/06
Free full text
1261

Review zur Bedeutung der Schädelbasis in der Osteopathie
(Review on the importance of the cranial base in osteopathy)
Liem, T.
Osteopathische Medizin, 2018/05
1262

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05
1263

Subokzipitalregion: Entwicklung, Muskulatur und myodurale Brücken
(Suboccipital region: Development, musculature and myoduric bridges)
Reinhardt, R.
Osteopathische Medizin, 2018/05
1264

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05
1265

Efficacy of Osteopathic Manipulative Treatment in the Patient of Chronic Rhinosinusitis: A Case Report
Baisakhiya, N.
An International Journal Clinical Rhinology, 2018/05
1266

Cervical HVLA Used as Single Intervention Improves Motion and Strength
Zamora, S., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1267

Las cadenas fisiológicas en la medicina osteopática
(Physiological chains in osteopathic medicine)
Amado Suárez, M. C.
Unpublished MSc thesis, 2018/05
Free full text
1268

The perceptions and experiences of osteopathic treatment among cancer patients in palliative care: a qualitative study
Steel, A., Tricou, C., Monsarrat, T., Ruer, M., Deslandes, C., Sisoix, C., Filbet, M.
Supportive Care in Cancer, 2018/05
1269

Toolkit to improve provider adherence to metabolic monitoring of atypical antipsychotics for youths
Carpenter, L.
Unpublished MSc thesis, 2018/05
Free full text
1270

Knieschmerz und fazilitierte Positionierung in Anlehnung an L.H. Jones
(Knee pain and facilitated positioning in the style of L.H. Jones)
Heidrich, M., Buchmann, J., Röper-Krejza, B.
Osteopathische Medizin, 2018/05
1271

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1272

How type and number of training sessions influence the reliability of palpation
Lavazza, C., Milano, V., Abenavoli, A., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2018/04
1273

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04
1274

The immediate effect of osteopathic cervical spine mobilization on median nerve mechanosensitivity: A triple-blind, randomized, placebo-controlled trial
Whelan, G., Johnston, R., Millward, C., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2018/04
1275

IGeL-Monitor. Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text
1276

Complaints about chiropractors, osteopaths, and physiotherapists: A retrospective cohort study of health, performance, and conduct concerns
Ryan, A. T., Too, L. S., Bismark, M. M.
Chiropractic & Manual Therapies, 2018/04
Free full text
1277

An investigation of attitudes and underlying beliefs toward low back pain among osteopathy students using the Back Pain Attitudes Questionnaire (Back-PAQ)
Hilbink, H.
Unpublished MSc thesis, 2018/04
Free full text
1278

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1279

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1280

Shaping conservative spinal services with the Spine Tango Registry
Morris, S., Booth, J.
European spine journal, 2018/03
1281

Intuitive Beurteilung im Kontext des Clinical Reasoning in der Osteopathie
(Intuitive assessment in the context of clinical reasoning in osteopathy)
Liem, T.
Osteopathische Medizin, 2018/03
1282

The Safety of Osteopathic Manipulative Treatment (OMT)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1283

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1284

Der achtsame A.T. Still
(The mindful A.T. Still)
Schötta, M.
Unpublished MSc thesis, 2018/03
Free full text
1285

‘I just don't have the tools’ - Italian osteopaths' attitudes and beliefs about the management of patients with chronic pain: A qualitative study
Formica, A., Thomson, O. P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/03
Free full text
1286

“Der schiefe Kopf“ Befundungs- und Behandlungsprozess bei Säuglingen mit Plagiozephalie mittels Experteninterviews
(“The Oblique Head“ Follow-Up and Treatment Process for Infants with Orthesis by Interview of Experts)
Michaelis, C.
Unpublished MSc thesis, 2018/03
Free full text
1287

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text
1288

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text
1289

Pre-entry qualifications as predictors of success in first year osteopathic education
Palfreyman, S., Mercier, J., Friedlander, T.
International Journal of Osteopathic Medicine, 2018/03
1290

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03
1291

Pilotstudie über den Einfluss der osteopathischen Behandlung des Mesenteriums auf das Atemvolumen
(Pilot study on the influence of the treatment of the mesentery on the respiratory volume)
Muigg, E.
Unpublished MSc thesis, 2018/03
Free full text
1292

Core competencies in osteopathy: Italian register of osteopaths proposal
Sciomachen, P., Arienti, C., Bergna, A., Castagna, C., Consorti, G., Lotti, A., Lunghi, C., Tramontano, M., Longobardi, M.
International Journal of Osteopathic Medicine, 2018/03
Free full text
1293

Physician-Mentored Patient Rounds to Observe and Assess Entrustable Professional Activities 1 and 2 in Preclinical Medical Students
Chamberlain, N. R., Sexton, P. S., Hardee, M. R., Baer, R. W.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1294

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text
1295

Einfluss postoperativer Adhäsionen nach Sektio auf chronischen Low Back Pain - eine Pilotstudie
(Influence of postoperative adhesion after caesarean section on chronic lower back pain - a pilot study)
Liedler, M.
Unpublished MSc thesis, 2018/02
Free full text
1296

Osteopathische intrauterine Behandlung einer kongenitalen Lungenzyste
(Osteopathic intrauterine treatment of a congenital lung cyst)
Urbanek, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
1297

Patienteninfo: Fluor vaginalis, Vaginitis, Vulvitis, Kolpitis
(Patient information: Fluor vaginalis, vaginitis, vulvitis, colpitis)
Urbanek, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
1298

OMT May Be Helpful in the Management of Benign Paroxysmal Positional Vertigo
Tegeler, L., Blumer, J.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1299

An evaluation of osteopathic treatment on psychological outcomes with patients suffering from chronic pain: A prospective observational cohort study collected through a health and well-being academy
Edwards, D. J., Toutt, C.
Health Psychology Open, 2018/01
Free full text
1300

The Validity and Reliability of Provocation Tests in the Diagnosis of Sacroiliac Joint Dysfunction
Telli, H., Telli, S., Topal, M.
Pain Physician, 2018/01
Free full text
1301

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01
1302

More than words: an investigation into the patient experience of informed consent in osteopathy
Kilpin, C. A.M.
Unpublished MSc thesis, 2018/01
Free full text
1303

Medical Student Decision-Making: Standard Surgical Excision or Mohs Micrographic Surgery to Manage Basal Cell Carcinoma
Mancuso, C., Morris, J. B., Hernandez, N., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1304

Osteopathic Medical Education: Answering the Call
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1305

Osteopathy as an Aid to Treatment
Riedel, M.
Deutsches Ärzteblatt International, 2018/01
Free full text
1306

Level of evidence and quality of reports of cranial and visceral osteopathic treatment trials
Morin, C., Gaboury, I.
Global Advances in Health and Medicine, 2018
1307

Die Wirklichkeit der Osteopathie. Studie zu einer am Leib orientierten Anthropologie
(The reality of osteopathy. Study of an anthropology oriented to the lived body)
Kaiser, A.K.
Dissertation, 2018
1308

Palpatory and Ultrasound Assessment of Cervical Dysfunctions and the Effect of Cervical High-Velocity, Low-Amplitude (HVLA) Technique
Flaum, T. B., Mirza, A., Rusnack, F. M-A., Apoznanski, T. E., Munarova, A., Mazzie, J., Terzella, M. J., Yao, S. C.
The AAO Journal, 2017/12
Free full text
1309

A road to somewhere - endless debate about the nature of practice, the profession and how we should help patients
Vogel, S.
International Journal of Osteopathic Medicine, 2017/12
1310

Osteopathische Läsion – Teil 2: Definitionen und Terminologien
(Osteopathic lesion - Part 2: Definitions and terminologies)
Liem, T.
Osteopathische Medizin, 2017/12
1311

Braucht es einen Paradigmenwechsel in der osteopathischen Diagnostik und Therapie im kraniozervikalen Bereich?
(Is a paradigm shift required in osteopathic diagnosis and treatment in the craniocervical junction?)
Moser, U.
Osteopathische Medizin, 2017/12
1312

A Mokken analysis of the literacy in musculoskeletal problems questionnaire
Vaughan, B., Mulcahy, J., Coffey, A., Addinsall, L., Ryan, S., Fitzgerald, K.
Health and Quality of Life Outcomes, 2017/12
Free full text
1313

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12
1314

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text
1315

Developing a new approach to persistent pain management in osteopathic practice. Stage 1: A feasibility study for a group course
Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/12
1316

Investigation of four self-report instruments (FABT, TSK-HC, Back-PAQ, HC-PAIRS) to measure healthcare practitioners' attitudes and beliefs toward low back pain: Reliability, convergent validity and survey of New Zealand osteopaths and manipulative physiotherapists
Moran, R. W., Rushworth, W. M., Mason, J.
Musculoskeletal Science and Practice, 2017/12
1317

‘Sometimes I don't feel like an osteopath at all’- a qualitative study of final year osteopathy students' professional identities
Clarkson, H. J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2017/12
1318

Challenging Case of Parotitis: A Comprehensive Approach
Patel, P., Scott, S., Cunningham, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1319

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text
1320

Effects of Group Fitness Classes on Stress and Quality of Life of Medical Students
Yorks, D. M., Frothingham, C. A., Schuenke, M. D.
The Journal of the American Osteopathic Association, 2017/11
Free full text
1321

Current Clinical Status of Osteopathy: Study Based on Retrospective Evidences of Six Years, A Systemic Review
Ahmad, R.
Annual Research & Review in Biology, 2017/11
Free full text
1322

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2017/11
1323

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
The Journal of the American Osteopathic Association, 2017/11
1324

Osteopathic Manipulative Treatment Reduces Oxidative Stress Levels and Improves Relative Stiffness and Quality of Life in Parkinson Disease
Moriarty, S. A., Lu, V., Oommen, C., Bellavia, L. M., Lee, J. M., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
1325

Lymphatic Pump Treatment of Inflammation in Rat Adjuvant-Induced Arthritis
Volin, M., McAuliffe, R., Zanotti, B.
The Journal of the American Osteopathic Association, 2017/11
1326

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
1327

Vital Signs of U.S. Osteopathic Medical Residency Programs Pivoting to Single Accreditation Standards
Novak, T. S.
Unpublished PhD thesis, 2017/10
Free full text
1328

Assessment of Nutrition Knowledge and Attitudes in Preclinical Osteopathic Medical Students
Hargrove, E. J., Berryman, D. E., Yoder, J. M., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/10
Free full text
1329

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text
1330

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text
1331

Work related musculoskeletal injuries sustained by Australian osteopaths: qualitative analysis of effects on practitioner health, clinical practice, and patient care
McLeod, G. A., Annels, K., Cohen, J., Edwards, S., Hodgins, D., Vaughan, B.
Chiropractic & Manual Therapies, 2017/10
Free full text
1332

Kann die osteopathische Behandlung die Krankheitsaktivität bei Patienten mit rheumatoider Arthritis (RA) beeinflussen? Randomisierte kontrollierte Studie.
(The influence of osteopathic treatment in addition to the standard therapy on disease activity in patients with rheumatoid arthritis (RA). A randomized controlled trial)
Franzen, K., Ramscheidt, B.
Unpublished D.O. thesis, 2017/10
1333

Osteopathie bei gastroosophagealem Reflux mit Hiatushernie: Ein Fallbericht gemass der CARE-Leitlinie
(Osteopathic Treatment of Gastroesophageal Reflux Disease and Hiatal Hernia: A Case Report Following the CARE Guideline)
Rotter, G., Brinkhaus, B.
Complementary Medicine Research, 2017/10
Free full text
1334

Motilität und Mobilität der Lunge - in Korrelation zu Pneumonie
(Motility and mobility of the lungs and the correlation with pneumonia)
Grimmer, K.
Unpublished MSc thesis, 2017/10
Free full text
1335

Die Pathophysiologie von postoperativen peritonealen Adhäsionen - Osteopathie als Behandlungsmöglichkeit?
(The pathophysiology of postoperative peritoneal adhesions - Osteopathy as a treatment option?)
Lackner, I.
Unpublished MSc thesis, 2017/10
Free full text
1336

Chronologie von Krankheitsgeschehen, Therapie und Forschung in der Osteopathie
(Chronology of pathophysiology, therapy and research in osteopathy)
Levin, P.
Osteopathische Medizin, 2017/09
1337

The Use of Osteopathic Manual Therapy and Rehabilitation for Subacromial Impingement Syndrome: A Case Report
Bennett, S., Macfarlane, C., Vaughan, B.
Explore (NY), 2017/09
1338

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
1339

Effects of Cervical High-Velocity Low-Amplitude Techniques on Range of Motion, Strength Performance, and Cardiovascular Outcomes: A Review
Galindez-Ibarbengoetxea, X., Setuain, I., Andersen, L. L., Ramírez-Velez, R., González-Izal, M., Jauregi, A., Izquierdo, M.
The Journal of Alternative and Complementary Medicine, 2017/09
1340

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
1341

Interet clinique du traitement osteopathique chez les patientes ayant une endometriose colorectale : classification fondee sur les symptomes et la qualite de vie.
(Impact of osteopathic manipulative therapy in patient with deep colorectal endometriosis: A classification based on symptoms and quality of life)
Darai, C., Bendifallah, S., Foulot, H., Ballester, M., Chabbert-Buffet, N., Darai, E.
Gynecologie, Obstetrique, Fertilite & Senologie, 2017/09
1342

Entzündlicher Rückenschmerz – sind Warnsignallisten verlässlich?
(Inflammatory back pain - Are lists of warning signals reliable?)
Polivka, J. S.
Osteopathische Medizin, 2017/09
1343

Osteopathic approach to treating a patient with congenital infantile torticollis reveals unusual presentation of absence of concomitant cranial base strain pattern: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/09
1344

Patienteninfo: Loslassen, ruhig werden, Raum schaffen mit Yoga
(Patient information: Let go, calm down, create space through the use of yoga)
Storm, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
1345

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text
1346

Osteopathische Behandlung bei Coxarthrose
(Osteopathic Treatment of Patients with Coxarthrosis: A Randomised Controlled Trial)
Vögele, T.
Unpublished MSc thesis, 2017/09
Free full text
1347

Fuß- und Beinachsenentwicklung vom Säugling bis zum Erwachsenen
(Development of the feet and leg axis from infant to adult)
Halasz, C.
Osteopathische Medizin, 2017/09
Free full text
1348

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text
1349

Sensitivity for palpating lumbopelvic soft- tissues and bony landmarks and its associated factors: A single-blinded diagnostic accuracy study
Ferreira, A. P. A., Póvoa, L. C., Zanier, J. F. C., Machado, D. C., Ferreira, A. S.
Journal of Back and Musculoskeletal Rehabilitation, 2017/08
1350

Fundamentals for an Osteopathic Obesity Designed Study: The Effects of Education on Osteopathic Medical Students' Attitudes Regarding Obesity
Gayer, G. G., Weiss, J., Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text
1351

In Reply to Buser and to Shannon
Cummings, M.
Academic Medicine, 2017/08
Free full text
1352

Diagnostic reliability of osteopathic tests: A systematic review
Basile, F., Scionti, R., Petracca, M.
International Journal of Osteopathic Medicine, 2017/08
1353

Corrigendum to “Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research“ [Musculoskelet. Sci. Pract. 27 165-175]
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/08
1354

Effect of Continuous Touch on Brain Functional Connectivity Is Modified by the Operator's Tactile Attention
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Frontiers in Human Neuroscience, 2017/07
Free full text
1355

Meeting ACGME Standards Under a Unified Accreditation System: Challenges for Osteopathic Graduate Medical Education Programs
Cummings, M.
Academic Medicine, 2017/07
Free full text
1356

Interexaminer reliability study of a standardized myofascial diagnostic technique of the superior thoracic inlet
Hutchinson, D., Hines, S., Vijayaraghavan, N., Sammond, A., Metzler-Wilson, K., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2017/07
1357

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
1358

Update zur Liquorforschung und Drainage des Gehirns
Update on cerebrospinal fluid research and cerebral drainage
Liem, T.
Osteopathische Medizin, 2017/06
1359

(Osteopathic approaches for endometriosis)
Ott, S.
Osteopathische Medizin, 2017/06
1360

Efficacy of an eccentric osteopathic manipulation treatment in somatic tinnitus
Goyal, M., Sharma, S., Baisakhiya, N., Goyal, K.
Indian Journal of Otology, 2017/06
1361

Wirkungen der Osteopathie im psychischen Bereich – eine systematische Literaturübersicht
(Effects of osteopathy in the psychological field - a systematic literature review)
Perstling, A., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
1362

Schwindel bei Tubenkatarrh nach Otitis media
(Vertigo in tubal catarrh after otitis media)
Schneider, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
1363

Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment
Licciardone, J. C.
Musculoskeletal Science and Practice, 2017/06
1364

Reply to the letter to the editor: 'Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment'
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/06
1365

Factors influencing osteopathic medical students' intent to work with underserved populations: Implications for curriculum enhancement
Jacobs, R. J., Kane, M. N., Wallace, E. M., Rana, A.f M., Iqbal, H., Rana, Z.
International Journal of Osteopathic Medicine, 2017/06
1366

A pilot study to develop a tool for the assessment of students' clinical record keeping
Moore, K., Vaughan, B., Cox, A.
International Journal of Osteopathic Medicine, 2017/06
1367

A systematic review of randomised controlled trials using Acceptance and commitment therapy as an intervention in the management of non-malignant, chronic pain in adults
Simpson, P. A., Mars, T., Esteves, J. E.
International Journal of Osteopathic Medicine, 2017/06
1368

‘Talking a different language’: a qualitative study of chronic low back pain patients' interpretation of the language used by student osteopaths
Thomson, O. P., Collyer, K.
International Journal of Osteopathic Medicine, 2017/06
1369

Toucher pour soigner: le toucheur traditionnel, le médecin et l'ostéopathe: un nourrisson entre de bonnes mains
(The healing touch: the traditional healer, the physician and the osteopath: an infant in good hands)
Le Dû, M.
Unpublished PhD thesis, 2017/05
Free full text
1370

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text
1371

Validitäts- und Interrater-Reliabilitätsstudie des Auskultationstests der A. Carotis in der Osteopathie
(Validity and Inter-rater Reliability Study of the Auscultation Test of the Carotid Artery in Osteopathy)
Schaffhauser, S. M.
Unpublished MSc thesis, 2017/05
Free full text
1372

Osteopathic manipulation of the ankle improves spinal flexibility in elite alpine skiers: a pilot study
Parisio, C., Vismara, L., Micotti, V., Cimolin, V., Aprile, D., Cavigioli, M., Panzeri, A., Manzotti, A., Galli, M., Capodaglio, P.
Gazzetta Medica Italiana Archivio Per Le Scienze Mediche, 2017/05
1373

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text
1374

An Osteopathic Approach to Chronic Pain Management
Jerome, J. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text
1375

Addition of Osteopathic Visceral Manipulation to OMT for Low Back Pain Decreases Pain and Increases Quality of Life
King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
1376

Residency Program Directors' Interview Methods and Satisfaction With Resident Selection Across Multiple Specialties
VanOrder, T., Robbins, W., Zemper, E.
The Journal of the American Osteopathic Association, 2017/04
Free full text
1377

Attitudes of Family Medicine Program Directors Toward Osteopathic Residents Under the Single Accreditation System
Hempstead, L. K., Shaffer, T. D., Williams, K. B., Arnold, L. C.
The Journal of the American Osteopathic Association, 2017/04
Free full text
1378

Preliminary evidence of Regional Interdependent Inhibition, using a 'Diaphragm Release' to specifically induce an immediate hypoalgesic effect in the cervical spine
McCoss, C. A., Johnston, R., Edwards, D. J., Millward, C.
Journal of Bodywork and Movement Therapies, 2017/04
1379

Ein Leben mit Arthrogryposis multiplex congenita (ACM)
(Living with arthrogryposis multiplex congenita (AMC))
Seger, G.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
1380

Non-pharmacological therapies for primary open angle glaucoma: A quasi-experimental pilot study
Pandey, R., Samuel, A. J., Aranha, V. P., Pandey, A., Narkeesh, K.
Saudi Journal of Ophthalmology, 2017/04
Free full text
1381

Begleitung von Familien mit besonderen Kindern
(Support of families with special needs children)
Beuge, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
1382

Eine osteopathische Herangehensweise an reflexives Schreiben
(An osteopathic approach to reflective writing)
Brown, A., Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
1383

Can the Humanities Humanize Health Care?
Baltonado, J., Cymet, T.
The Journal of the American Osteopathic Association, 2017/04
Free full text
1384

Changes in Osteopathic Medical Education: The Journey Continues
McClain, E. K.
The Journal of the American Osteopathic Association, 2017/04
Free full text
1385

Patienteninfo: Handling und Lagerung von Säuglingen
(Patient information: Handling and positioning of infants)
Fischer, S. J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
1386

Das chronische Beckenschmerzsyndrom : Hilfe durch Osteopathie.
(Chronic pelvic pain syndrome : Treatment options using osteopathy)
Marx, S.
Der Urologe, 2017/04
1387

Collaboration interprofessionnelle entre médecins et ostéopathes impliqués auprès de la clientèle pédiatrique au Québec
(Interprofessional collaboration between physicians and osteopaths involved with pediatric population in Quebec)
Morin, C.
Unpublished PhD thesis, 2017/03
Free full text
1388

Osteopathic Manipulative Treatment for Nausea and Vomiting Following Fine Needle Aspiration of the Neck
Hess, N. J.
The AAO Journal, 2017/03
Free full text
1389

A Qualitative, Interview-Based Study of the Health Policy Fellowship's Osteopathic Identity
Skinner, D., Franz, B.
The Journal of the American Osteopathic Association, 2017/03
Free full text
1390

Impact of osteopathic therapy on proprioceptive balance and quality of life in patients with dizziness
Papa, L., Amodio, A., Biffi, F., Mandara, A.
Journal of Bodywork and Movement Therapies, 2017/03
1391

Osteopathy for primary headache patients: a systematic review
Cerritelli, F., Lacorte, E., Ruffini, N., Vanacore, N.
Journal of Pain Research, 2017/03
Free full text
1392

Australian osteopathic students' perceptions of interprofessional relationships
Vaughan, B., Moore, K., Macfarlane, C., Grace, S.
International Journal of Osteopathic Medicine, 2017/03
1393

History of Osteopathic Medicine: Still Relevant?
Orenstein, R.
The Journal of the American Osteopathic Association, 2017/03
Free full text
1394

Burnout: Worauf Sie bei Ihren Patienten achten sollten
(Burnout: What you should pay attention to in your patients)
Krautz, B.
Osteopathische Medizin, 2017/02
1395

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text
1396

Osteopathische Läsion – Teil 1: Begriffsentstehung und Konzept
(Osteopathic lesion - Part 1: Emergence of the idea and concept)
Liem, T.
Osteopathische Medizin, 2017/02
1397

Vom Aufhängeband zum Organ: neue Forschungsergebnisse zum Mesenterium
From the suspensory ligament to the organ: New findings on the mesentery
Plathner, M.
Osteopathische Medizin, 2017/02
1398

Motorische Entwicklung eines Säuglings: Idealbild und Abweichungen
(Motor development of an infant: Ideal and deviations)
Strunk, A.
Osteopathische Medizin, 2017/02
1399

Quiet dissent: The attitudes, beliefs and behaviours of UK osteopaths who reject low back pain guidance - A qualitative study
Figg-Latham, J., Rajendran, D.
Musculoskeletal Science and Practice, 2017/02
1400

Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/02
1401

The strain - Counter strain technique in the management of anterior interosseous nerve syndrome: A case report
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S.
Journal of Taibah University Medical Sciences, 2017/02
Free full text
1402

Do you hear me?: the caregivers' experience of osteopathy for their child’s otitis media
McCulloch, J.
Unpublished MSc thesis, 2017/02
Free full text
1403

GPs and the unexplored world of osteopathy: a descriptive study
Currie, K. G.
Unpublished MSc thesis, 2017/02
Free full text
1404

Auswirkungen einer cranialen Technik auf die Herzratenvariabilität
(Effects of a cranial technique on the heart rate variability)
Hauser, B. D.
Unpublished MSc thesis, 2017/02
Free full text
1405

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/
1406

Developing an integrated osteopathy and acceptance-informed pain management course for patients with persistent pain
Abbey, H. A.
Unpublished PhD thesis, 2017/01
Free full text
1407

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text
1408

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text
1409

Osteopathic Manipulative Treatment Limits Chronic Constipation in a Child with Pitt-Hopkins Syndrome
Aquino, A., Perini, M., Cosmai, S., Zanon, S., Pisa, V., Castagna, C., Uberti, S.
Case Reports in Pediatrics, 2017/01
Free full text
1410

Osteopathie und Psyche
(Osteopathy and Psyche)
Tschinkel, M.
Unpublished MSc thesis, 2017/01
Free full text
1411

Knee Pain in Adults with an Osteopathic Component
Datta, R., Burina, L., Romanelli, F., Flaum, T. B.
Osteopathic Family Physician, 2017/01
Free full text
1412

The role of New Zealand osteopaths in the care of people who experience migraine: a qualitative exploration
Chaise, K.
Unpublished MSc thesis, 2017/01
Free full text
1413

Osteopathische Behandlung eines Descensus genitalis und dessen Begleitsymptome bei Frauen. Eine Vergleichsstudie von Osteopathie und Elektrostimulation/Biofeedback für den Beckenboden
(Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative study of osteopathy and electrostimulation / biofeedback for pelvic floor)
Bogner, D.
Unpublished MSc thesis, 2017/01
Free full text
1414

Der kurzfristige Effekt des General Osteopathic Treatment auf die Beweglichkeit bei jungen Frauen am Beispiel “Finger-Boden-Abstand“. Eine quasi randomisierte, einfach verblindete, experimentelle Studie
(The short-term effect of General Osteopathic Treatment (GOT) on the mobility of young women using the Finger-Floor-Distance test (FFD). A quasi-randomized, single blinded, experimental study)
Dutzler, R.
Unpublished MSc thesis, 2017/01
Free full text
1415

How Osteopathy Could Help Obstetrics in Diagnosis and Therapy. Preliminary Report About Safety and Efficacy of Osteopathy in an Obstetrics Department in Italy
Siccardi, M., Valle, C., Di Matteo, F., Perlo, B., Pratticò, M., Angius, V., Bianco, G., Damonte, V., Giusto, S., Palezzato, E., Tabò, M., Brichetto, C., Valle, P., Zolezzi, A., Parodi, G., Airaudi, G.
Journal of Perinatal Medicine, 2017/01
1416

John Martin Littlejohn: Leben und Werk
(John Martin Littlejohn: life and work)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
1417

Osteopathic Manipulative Treatment of Primary Dysmenorrhea and Related Factors: A Randomized Controlled Trial
Zecchillo, D., Acquati, A., Aquino, A., Pisa, V., Uberti, S., Ratti, S.
International Journal of Medical Research & Health Sciences, 2017
Free full text
1418

Osteopathische Behandlung des Reizdarmsyndroms – ein Review
(Osteopathic treatment of irritable bowel syndrome - A review)
Krüger, S.
Osteopathische Medizin, 2016/12
1419

Relationship Between Falls and Complementary and Alternative Medicine Use Among Community-Dwelling Older Adults
Caron, A., Gallo, W. T., Durbin, L. L., Mielenz, T. J.
The Journal of Alternative and Complementary Medicine, 2016/12
1420

Assessment of Hospital Staff's Knowledge of Osteopathic Manipulative Medicine: A Survey-Based Study
Smith-Kelly, J. B., Cardenas, A.
The Journal of the American Osteopathic Association, 2016/12
Free full text
1421

Reliability of Diagnosis and Clinical Efficacy of Cranial Osteopathy: A Systematic Review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
PLoS One, 2016/12
Free full text
1422

Construção da Identidade profissional do osteopata
(Building the osteopath's professional identity)
Sousa, L. F. G.
Unpublished MSc thesis, 2016/12
Free full text
1423

Holism in Osteopathy – Bridging the gap between concept and practice: A grounded theory study
Turner, P. W. D., Holroyd, E.
International Journal of Osteopathic Medicine, 2016/12
1424

Entwicklungstests für Säuglinge und Kleinkinder: Hintergründe und praktische Empfehlungen
(Developmental tests for infants and toddlers: Backgrounds and practical recommendations)
Hohendahl, J.
Osteopathische Medizin, 2016/12
1425

Does replacing live demonstration with instructional videos improve student satisfaction and osteopathic manipulative treatment examination performance?
Seals, R., Gustowski, S. M., Kominski, C., Li, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text
1426

Manual therapy and OMT may be of benefit in the management of somatosensory tinnitus
King, H. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text
1427

Is cranial mobility affecting school performance and can osteopathic manual treatment (OMT) improve it? Results from a pilot study with children in a regular elementary curriculum
Bouchard, A.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
1428

Can manual osteopathic techniques performed on the small and large intestines reduce the symptoms associated with irritable bowel syndrome?
Choquette, J., Plante, S., Sabourin, D.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
1429

Interrater-Reliabilitätsstudie am Os temporale
(Interrater Reliability Study on the Temporal Bone)
Pöschl, A.
Unpublished MSc thesis, 2016/10
Free full text
1430

Inter-examiner reliability of osteopathic cranial palpatory diagnostic test
Morin, C., Collette, L., Aubin, A.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
1431

Development of trust between conventional and CAM practitioners: Insights from physicians and osteopaths in Quebec
Morin, C., Gaboury, I., Desrosiers, J.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
1432

The effects of osteopathic treatment on snapping hip syndrome in ballet and contemporary dancers: A longtudinal study
Ryder, C.
Journal of Complementary and Integrative Medicine, 2016/10
1433

Current clinical practices, experiences, and perspectives of healthcare practitioners who attend to dysfunctional breathing: A qualitative study
Shaw, J.
Unpublished MSc thesis, 2016/10
Free full text
1434

Exploring Ambulance Officers' experiences of chronic low back pain and its treatment
Mohammad, S. B.
Unpublished MSc thesis, 2016/10
1435

The use of critical reflection to foster reflective practice in student osteopaths
McLeod, G. A.
Unpublished PhD thesis, 2016/09
Free full text
1436

The enigmatic case of cranial osteopathy: Evidence versus clinical practice
Zegarra-Parodi, R., Cerritelli, F.
International Journal of Osteopathic Medicine, 2016/09
Free full text
1437

Nachruf auf Roger Seider
(Obituary for Roger Seider)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
1438

The Attitudes of Physicians, Nurses, Physical Therapists, and Midwives Toward Complementary Medicine for Chronic Pain: A Survey at an Academic Hospital
Aveni, E., Bauer, B., Ramelet, A. S., Kottelat, Y., Decosterd, I., Finti, G., Ballabeni, P., Bonvin, E., Rodondi, P. Y.
Explore (NY), 2016/09
1439

Does Using a Shim Improve the Diagnostic Reliability of the Standing Flexion Test? A Pilot Study
Marquez, A. P., Yim, M., Zelimkhanian, B., Quiamas, J., Davidge, R. E., Siri, M., Hruby, R. J.
The AAO Journal, 2016/09
1440

Osteopathic Manipulative Therapy for Preterm Infants, Acupuncture for Menopausal Symptoms, Mindfulness-Based Stress Reduction for Chronic Low Back Pain, Chocolate for Ischemic Heart Disease, Berberine for Irritable Bowel Syndrome
Pettit, J., Glickman-Simon, R.
Explore (NY), 2016/09
1441

Mechanotransduktion: von der zellulären Ebene bis zum ganzen Körper
(Mechanotransduction: From the cellular level up to the entire body)
Schleip, R.
Osteopathische Medizin, 2016/09
1442

Osteopathic Manipulative Treatment in Pediatric and Neonatal Patients and Disorders: Clinical Considerations and Updated Review of the Existing Literature
Bagagiolo, D., Didio, A., Sbarbaro, M., Priolo, C. G., Borro, T., Farina, D.
American Journal of Perinatology, 2016/09
1443

Struktur und Funktion der Atlasregion aus Sicht von Humankybernetik und Tensegrity
(Structure and function of the atlas region from the point of view of human cybernetics and tensegrity)
Siemsen, C.H., Koerner, H.
Osteopathische Medizin, 2016/09
1444

Haftungsfälle in der osteopathischen Praxis
(Cases of liability in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
1445

Tensegrity and manual therapy practice: a qualitative study
Hohenschurz-Schmidt, D. J., Esteves, J. E., Thomson, O. P.
International Journal of Osteopathic Medicine, 2016/09
1446

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text
1447

Benefits of Craniosacral Therapy in Patients with Chronic Low Back Pain: A Randomized Controlled Trial
Castro-Sánchez, A. M., Lara-Palomo, I. C., Matarán-Peñarrocha, G. A., Saavedra-Hernández, M., Pérez-Mármol, J. M., Aguilar-Ferrándiz, M. E.
The Journal of Alternative and Complementary Medicine, 2016/08
1448

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text
1449

Osteopathic Manual Treatment for Amyotrophic Lateral Sclerosis: A Feasibility Pilot Study
Maggiani, A., Tremolizzo, L., Della Valentina, A., Mapelli, L., Sosio, S., Milano, V., Bianchi, M., Badi, F., Lavazza, C., Grandini, M., Corna, G., Prometti, P., Lunetta, C., Riva, N., Ferri, A., Lanfranconi, F., Me, Study
The Open Neurology Journal, 2016/08
Free full text
1450

Nutrition Knowledge and Attitude Towards Nutrition Counseling Among Osteopathic Medical Students
Hargrove, E. J.
Unpublished MSc thesis, 2016/08
Free full text
1451

Health literacy screening of patients attending a student-led osteopathy clinic: A pilot investigation
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Complementary Therapies in Clinical Practice, 2016/08
1452

Effects of an e-learning programme on osteopaths’ back pain attitudes: a mixed methods feasibility study
Draper-Rodi, J.
Unpublished PhD thesis, 2016/07
Free full text
1453

Repeat-measures longitudinal study evaluating behavioural and gastrointestinal symptoms in children with autism before, during and after visceral osteopathic technique (VOT)
Bramati-Castellarin, I., Patel, V. B., Drysdale, I. P.
Journal of Bodywork and Movement Therapies, 2016/07
1454

Patienteninfo: Verhaltensauffällige Kinder – ADHS aktuell
(Patient information: Children with behavioral problems - latest on ADHD)
Rudner, S., Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
1455

Symposium: ADHS – beziehungsorientiert verstehen und begegnen
(Symposium: ADHD - understanding and dealing with it in a relationship-oriented way)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
1456

Targeted Pressure on Abductor Hallucis and Flexor Hallucis Brevis Muscles to Manage Moderate to Severe Primary Restless Legs Syndrome
Kuhn, P. J., Olson, D. J., Sullivan, J. P.
The Journal of the American Osteopathic Association, 2016/07
Free full text
1457

In memoriam Viola Frymann (1921–2016)
(In memoriam of Viola Frymann (1921–2016))
Dove, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
1458

The use of osteopathic manipulative treatment as part of an integrated treatment for infantile colic:A case report
Snider, K. T.
The AAO Journal, 2016/06
1459

Response of Tinnitus to Osteopathic Manipulation
Kurisu, M., Alexander, J., Fleming, J., King, H.
Journal of Integrative and Complementary Medicine, 2016/06
1460

Behandlungsvertrag in der Osteopathie – Warum ist er wichtig?
(Treatment contract in osteopathy - Why is it important?)
Schröder, B.
Osteopathische Medizin, 2016/06
1461

Beliefs about back pain: The confluence of client, clinician and community
Darlow, B.
International Journal of Osteopathic Medicine, 2016/06
1462

Time, space and form: Necessary for causation in health, disease and intervention?
Evans, D. W., Lucas, N., Kerry, R.
Medicine, Health Care and Philosophy, 2016/06
1463

Osteopathic manipulative treatment in gynecology and obstetrics: A systematic review
Ruffini, N., D'Alessandro, G., Cardinali, L., Frondaroli, F., Cerritelli, F.
Complementary Therapies in Clinical Practice, 2016/06
1464

Sensomotorische Entwicklung und pädiatrische Osteopathie
(Sensorimotor development and pediatric osteopathy)
Ava Levin, V., Levin, P.
Osteopathische Medizin, 2016/06
1465

O desenvolvimento profissional do osteopata: Representações de profissionais em início decarreira
(The professional development of an osteopath: Representations of early-career professionals)
Pedro, J. C. F.
Unpublished MSc thesis, 2016/06
Free full text
1466

Osteopathische Behandlungstechnik für die Fascia clavipectoralis
(Osteopathic treatment techniques for fascia clavipectoralis)
Baumgart, V.
Osteopathische Medizin, 2016/06
1467

Masterclasses – integrating research evidence with expertise into clinical practice
Thomson, O. P., Evans, D. W.
International Journal of Osteopathic Medicine, 2016/06
1468

Ergänzende Anmerkungen zum Artikel „Osteopathische Behandlungstechnik für die Fascia clavipectoralis”
(Supplementary notes on the article “Osteopathic treatment techniques for fascia clavipectoralis“)
Hartwig, B.
Osteopathische Medizin, 2016/06
1469

Experiences of intervertebral motion palpation in osteopathic practice – A qualitative interview study among Swedish osteopaths
Sposato, N. S., Bjerså, K.
Journal of Bodywork and Movement Therapies, 2016/05
1470

Eye contact, appetite, and vomiting improved in children with autism spectrum disorder after visceral osteopathic technique
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
1471

Postural Balance and Gait Improved With an Osteopathic Intervention in a Special Needs Population
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
1472

Premedical Students’ Attitudes Toward Primary Care Medicine
Beverly, E. A., Wietecha, D. A., Nottingham, K., Rush, L. J., Law, T. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text
1473

ENGAGE Initiative: Showcasing Osteopathic Scholarly Activity
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/05
Free full text
1474

Program Characteristics Influencing Allopathic Students' Residency Selection
Stillman, M. D., Miller, K. H., Ziegler, C. H., Upadhyay, A., Mitchell, C. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text
1475

Effect of muscle energy technique and static stretching on pain and functional disability in patients with mechanical neck pain: A randomized controlled trial
Phadke, A., Bedekar, N., Shyam, A., Sancheti, P.
Hong Kong Physiotherapy Journal, 2016/04
Free full text
1476

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text
1477

Osteopathic Manipulative Treatment improves gait pattern and posture in adult patients with Prader–Willi syndrome
Vismara, L., Cimolin, V., Galli, M., Grugni, G., Ancillao, A., Capodaglio, P.
International Journal of Osteopathic Medicine, 2016/03
1478

Osteopathy – a complex business
Vogel, S.
International Journal of Osteopathic Medicine, 2016/03
1479

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
1480

Reduziert die Osteopathische Behandlung die Dauer des Neonatalen Abstinenzsyndroms? Eine Pilotstudie
(Does an osteopathic treatment reduce the duration of the neonatal abstinence syndrome? A Pilot Study)
Sander, K.
Unpublished MSc thesis, 2016/03
Free full text
1481

Pilotstudie: Reduziert die Osteopathische Behandlung die Dauer des Neonatalen Abstinenzsyndroms?
(Pilot study: Does an osteopathic treatment reduce the duration of the neonatal abstinence syndrome?)
Sander, K.
Unpublished MSc thesis, 2016/03
Free full text
1482

20. Europäisches Symposium der Traditionellen Osteopathie
(The 20th European Symposium of Traditional Osteopathy)
Pauler, A.
Osteopathische Medizin, 2016/03
1483

Knowing hands converse with an expressive body - An experience of osteopathic touch
Consedine, S., Standen, C., Niven, E.
International Journal of Osteopathic Medicine, 2016/03
1484

Understanding clinical reasoning in osteopathy: a qualitative research approach
Grace, S., Orrock, P., Vaughan, B., Blaich, R., Coutts, R.
Chiropractic & Manual Therapies, 2016/03
Free full text
1485

Die Beeinflussung der Kapazität der Vena portae durch eine Mobilisierung der Leber gemessen mit Doppler-Ultraschall
(Influence of osteopathic treatment on the capacity of the portal vein through a mobilisation of liver measured by Doppler ultrasonography)
Maier, M.
Unpublished MSc thesis, 2016/03
Free full text
1486

Osteopathie bei Infantiler Cerebralparese
(Osteopathy for Infant Cerebral Palsy)
Budroni, J.
Unpublished MSc thesis, 2016/03
Free full text
1487

Commitment der österreichischen Osteopathinnen zur Osteopathie und zur Österreichischen Gesellschaft für Osteopathie
(Commitment of Austrian osteopaths to osteopathy and to the Austrian Society for Osteopathy (OEGO))
Unpublished MSc thesis, 2016/03
1488

Osteopaths' clinical reasoning during consultation with patients experiencing acute low back pain: A qualitative case study approach
Roots, S. A., Niven, E., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/03
1489

Klinische Effektivität einer osteopathischen Behandlung bei Migräne
(Clinical effectiveness of osteopathic treatment for migraines)
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Osteopathische Medizin, 2016/03
1490

Patients' experiences of living with persistent back pain
van Griensven, Hubert
International Journal of Osteopathic Medicine, 2016/03
1491

Osteopathic educators' attitudes towards osteopathic principles and their application in clinical practice: A qualitative inquiry
Kasiri-Martino, H., Bright, P.
Manual Therapy, 2016/02
1492

Single Accreditation System for Graduate Medical Education: An Opportunity for Lesbian, Gay, Bisexual, and Transgender Health Education Integration in Osteopathic Medicine
Lapinski, J., Diaz, K. M.
The Journal of the American Osteopathic Association, 2016/02
Free full text
1493

Osteopathic Physicians on the Editorial Boards of Major Medical Journals Over the Past 30 Years
Ashurst, J. V., Galuska, M.
The Journal of the American Osteopathic Association, 2016/02
Free full text
1494

As the Twig Is Bent, so Grows the Tree—Part 7: Severe Temporal Bone Restriction in Children Is Risk Factor for Acute Otitis Media
King, H. H.
The Journal of the American Osteopathic Association, 2016/01
Free full text
1495

Osteopathic clinical reasoning: an ethnographic study of perceptual diagnostic judgments, metacognition, and reflective practice
McIntyre, C. L.
Unpublished PhD thesis, 2016/01
Free full text
1496

Patienteninfo: Fünf Übungen für mehr Mobilität
(Patient information: Five exercises for more mobility)
Melcher, L.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
1497

Osteopathic Students' Graduate Medical Education Aspirations Versus Realities: The Relationship of Osteopathic Medicine and Primary Care
Cummings, M.
Academic Medicine, 2016/01
Free full text
1498

Pilot study of the effects of mixed light touch manual therapies on active duty soldiers with chronic post-traumatic stress disorder and injury to the head
Davis, L., Hanson, B., Gilliam, S.
Journal of Bodywork and Movement Therapies, 2016/01
1499

Prevalence and characteristics of women who consult with osteopathic practitioners during pregnancy; a report from the Australian Longitudinal Study on Women's Health (ALSWH)
Frawley, J., Sundberg, T., Steel, A., Sibbritt, D., Broom, A., Adams, J.
Journal of Bodywork and Movement Therapies, 2016/01
1500

Lumbosakrale Schmerzen und Miktionsbeschwerden bei benignem Prostatasyndrom (BPS)
(Lumbosacral pain and micturition symptoms in benign prostatic hyperplasia (BPH))
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
1501

General Movements in preterm infants undergoing craniosacral therapy: a randomised controlled pilot-trial
Raith, W., Marschik, P. B., Sommer, C., Maurer-Fellbaum, U., Amhofer, C., Avian, A., Lowenstein, E., Soral, S., Muller, W., Einspieler, C., Urlesberger, B.
BMC Complementary and Alternative Medicine, 2016/01
Free full text
1502

As the Twig Is Bent, so Grows the Tree-Part 6: In a Multicenter Study, OMTh Shortens Length of Stay in the Neonatal Intensive Care Unit
King, H. H.
The Journal of the American Osteopathic Association, 2016/01
Free full text
1503

Muscle energy technique improves chronic lateral epicondylitis
Koh, C., III, Seffinger
The Journal of the American Osteopathic Association, 2016/01
Free full text
1504

Rechtliches rund um die osteopathische Praxis: Heilpraktikergesetz und GKV-Erstattungspraxis
(Non-Medical Practitioners Act and GKV reimbursement practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
1505

An indication of current views of Australian general practitioners towards chiropractic and osteopathy: a cross-sectional study
Engel, R. M., Beirman, R., Grace, S.
Chiropractic & Manual Therapies, 2016/01
Free full text
1506

Arguments for and against movement at the spheno-occipital synostosis: Furthering the debate
Starkey, R.
International Journal of Osteopathic Medicine, 2015/6
1507

The Osteopathic Clinical Practice Assessment – a pilot study to develop a new workplace-based assessment tool
Vaughan, B., Moore, K.
International Journal of Osteopathic Medicine, 2015/12
1508

Rising to New Challenges: Problems and Proposed Solutions for Osteopathic Program Directors
Goldmann, S. I.
The AAO Journal, 2015/12
1509

Effect of Select Osteopathic Manipulative Treatment Techniques on Patients With Acute Rhinosinusitis
Nishida, Y., Sopchak, M. M., Jackson, M. R., Andersonning, T. R., Leikert, E. P., Goldman, S. I., Jarski, R. W.
The AAO Journal, 2015/12
1510

Osteopathische Behandlung der Symphysensprengung – ein Fallbeispiel
(Osteopathic treatment of symphyseal disruption - A case study)
Past, A.
Osteopathische Medizin, 2015/12
1511

Craniomandibuläre Dysfunktion: Bedeutung der Körperhaltung bei Okklusionstests
(Craniomandibular dysfunction: Importance of body position in occlusion tests)
Prodinger-Glöckl, D.
Osteopathische Medizin, 2015/12
1512

Kindernöte verstehen – das Bewegungsverhalten von Babys und Kindern
(Understanding children's afflictions - The movement behavior of babies and children)
Ritter, K.
Osteopathische Medizin, 2015/12
1513

Vascular Dynamics – ein osteopathischer Behandlungsansatz
(Vascular Dynamics - An osteopathic treatment approach)
Vogt, R.
Osteopathische Medizin, 2015/12
1514

Reassessing the accuracy and reproducibility of Diers formetric measurements in healthy volunteers
Lason, G., Peeters, L., Vandenberghe, K., Byttebier, G., Comhaire, F.
International Journal of Osteopathic Medicine, 2015/12
1515

Scimitar syndrome: A rare explanation for a common symptom with an osteopathic approach
Rivera, N. T., Martin, R. B., Gordon, M.l B., Rajter, J.-J., Bray, N.
International Journal of Osteopathic Medicine, 2015/12
1516

Balance-Konzept – Grundlagen und Fallbeispiele
(Concept of balance - Fundamentals and case studies)
Dräger, K.
Osteopathische Medizin, 2015/12
1517

Objectivation de l'équilibre en stabilité debout et lors du cycle de marche chez le sujet âgé autonome chuteur: apport de l'Ostéopathie
(Objectification of balance stability when standing and walking among elderly fallers: contribution of Osteopathy)
Huard, Y.
Unpublished PhD thesis, 2015/11
Free full text
1518

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11
1519

Serious Adverse Events and Spinal Manipulative Therapy of the Low Back Region: A Systematic Review of Cases
Hebert, J. J., Stomski, N. J., French, S. D., Rubinstein, S. M.
Journal of Manipulative and Physiological Therapeutics, 2015/11
1520

Validität der Palpation des intraokularen Druckes durch Osteopathen
(Validity of the Palpation of the Intraocular Pressure by Osteopaths)
Frenzel, S.
Unpublished MSc thesis, 2015/11
Free full text
1521

Job Satisfaction and Affective Commitment of Osteopathic Medical School Clinical Faculty
Yurvati, A. H.
Unpublished PhD thesis, 2015/11
1522

Patients' expectations of osteopathic care: a qualitative study
Cross, V., Leach, C. M., Fawkes, C. A., Moore, A. P.
Health Expectations, 2015/10
Free full text
1523

Person-centered osteopathic practice: patients' personality (body, mind, and soul) and health (ill-being and well-being)
Fahlgren, E., Nima, A. A., Archer, T., Garcia, D.
PeerJ, 2015/10
Free full text
1524

Look but ... please don't touch!
De-Giorgio, F., Panarella, L., Miscusi, M., d', Aloja, E., Spagnolo, A. G., Pascali, V. L., Vetrugno, G.
Medicine, Science and the Law, 2015/10
Free full text
1525

(Osteopathic treatment in patients with age-related macular degeneration. Pre-post study)
Ihlow, D.
Unpublished D.O. thesis, 2015/10
1526

Intratester-Reliabilität des viszeralen Tensionstests nach Helsmoortel et al. (2002). Reliabilitätsstudie.
(Intra-observer reliability of the visceral tension test developed by Helsmoortel et al. (2002). Reliability study)
Verbaarschot, A.
Unpublished D.O. thesis, 2015/10
1527

Systematische Übersichtsarbeit über die Bewegungen des Herzens in der Mobilität und in der Motilität. Systematischer Review
(Heart motion and motility. Systematic review)
Will, T.
Unpublished D.O. thesis, 2015/10
1528

Intratester-Reliabilität des viszeralen Tensionstests nach Helsmoortel et al. (2002).
Reliabilitätsstudie. (Intra-observer reliability of the visceral tension test developed by Helsmoortel et al. (2002). Reliability study)
Verbaarschot, A.
Unpublished D.O. thesis, 2015/10
1529

Interrater-Reliabilität von osteopathischen Befunden am Beispiel der Zwerchfelluntersuchung
(Interrater reliability of osteopathic findings using the example of diaphragmatic examination.)
Körner, J., Porthun, J., Woisetschläger, G.
Osteopathische Medizin, 2015/09
1530

Embodied Clinical Decision-making in Osteopathic Manipulative Medicine
Esteves, J. E.
The AAO Journal, 2015/09
1531

Impact of forefoot varus on standing and gait kinematics in children
Villarroya-Aparicio, A., Franco-Sierra, M. A., García-Muñoz, I., Marcén-Román, Y., Alonso-Vázquez, A., Rodriguez-Blanco, C.
International Journal of Osteopathic Medicine, 2015/09
1532

Osteopathische Universität – ein Entwurf
(Osteopathic University - a concept)
Levin, P.
Osteopathische Medizin, 2015/09
1533

Implementing the Single Accreditation System for Graduate Medical Education: Seeking Osteopathic Recognition
Shannon, S. C.
The AAO Journal, 2015/09
1534

Rolle der Empathie in der Osteopathie – eine qualitative Studie
(Role of empathy in osteopathy - a qualitative study)
Müller-Steffens, C., Wikus, P.
Osteopathische Medizin, 2015/09
1535

Dysfunction in a Patient With Acute Knee Pain and Osteoarthritis: A Case Report
T., Snider. K.
The AAO Journal, 2015/09
1536

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09
1537

Approaching the Single Accreditation System: Curricular Variation in Allopathic, Osteopathic, and Dually Accredited Family Medicine Residency Programs
Mims, L. D., Wannamaker, L. R., Bressler, L. C.
Journal of Graduate Medical Education, 2015/09
Free full text
1538

Testung der Interrater-Reliabilität osteopathischer Befundergebnisse bei Untersuchung des abdominalen Diaphragmas ohne Vorgabe der Testdurchführung.
(Testing the interrater reliability of osteopathic findings in the examination of the abdominal diaphragm without specification of test implementation)
Körner, J.
Unpublished MSc thesis, 2015/09
Free full text
1539

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09
1540

Improving our impact and developing high-level clinical expertise
Moran, R.
International Journal of Osteopathic Medicine, 2015/09
Free full text
1541

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text
1542

Accuracy of Anterior Superior Iliac Spine Symmetry Assessment by Routine Structural Examination
Lee, A. S., Pyle, C. W., Redding, D.
The Journal of the American Osteopathic Association, 2015/08
Free full text
1543

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text
1544

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text
1545

Numbers of MD and DO Graduates in Graduate Medical Education Programs Accredited by the Accreditation Council for Graduate Medical Education and the American Osteopathic Association
Jolly, P., Lischka, T., Sondheimer, H.
Academic Medicine, 2015/07
Free full text
1546

Effects of Osteopathic Manipulative Treatment on Diabetic Gastroparesis
Van Ravenswaay, V. J., Hain, S. J., Grasso, S., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2015/07
Free full text
1547

Lass die Natur ihre Arbeit machen
(Let nature do its job)
Deslee, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
1548

Zwischen Traditionalisten und Reformern: Littlejohns Konzept der Anpassung
(Between traditionalists and reformers: Little Johns concept of adaptation)
Liem, T.
Osteopathische Medizin, 2015/06/01/
1549

Einfluss zirkadianer Rhythmik auf den Kurzzeiteffekt eines myofaszialen Release des Zwerchfells hinsichtlich vagaler Modulation der Herzratenvariabilität
(Influence of circadian rhythmicity on the short-term effect of a myofascial release of the diaphragm with respect to vagal modulation of heart rate variability)
Hofer, U.
Unpublished MSc thesis, 2015/06
Free full text
1550

Didaktik: Palpation, Wahrnehmung und Persönlichkeitsentwicklung
(Didactics: Palpation, perception and personality development)
Krause, R.
Osteopathische Medizin, 2015/06
1551

Osteopathie aus Sicht der Patienten: „Die Blüte entfaltet sich”
(Osteopathy from the patients' point of view: “The blossom unfolds“)
Weber, K.H.
Osteopathische Medizin, 2015/06
1552

Relationship between somatic dysfunction of the lumbosacral joint and changes in the gait pattern
Croonenborghs, H., Peeters, L., De Schepper, J.
International Journal of Osteopathic Medicine, 2015/06
1553

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06
1554

Proposed Amendments to the AOA Constitution
listed, No authors
The Journal of the American Osteopathic Association, 2015/06
Free full text
1555

Neue Strategien zur persönlichen und beruflichen Weiterentwicklung für Osteopathen
(New strategies for the further personal and professional development of osteopaths)
Bradonic, B., Risch, A. J.
Osteopathische Medizin, 2015/06
1556

Einfluss einer Behandlung der lateralen Ventrikel auf die Hirnaktivität – eine Pilotstudie
(Influence of a treatment of the lateral ventricle on brain activity - A pilot study)
Fröhlich, B.
Osteopathische Medizin, 2015/06
1557

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text
1558

High-Velocity Thrust to the Atlantoaxial Joint Does Not Increase Mechanical Stress on the Vertebral Artery
Guevarra, C. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text
1559

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05
1560

A multicenter, randomized, controlled trial of osteopathic manipulative treatment on preterms
Cerritelli, F., Pizzolorusso, G., Renzetti, C., Cozzolino, V., D'Orazio, M., Lupacchini, M., Marinelli, B., Accorsi, A., Lucci, C., Lancellotti, J., Ballabio, S., Castelli, C., Molteni, D., Besana, R., Tubaldi, L., Perri, F. P., Fusilli, P., D'Incecco, C., Barlafante, G.
PLoS One, 2015/05
Free full text
1561

The impact of MD and DO attitudes and beliefs on their willingness to collaborate clinically with chiropractors
McGregor, D. M.
Unpublished PhD thesis, 2015/05
1562

The meaning of fascia in a changing society
Adstrum, N. S.
Unpublished PhD thesis, 2015/04
1563

Transitions in osteopathic medical education
Cymet, T. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1564

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1565

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1566

Developing a clinical teaching quality questionnaire for use in a university osteopathic pre-registration teaching program
Vaughan, B.
BMC Medical Education, 2015/04
Free full text
1567

„Meine Mitte ist verschoben!“
(“My center is shifted!“)
Weese, P.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
1568

Osteopathic manipulative treatment and pain in preterms: study protocol for a randomised controlled trial
Cerritelli, F., Cicchitti, L., Martelli, M., Barlafante, G., Renzetti, C., Pizzolorusso, G., Lupacchini, M., D'Orazio, M., Marinelli, B., Cozzolino, V., Fusilli, P., D'Incecco, C.
Trials, 2015/04
Free full text
1569

Clinical effectiveness of osteopathic treatment in chronic migraine: 3-Armed randomized controlled trial
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Complementary Therapies in Medicine, 2015/04
1570

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1571

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1572

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
1573

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text
1574

Die Interrater Reliabilität der segmentalen passiven Mobilitätstestung der Lendenwirbelsäule im Sitz mit markierten Processus spinosi
(Interrater Reliability For Segmental Passive Motion Palpation Of The Lumbar Spine In Sitting Position With Marked Spinous Processes)
Maurer, S.
Unpublished MSc thesis, 2015/03
Free full text
1575

19. Europäisches Symposium der traditionellen Osteopathie
(The 19th European Symposium of Traditional Osteopathy)
Müller, F.
Osteopathische Medizin, 2015/03
1576

Adapting and feasibility testing pre-registration e-learning resources for Professionalism in Osteopathy in the UK
Browne, F., Rolfe, K., Currie, A., Walker, T., Roff, S.
International Journal of Osteopathic Medicine, 2015/03
1577

Chronic inflammatory disease and osteopathy: a systematic review
Cicchitti, L., Martelli, M., Cerritelli, F.
PLoS One, 2015/03
Free full text
1578

Osteopathie: eine Heilmethode auf dem Prüfstand
Snijders, C.
Skeptiker, 2015/03
1579

Investigation of instruments measuring healthcare practitioners’ attitudes and beliefs toward low back pain: psychometric properties and survey of New Zealand osteopaths and manipulative physiotherapists
Rushworth, W.
Unpublished MSc thesis, 2015/03
Free full text
1580

Einfluss der Osteopathie auf den körperlichen und mentalen Zustand von Teenagern
(Influence of osteopathy on the physical and mental states of teenagers)
Egorova, I. A., Buchnov, A. D.
Osteopathische Medizin, 2015/03
1581

Osteopathic graduates perceptions of stress and competence – A longitudinal study
Subramaniam, P., Eaton, S.A., Cranfield, J., Mulcahy, J., McLaughlin, P., Morrison, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2015/03
1582

Documenting female spine motion during coitus with a commentary on the implications for the low back pain patient
Sidorkewicz, N., McGill, S. M.
European Spine Journal, 2015/03
1583

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text
1584

Leaky Gut. Eine wissenschaftliche Literaturanalyse.
(Leaky Gut. A scientific literature review)
Halbfurter, M.
Unpublished MSc thesis, 2015/02
Free full text
1585

Promoting optimal breastfeeding through the osteopathic therapeutic cycle
Cornall, D.
Unpublished PhD thesis, 2015/02
Free full text
1586

Impact of the Single Accreditation Agreement on GME Governance and the Physician Workforce
Buser, B. R.
The Journal of the American Osteopathic Association, 2015/02
Free full text
1587

Patienteninfo: Gute Ernährung für gesundes Altern
(Patient information: Good nutrition for healthy aging)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
1588

Aufrecht im Alter
(Upright in old age)
Eix, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
1589

Racionalidades médicas de los sistemas tradicional colombiano, biomédico y osteopático: una aproximación a la conceptualización de la dolencia del descuaje en Bogotá, Colombia. 2015
(Medical rationalities of the traditional Colombian, biomedical, and osteopathic systems: an approach to the conceptualization of the ailment of descuaje in Bogota, Colombia)
Sanin Pineda, L. F.
Unpublished MSc thesis, 2015/01
Free full text
1590

A single graduate medical education accreditation system: ensuring quality training for physicians and improved health care for the public
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/4
Free full text
1591

Pitfalls and challenges involved in the process of perception and interpretation of palpatory findings
Liem, T.
International Journal of Osteopathic Medicine, 2014/12
1592

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text
1593

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12
1594

Intuition, analysis and reflection: An experimental study into the decision-making processes and thinking dispositions of osteopathy students
Spadaccini, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2014/12
1595

“Making Strange”: A role for the humanities in medical education
Vincent, F.
International Journal of Osteopathic Medicine, 2014/12
1596

The role of clinicians in osteopathic research
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/12
1597

CV4 vs Meditation: Die Auswirkungen auf das vegetative Nervensystem verglichen anhand der Herzratenvariabilität
(The impact of CV4 vs meditation on the vegetative nervous system measured by analysis of heart-rate variability: a comparative study)
Buschatzky, B.
Unpublished MSc thesis, 2014/12
Free full text
1598

Passive Bewegungstestung in Rotation und Seitneigung mit der Beurteilung des Endgefühls im Segment C0/C1 (Interrater- und Intrarater Reliabilitätsstudie)
(Passive movement testing in rotation and lateral flexion for the assessment of the end feel in segment C0/C1 (interrater and intrarater reliability study))
Neuwirth, B.
Unpublished MSc thesis, 2014/12
Free full text
1599

Intertester-Reliabilitätsprüfung einer visceralen Mobilitätsuntersuchung an der Leberzone
(Examination of the Intertester Reliability of a passive visceral mobility palpation on the hepatic area)
Zeller, U.
Unpublished MSc thesis, 2014/12
Free full text
1600

(Passive movement testing in rotation and lateral flexion for the assessment of the end feel in segment C0/C1 (interrater and intrarater reliability study))
Passive Bewegungstestung in Rotation und Seitneigung mit der Beurteilung des Endgefühls im Segment C0/C1 (Interrater- und Intrarater Reliabilitätsstudie)
Neuwirth, B.
Unpublished MSc thesis, 2014/12
Free full text
1601

Credibility of a comparative sham control intervention for craniosacral therapy in patients with chronic neck pain
Haller, H., Ostermann, T., Lauche, R., Cramer, H., Dobos, G.
Complementary Therapies in Medicine, 2014/12
1602

A prodromal, musculoskeletal presentation of Parkinson's disease: A case report
Simpson, P. A.
International Journal of Osteopathic Medicine, 2014/12
1603

Osteopathic manual therapy as an adjunct treatment for self-management of breast cancer related lymphoedema: the lived experience of lymphoedema and osteopathic treatment
Henderson, K.
Unpublished MSc thesis, 2014/12
Free full text
1604

Safeguarding children in osteopathic practice: Part 1: Identifying children at risk
Maddick, A. F., Feld, A., Laurent, S.
International Journal of Osteopathic Medicine, 2014/12
1605

Using the Strain-Counterstrain Approach to Highlight the Body Unity Within Osteopathic Treatment
Dixneuf, A., Ghattas, B.
The AAO Journal, 2014/11
Free full text
1606

Was zeigen osteopathische Tests an bei Patienten mit schmerzhaftem unteren Rücken (low back pain) die eine Modic 1- oder Modic 2-Veränderung haben im Vergleich zu einer Kontrollgruppe mit schmerzhaftem unteren Rücken ohne Modic-Veränderung ?
(What are showing osteopatic tests by patients with low back pain who have a modic 1 or a modic 2 change in comparison to a control group who has low back pain but no modic changes?)
Gutenkauf, F.
Unpublished MSc thesis, 2014/11
Free full text
1607

Prozess der Wahrnehmung und Interpretation von Palpationsbefunden
(Process of perception and interpretation of palpation findings).
Liem, T.
Osteopathische Medizin, 2014/11
1608

Beeinflussung des autonomen Nervensystems durch eine osteopathische Recoiltechnik am Sternum
(Influencing the autonomic nervous system through the application of an osteopathic recoil technique on the sternum)
Mayrhofer, D.
Unpublished MSc thesis, 2014/11
Free full text
1609

Desenvolvimento e aplicação de um protocolo osteopático de tratamento para bebês com refluxo
(Development and application of an osteopathic treatment protocol for infants with reflux)
Gemelli, M.
Unpublished MSc thesis, 2014/11
Free full text
1610

The Effect of Optimally Timed Osteopathic Manipulative Treatment on Length of Hospital Stay in Moderate and Late Preterm Infants: Results from a RCT
Pizzolorusso, G., Cerritelli, F., Accorsi, A., Lucci, C., Tubaldi, L., Lancellotti, J., Barlafante, G., Renzetti, C., D', Incecco, C., Perri, F. P.
Evidence-based Complementary and Alternative Medicine, 2014/11
Free full text
1611

Osteopathische Forschungsinstitutionen: eine Übersicht
(Osteopathic research institutions: an overview)
Newiger, C.
Osteopathische Medizin, 2014/11
1612

A modified Delphi consensus study to identify UK osteopathic profession research priorities
Rushton, A. B., Fawkes, C. A., Carnes, D., Moore, A. P.
Manual Therapy, 2014/10
1613

Dose-Response Research in Chiropractic Care and Possible Comparisons With OMT
King, H. H.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1614

Vergleichende Literaturanalyse über die Notwendigkeit der Einführung von Balintgruppen in die (Kinder-)Osteopathie
(Comparative literature analysis on the necessity of introducing balint groups into (pediatric) osteopathy)
Kohlmann, M.
unpublished MSc thesis, 2014/10
Free full text
1615

How to Win the Match Against Tennis Elbow: A Comparison of Different Techniques
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1616

Effekt von Lebermobilisation
(Effects of liver mobilization)
March, S.
Unpublished MSc thesis, 2014/10
Free full text
1617

Deformations experienced in the human skin, adipose tissue, and fascia in osteopathic manipulative medicine
Chaudhry, H., Bukiet, B., Ji, Z., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1618

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1619

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1620

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text
1621

Osteopaths' professional views, identities and conceptions – A qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/09
1622

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09
1623

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09
1624

Results, solutions, and learning: The continuing maturation of osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2014/09
1625

Umgestaltung eines Zahnersatzes nach osteopathischen Therapieprinzipien
(Redesigning a dental prosthesis according to osteopathic therapeutic principles)
Daum, H., Abt, J.
Osteopathische Medizin, 2014/09
1626

Gesetz gegen den unlauteren Wettbewerb und Heilmittelwerbegesetz
(Law against unfair competition and the law on the advertising of medicinal products)
Köber, C.
Osteopathische Medizin, 2014/09
1627

Osteopathie und ihre Effektivität bei craniomandibulärer Dysfunktion (CMD)
(Osteopathic efficiency regarding craniomandibular dysfunction (CMD))
Maron, A.
Unpublished MSc thesis, 2014/09
Free full text
1628

Osteopathie bei chronischen unteren Rückenschmerzen aus Sicht der PatientInnen. Eine qualitative Studie
(The patient's view on osteopathic treatment of chronic low back pain. A qualitative study)
Brenner, F.
Unpublished MSc thesis, 2014/09
Free full text
1629

Embryologie nach Blechschmidt – Entwicklung der Gliedmaßen
(Embryology according to Blechschmidt - development of the limbs)
Wojtowicz, A.
Osteopathische Medizin, 2014/09
1630

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text
1631

What about OMT and nutrition for managing the irritable bowel syndrome? An overview and treatment plan
Collebrusco, L., Lombardini, R.
Explore (NY), 2014/09
1632

Osteopathic Primary Care of Patients With Inflammatory Bowel Disease: A Review
Bragg, J. D.
The Journal of the American Osteopathic Association, 2014/09
Free full text
1633

Faszien und ihre Bedeutung für die Interozeption
(Fascia and its importance for interoception)
Schleip, R., Jäger, H.
Osteopathische Medizin, 2014/09
1634

Osteopathie und Naturheilkunde in der Schweiz
(Osteopathy and naturopathy in Switzerland)
Vogel, C.
Osteopathische Medizin, 2014/09
1635

Male spine motion during coitus: implications for the low back pain patient
Sidorkewicz, N., McGill, S. M.
Spine (Phila Pa 1976), 2014/09
1636

Multitasking behaviors of osteopathic medical students
Shah, A. V., Mullens, D. J., Van Duyn, L. J., Januchowski, R. P.
The Journal of the American Osteopathic Association, 2014/08
Free full text
1637

Quality of life in patients referring to private osteopathic clinical practice: A prospective observational study
Cerritelli, F., Verzella, M., Barlafante, G.
Complementary Therapies in Medicine, 2014/08
1638

Cost-effectiveness of manual therapy for the management of musculoskeletal conditions: a systematic review and narrative synthesis of evidence from randomized controlled trials
Tsertsvadze, A., Clar, C., Court, R., Clarke, A., Mistry, H., Sutcliffe, P.
Journal of Manipulative and Physiological Therapeutics, 2014/07
Free full text
1639

Impact of osteopathic treatment on pain in adult patients with cystic fibrosis--a pilot randomized controlled study
Hubert, D., Soubeiran, L., Gourmelon, F., Grenet, D., Serreau, R., Perrodeau, E., Zegarra-Parodi, R., Boutron, I.
PLoS One, 2014/07
Free full text
1640

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1641

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text
1642

Osteopathic Manipulative Treatment in Vestibular Neuritis: A Case Report
Ross, B. S., Johnson, V. M.
The AAO Journal, 2014/06
Free full text
1643

Treatment of Common Fibular (Peroneal) Nerve Palsy With Osteopathic Manipulative Medicine: A Case Study
Jahnke, B. M., Hopson, P., Worden, K.
The AAO Journal, 2014/06
Free full text
1644

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06
1645

New gestational osteopathy unit at the University Hospital Quiron San Jose of Madrid
Guzman Mora, R.
Revista de Enfermeria, 2014/06
1646

Vibration und Gewebewiederherstellung
(Vibration and tissue repair)
Garoli, A.
Osteopathische Medizin, 2014/06
1647

Osteopathie in Kenia – humanitäre Hilfe und Engagement gegen die weibliche Genitalverstümmelung
(Osteopathy in Kenya - Humanitarian aid and commitment against female genital mutilation)
Gassmaier, H.
Osteopathische Medizin, 2014/06
1648

Osteopathische Behandlung der Dura mater spinalis in der hochzervikalen Region
(Osteopathic treatment of the dura mater spinalis in the upper cervical region)
Liem, T.
Osteopathische Medizin, 2014/06
1649

The effect of cranial osteopathic manual therapy on somatic tinnitus in individuals without otic pathology: Two case reports with one year follow up
Arab, A. M., Nourbakhsh, M. R.
International Journal of Osteopathic Medicine, 2014/06
1650

An audit of the accuracy of medication documentation in a United Kingdom osteopathic training clinic before and after an educational intervention
Brunt, H., Abbey, H.
International Journal of Osteopathic Medicine, 2014/06
1651

Reprint of: Elevating the quality of disability and rehabilitation research: Mandatory use of the reporting guidelines
collective, Authors
International Journal of Osteopathic Medicine, 2014/06
Free full text
1652

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06
1653

Osteopathie als zusätzliche Leistung gesetzlicher Krankenkassen
(Osteopathy as an additional service of statutory health insurance companies.)
Newiger, C.
Osteopathische Medizin, 2014/06
1654

Effectiveness of osteopathic manipulative therapy for managing symptoms of irritable bowel syndrome: a systematic review
Muller, A., Franke, H., Resch, K.L., Fryer, G.
The Journal of the American Osteopathic Association, 2014/06
1655

Effect of osteopathic manipulative treatment on middle ear effusion following acute otitis media in young children: a pilot study
Steele, K. M., Carreiro, J. E., Viola, J. H., Conte, J. A., Ridpath, L. C.
The Journal of the American Osteopathic Association, 2014/06
Free full text
1656

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text
1657

Adrian Barnes MSc(Ost) D.O, principal of the European School of Osteopathy (ESO)
Fawkes, C.
Manual Therapy, 2014/06
Free full text
1658

Robin Kirk DO ND MSc 1939-2014
Collins, M., O'Brien, J., McCoy, R., Hamiliton, F.
Manual Therapy, 2014/06
Free full text
1659

Attributions, influences and outcomes for underrepresented and disadvantaged participants of a medical sciences enrichment pipeline program
Pinckney, C.
Unpublished Dissertation, 2014/05
Free full text
1660

The Journal of the American Osteopathic Association: the next generation
Orenstein, R.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1661

G.I. Joe: Could Visceral Osteopathy Help Fight the War against IBS?
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1662

Association of Low Back Pain, Somatic Dysfunction, and Lumbar Bone Mineral Density: Reproducibility of Findings
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J., Burton, D. C.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1663

Introducing an osteopathic approach into neonatology ward: the NE-O model
Cerritelli, F., Martelli, M., Renzetti, C., Pizzolorusso, G., Cozzolino, V., Barlafante, G.
Chiropractic & Manual Therapies, 2014/05
Free full text
1664

Investigation into factors influencing roles, relationships, and referrals in integrative medicine
Gray, B., Orrock, P.
The Journal of Alternative and Complementary Medicine, 2014/05
Free full text
1665

Effect of osteopathic manipulative therapy in the attentive performance of children with attention-deficit/hyperactivity disorder
Accorsi, A., Lucci, C., Di Mattia, L., Granchelli, C., Barlafante, G., Fini, F., Pizzolorusso, G., Cerritelli, F., Pincherle, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
1666

Does fascia hold memories?
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2014/04
Free full text
1667

Strain counterstrain technique to decrease tender point palpation pain compared to control conditions: a systematic review with meta-analysis
Wong, C. K., Abraham, T., Karimi, P., Ow-Wing, C.
Journal of Bodywork and Movement Therapies, 2014/04
1668

Anatomical landmark position--can we trust what we see? Results from an online reliability and validity study of osteopaths
Pattyn, E., Rajendran, D.
Manual Therapy, 2014/04
1669

The use of technology and perceptions of its effectiveness in training physicians
Mason, P. B., Turgeon, B. M., Cossman, J. S., Lay, D. M.
Medical Teacher, 2014/04
1670

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1671

Osteopathic management of mild leg length inequality with heel lift therapy: A pilot study analyzing altered gait kinetics and kinematics
Bens, S.
Unpublished MSc thesis, 2014/04
1672

Honoring the Medicine: searching for the embodiment of spiritual commitment and philosophy for student physicians
Roseman, J. L.
Advances in Mind-Body Medicine, 2014/04
1673

Unified graduate medical education accreditation: a better plow
Bulger, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1674

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text
1675

A profile of osteopathic care in private practices in the United Kingdom: a national pilot using standardised data collection
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
1676

Not Every Hero Wears a Cape. In Memoriam: Melicien Tettambel, DO, FAAO
Hruby, R. J.
The AAO Journal, 2014/03
Free full text
1677

Osteopathic student satisfaction and preparedness to practice: A comparative study
Luciani, E., Cerritelli, F., Waters, M., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/03
1678

Tonische Immobilität als häufige Ursache für funktionelle Störungen
(Tonic immobility as a common cause of functional disorders)
Fleischhauer, M., Krebs, C.A.
Osteopathische Medizin, 2014/03
1679

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03
1680

An investigation into the current practices and educational theories that underpin the teaching of palpation in osteopathic education: A Delphi study
Browning, S.
International Journal of Osteopathic Medicine, 2014/03
1681

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03
1682

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03
1683

Osteopathic manipulative therapy induces early plasma cytokine release and mobilization of a population of blood dendritic cells
Walkowski, S., Singh, M., Puertas, J., Pate, M., Goodrum, K., Benencia, F.
PLoS One, 2014/03
Free full text
1684

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly
Juhl, J. H.
The Journal of the American Osteopathic Association, 2014/02
Free full text
1685

Clinical decision-making and therapeutic approaches in osteopathy - a qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
Manual Therapy, 2014/02
1686

Response to Letter Regarding “Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly“
Noll, D. R.
The Journal of the American Osteopathic Association, 2014/02
Free full text
1687

Should osteopathic students applying to allopathic emergency medicine programs take the USMLE Exam?
Weizberg, M., Kass, D., Husain, A., Cohen, J., Hahn, B.
Western Journal of Emergency Medicine, 2014/02
Free full text
1688

The integration of the “spirituality in medicine“ curriculum into the osteopathic communication curriculum at Kansas City University of Medicine and Biosciences
Talley, J. A., Magie, R.
Academic Medicine, 2014/01
Free full text
1689

Pilot Study Comparing 2 Variations of Occipitomastoid Suture (OMS) Release and Their Effects on Blood Pressure and Pulse Rate in Prehypertensive and Hypertensive Individuals Compared With Normotensive Controls
Nelson, J. H., Barnes, P. L., Stouch, B., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2014/01
1690

Somatic dysfunction and fascia's gliding-potential
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text
1691

Spatial medicine--a call to 'arms'
Myers, T.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text
1692

Manual Therapy or Exercise Effective for Hip or Knee Osteoarthritis
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
1693

Componentes de formação no plano de estudos: a componente prática num curso profissional de osteopatia
(Training components in the syllabus: the practical component in a professional osteopathy course)
Barreto, N. M. S.
Unpublished MSc thesis, 2014/01
Free full text
1694

Clinical reasoning in osteopathy: an investigation of diagnostic hypothesis generation for patients with acute low back pain
Roots, S. A.
Unpublished MSc thesis, 2014/01
Free full text
1695

An evaluation of a facilitator-led ‘Run & Walk’ health promotion initiative targeting inactive adult males. Supported by Men's Health Trust New Zealand & Unitec Institute of Technology
McLeod, M.
Unpublished MSc thesis, 2014/01
Free full text
1696

Contacting with clarity: the communicative purposes of osteopathic touch
Barrington, A.
Unpublished MSc thesis, 2014/01
Free full text
1697

Osteopathic manipulative treatment of congenital talipes equinovarus: a case report
Andreoli, E., Troiani, A., Tucci, V., Barlafante, G., Cerritelli, F., Pizzolorusso, G., Renzetti, C., Vanni, D., Pantalone, A., Salini, V.
Journal of Bodywork and Movement Therapies, 2014/01
1698

Should we start carrying out HVT on disc herniations?
Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2013/12
1699

The OSCE in a pre-registration osteopathy program: Introduction and psychometric properties
Vaughan, B., Florentine, P.
International Journal of Osteopathic Medicine, 2013/12
1700

On the oft-debated question of what it means to be an osteopathic physician
Benzoni, T.
The Journal of the American Osteopathic Association, 2013/12
Free full text
1701

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text
1702

Osteopathic graduate medical education: a way forward
Terry, R.
The Journal of the American Osteopathic Association, 2013/12
Free full text
1703

Assessing undergraduate osteopaths in the identification of patients' excess body weight
Bright, P., Wasik, C.
International Journal of Osteopathic Medicine, 2013/12
1704

Treatment of refractory irritable bowel syndrome with visceral osteopathy: short-term and long-term results of a randomized trial
Attali, T. V., Bouchoucha, M., Benamouzig, R.
Journal of Digestive Diseases, 2013/12
1705

Outcomes of osteopathic manual treatment for chronic low back pain according to baseline pain severity: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Minotti, D. E.
Manual Therapy, 2013/12
Free full text
1706

Neu: strukturierte curriculare Fortbildung „Osteopathische Verfahren“
(New: structured curricular training “Osteopathic methods“)
Psczolla, M.
Manuelle Medizin, 2013/12
Free full text
1707

Plagiozephalie – Ursachen und Hintergründe
(Plagiocephaly - Causes and background)
Künzel, K.H., Hoermann, R.
Osteopathische Medizin, 2013/11
1708

Evidenzbasierte Medizin – der Goldstandard auch in der Osteopathie?
(Evidence-based medicine - the golden standard also in osteopathy?)
Hartwig, B.
Osteopathische Medizin, 2013/11
1709

Muscle energy technique versus corticosteroid injection for management of chronic lateral epicondylitis: randomized controlled trial with 1-year follow-up
Kucuksen, S., Yilmaz, H., Salli, A., Ugurlu, H.
Archives of Physical Medicine and Rehabilitation, 2013/11
Free full text
1710

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text
1711

In vitro biomechanical strain regulation of fibroblast wound healing
Cao, T. V., Hicks, M. R., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/11
Free full text
1712

Role of osteopathic structural diagnosis and osteopathic manipulative treatment for diabetes mellitus and its complications
Johnson, A. W., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2013/11
Free full text
1713

Fiabilitat Inter i Intraexaminador del Test Soto Hall en Persones Sanes.
(The inter and intra-examiner reliability of Soto hall test in healthy people)
Cònsol Urgellés, N, Nin Dalmau, M.
, 2013/11
1714

The attitudes and self-reported practices of New Zealand osteopaths to exercise consultation and its use within osteopathy
Mistry, R.
Unpublished MSc thesis, 2013/11
Free full text
1715

Systematic Review of CAM Approaches to Otitis Media: The Otolaryngology Perspective
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1716

Quantifying Lack of Interexaminer Reliability
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1717

Influence of Manual Therapy on Functional Mobility After Joint Injury in a Rat Model
Ruhlen, R. L., Snider, E. J., Sargentini, N. J., Worthington, B. D., Singh, V. K., Pazdernik, V. K., Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1718

Studienziel: Erhebung von Daten zur psychischen Belastung und Beanspruchung bei der Arbeit von Osteopathen in Deutschland. Studiendesign: Querschnittsstudie.
(Psychosocial working conditions of German osteopaths. Cross-sectional study)
Salandi, C.
Unpublished D.O. thesis, 2013/10
1719

Prevention of progressive back-specific dysfunction during pregnancy: an assessment of osteopathic manual treatment based on Cochrane Back Review Group criteria
Licciardone, J. C., Aryal, S.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1720

Retrospective medical record review of an osteopathic manipulative medicine hospital consultation service
Snider, K. T., Snider, E. J., DeGooyer, B. R., Bukowski, A. M., Fleming, R. K., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/10
Free full text
1721

The effects of osteopathic treatment on common femoral artery blood flow and skin temperature in spinal cord injured and able-bodied individuals
Murray, D.
Unpublished MSc thesis, 2013/10
Free full text
1722

Patients' appraisals of public and private healthcare: a qualitative study of physiotherapy and osteopathy
Bradbury, K. J., Bishop, F. L., Yardley, L., Lewith, G.
Journal of Health Psychology, 2013/10
1723

The effects of osteopathic treatment on non-specific chronic neck pain and disability
Gasson, M.
Unpublished MSc thesis, 2013/10
Free full text
1724

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly: An Observational Study
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text
1725

High-velocity low-amplitude thrust manipulation of the lumbar spine immediately modifies soleus T reflex in asymptomatic adults
Boët, C., Fugier, S., Marsault, J., Toublan, D., Valot, M.E., Cheval, A., Amyot d'Inville, G., Niel, S., Guihéneuc, P., Guihard, G.
International Journal of Osteopathic Medicine, 2013/09
1726

The repeatability of pressure algometry in asymptomatic individuals over consecutive days
Frank, L, McLaughlin, P, Vaughan, B
International Journal of Osteopathic Medicine, 2013/09
1727

A Prognostic approach to defining chronic pain across a range of musculoskeletal pain sites
Mason, J.
International Journal of Osteopathic Medicine, 2013/09
1728

Klinische Forschung in der Osteopathie – Teil 2: neuronale und organische Störungen
(Clinical research in osteopathy - Part 2: Neuronal and organic disorders)
Rauch, A.
Osteopathische Medizin, 2013/09
1729

Emotional Tissue – eine Annäherung
(Emotional tissue - An approach)
Hartwig, B.
Osteopathische Medizin, 2013/09
1730

Neurologische Betrachtung der Osteopathie
(Neurological consideration of osteopathy)
Eckardt, P.
Osteopathische Medizin, 2013/09
1731

Neurologische Integration nach Allan Phillips
(Neurological integration by Allan Phillips)
Eckardt, P.
Osteopathische Medizin, 2013/09
1732

The Use of Orthotics in the Reduction of Self-reported Pain Scores in a Veterans Affairs Population: a Retrospective Study
Lipton, J. A.
The AAO Journal, 2013/09
Free full text
1733

A single systems research design to examine the effectiveness of osteopathic treatment for people with osteoarthritis of the hip
Howat, T.
Unpublished MSc thesis, 2013/09
Free full text
1734

Offer and use of complementary and alternative medicine in hospitals of the French-speaking part of Switzerland
Carruzzo, P., Graz, B., Rodondi, P. Y., Michaud, P. A.
Swiss Medical Weekly, 2013/09
Free full text
1735

Evaluation of the acceptability of Peer Physical Examination (PPE) in medical and osteopathic students: a cross sectional survey
Consorti, F., Mancuso, R., Piccolo, A., Consorti, G., Zurlo, J.
BMC Medical Education, 2013/08
Free full text
1736

One of ours
Burhop, J.
The Journal of the American Osteopathic Association, 2013/08
Free full text
1737

Portfolios in Osteopathic Medical Education: A Qualitative Pilot Study
Miner, A., Pierce, L. J., Sidhu, K., Menini, T.
The Journal of the American Osteopathic Association, 2013/08
1738

Osteopathic Manipulative Therapy Affects the Position of Internal Organs in Humans
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1739

Wer waren eigentlich …
(Who actually were ...)
Lewis, J. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1740

Patienteninfo: Warum ist die Bauchlage für Säuglinge so wichtig?
(Patient information: Why is the prone position so important for infants?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1741

Effects of craniosacral therapy as adjunct to standard treatment for pelvic girdle pain in pregnant women: a multicenter, single blind, randomized controlled trial
Elden, H., Ostgaard, H. C., Glantz, A., Marciniak, P., Linner, A. C., Olsen, M. F.
ACTA Obstetricia et Gynecologica Scandinavica, 2013/07
Free full text
1742

Osteopathic manipulative treatment for facial numbness and pain after whiplash injury
Genese, J. S.
The Journal of the American Osteopathic Association, 2013/07
Free full text
1743

Die frühkindliche Bewegungsentwicklung
(Early childhood movement development)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1744

Oxytocingabe während der Geburt und ADHS
(Oxytocin during birth and ADHD)
Fleischer, F.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
1745

Osteopathic manipulative treatment for pediatric conditions: a systematic review
Posadzki, P., Lee, M. S., Ernst, E.
Pediatrics, 2013/07
1746

Efficacy of osteopathy and other manual treatment approaches for malocclusion – A systematic review of evidence
Andresen, T., Bahr, C., Ciranna-Raab, C.
International Journal of Osteopathic Medicine, 2013/06
1747

Does lumbar spinal movement differ between patients who are healthy, those with simple low back pain and those with degenerative or pre-operative spinal conditions?
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2013/06
1748

Spiegelneuronen – ein unentbehrliches Werkzeug in der Osteopathie
(Mirror neurons - An indispensable tool in osteopathy)
Von Gimborn, G.
Osteopathische Medizin, 2013/06
1749

Klinische Forschung in der Osteopathie – Teil 1: muskuloskelettale Störungen
(Clinical research in osteopathy - Part 1: Musculoskeletal disorders)
Rauch, A.
Osteopathische Medizin, 2013/06
1750

Neurolymphatische Bahnen: neue wissenschaftliche Nachweise untermauern die Perrin-Technik
(Neurolymphatic pathways: New scientific evidences corroborate the Perrin technique)
Perrin, R. N.
Osteopathische Medizin, 2013/06
1751

Perrin-Technik am Beispiel des chronischen Müdigkeitssyndroms
(Perrin technique using chronic fatigue syndrome as an example)
Perrin, R. N.
Osteopathische Medizin, 2013/06
1752

Osteopathie und Unfruchtbarkeit
(Osteopathy and infertility)
Kermorgant, G.
Osteopathische Medizin, 2013/06
1753

Osteopathic manipulative treatment and nutrition: An alternative approach to the irritable bowel syndrome
Collebrusco, L., Lombardini, R.
Health, 2013/06
Free full text
1754

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text
1755

Osteopathic manual treatment in patients with diabetes mellitus and comorbid chronic low back pain: subgroup results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2013/06
Free full text
1756

Distance learning and osteopathic manipulative medicine
Blumer, J. U.
The AAO Journal, 2013/06
Free full text
1757

Osteopathic evaluation of somatic dysfunction and craniosacral strain pattern among preterm and term newborns
Pizzolorusso, G., Cerritelli, F., D', Orazio, M., Cozzolino, V., Turi, P., Renzetti, C., Barlafante, G., D', Incecco, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
1758

Complementary and alternative medicine for pediatric otitis media
Levi, J. R., Brody, R. M., McKee-Cole, K., Pribitkin, E., O'Reilly, R.
International Journal of Pediatric Otorhinolaryngology, 2013/06
1759

He walked with confidence into the wilderness of life: a tribute to Philip E. Greenman, DO (1928-2013)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
1760

An osteopathic approach to gastrointestinal disease: somatic clues for diagnosis and clinical challenges associated with Helicobacter pylori antibiotic resistance
Smilowicz, A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
1761

Sham manual medicine protocol for cervical strain-counterstrain research
Brose, S. W., Jennings, D. C., Kwok, J., Stuart, C. L., O', Connell, S. M., Pauli, H. A., Liu, B.
PM&R: The Journal of Injury, Function and Rehabilitation, 2013/05
1762

Severity of Irritable Bowel Syndrome Symptoms Is Reduced by Osteopathy
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1763

Manual Therapy May Benefit Women With Interstitial Cystitis and Pelvic Floor Pain
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1764

Response
Suminski, R. R., Wasserman, J. A., Guillory, V. J., Hendrix, D., May, L. E.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1765

Effect of osteopathic manipulative treatment on length of stay in a population of preterm infants: a randomized controlled trial
Cerritelli, F., Pizzolorusso, G., Ciardelli, F., La Mola, E., Cozzolino, V., Renzetti, C., D'Incecco, C., Fusilli, P., Sabatino, G., Barlafante, G.
BMC Pediatrics, 2013/04
Free full text
1766

Trial designs and exploration of the placebo response
Dieppe, P.
Complementary Therapies in Medicine, 2013/04
Free full text
1767

Osteopathic postdoctoral training institutions and academic sponsorship
Biszewski, M.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1768

A survey to determine the attitudes towards complementary and alternative medicine by users in Cape Town
Du Plessis, S.
Unpublished MSc thesis, 2013/04
Free full text
1769

Bibliometric measures and National Institutes of Health funding at COMs, 2006-2010
Gugliucci, A.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1770

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1771

Impact indices shed false light
McDonald, R. G.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1772

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
1773

The effects of experience on the inter-reliability of osteopaths to detect changes in posterior superior iliac spine levels using a hidden heel wedge
Sutton, C., Nono, L., Johnston, R. G., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2013/04
1774

Clinical decision making and therapeutic approaches of experienced osteopaths
Thomson, O.
Unpublished PhD thesis, 2013/04
Free full text
1775

Developing a chronic pain self-management clinic at the British School of Osteopathy: Quantitative pilot study results
Abbey, H., Nanke, L.
International Journal of Osteopathic Medicine, 2013/03
1776

Can a high-velocity low-amplitude thrust manipulation of C1-2 affect active depression of the temporomandibular joint in a symptomatic population?
Fisher, G., Ramadan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/03
1777

Clinical reasoning and therapeutic approaches of experienced osteopaths
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
1778

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03
1779

Osteopathie im Kontext der italienischen Politik
(Osteopathy in the context of Italian politics)
Tozzi, P.
Osteopathische Medizin, 2013/03
1780

Wie sehen die Finger? Unbewusste Wahrnehmung als eine Grundlage der Intuition
(How do the fingers see? Unconscious perception as a basis of intuition)
Sidler, S.
Osteopathische Medizin, 2013/03
1781

Enuresis als Folge eines erhöhten Drucks in den Kavitäten – ein Fallbeispiel
(Enuresis as a consequence of an increased pressure in the cavities – A case study)
Klein, M.
Osteopathische Medizin, 2013/03
1782

Special issue: Osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2013/03
1783

Electromyographic responses of deep thoracic transversospinalis muscles to osteopathic manipulative interventions
Fryer, G., Bird, M., Robbins, B., Johnson, J. C.
International Journal of Osteopathic Medicine, 2013/03
1784

An Exploration of Emerging Professional Identity in Women Osteopathic Medical Students: Does Gender Matter?
Dunatov, L. J.
Unpublished Dissertation, 2013/03
1785

Evaluating teaching methods and assessment tools of high velocity low amplitude techniques for undergraduate osteopathic manipulative treatment of the spine
Channell, M. K.
The AAO Journal, 2013/03
Free full text
1786

Osteopathic manipulative treatment of pes anserine bursitis using the triple technique: A case report
Chmielewski, R., Peña, N., Capalbo, G.
The AAO Journal, 2013/03
Free full text
1787

Langzeiteffekte osteopathischer Behandlungen bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom : 5-Jahres-Follow-up einer randomisiert kontrollierten Studie und Uberlegungen zum pathophysiologischen Kontext.
(Long-term effects of osteopathic treatment of chronic prostatitis with chronic pelvic pain syndrome: a 5-year follow-up of a randomized controlled trial and considerations on the pathophysiological context)
Marx, S., Cimniak, U., Rutz, M., Resch, K.L.
Urologe A, 2013/03
1788

Achieving Effective and Efficient Musculoskeletal Pain Relief Through TCM and OMM
Moy, C., Yu, J., Chiu, R., Hwang, Y. C., Lin, W., Lin, S.L., Burns, J., Lin, A.
The Journal of the American Osteopathic Association, 2013/03
1789

Reliabilität der Testung der abdominalen Diaphragmaspannung im Seitenvergleich (Interrater-Test Retest Studie)
(The Test of the Abdominal Diaphragm Tension and its Reliability concerning the Right and Left Body (Interrater-Test Retest Study))
Gruber, S.
Unpublished MSc thesis, 2013/03
Free full text
1790

Is craniosacral therapy effective for migraine? Tested with HIT-6 Questionnaire
Arnadottir, T. S., Sigurdardottir, A. K.
Complementary Therapies in Clinical Practice, 2013/02
1791

How patients choose osteopaths: a mixed methods study
Bishop, F. L., Bradbury, K., Hj Jeludin, N. N., Massey, Y., Lewith, G. T.
Complementary Therapies in Medicine, 2013/02
1792

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
1793

Fracture healing with osteopathy in traditional Mongolian medicine
Zhao, N., Wang, M., Li, X.
Journal of Traditional Chinese Medicine, 2013/02
Free full text
1794

Comparison of gait training versus cranial osteopathy in patients with Parkinson's disease: a pilot study
Muller, T., Pietsch, A.
NeuroRehabilitation, 2013/02
1795

Abdominal Visceral Manipulation Prevents and Reduces Peritoneal Adhesions
Seffinger, M. A., Martin, A. J.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1796

Die Rolle des Diaphragmas bei der lymphatischen Absorption aus der Peritonealhöhle
(The role of the diaphragm in lymphatic absorption from the peritoneal cavity)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
1797

Untersuchung der Wirksamkeit der Osteopathie im Rahmen der gesundheitsbedingten Lebensqualität im Wochenbett
(Investigating the efficacy of Osteopathy in Childbed - regarding the health related quality of life of the mothers)
Dlugos, J. M.
Unpublished MSc thesis, 2013/01
Free full text
1798

Gibt es einen Zusammenhang zwischen der Beweglichkeit der Halswirbelsäule bei Personen mit Überbiss und Personen mit normaler Okklusion?
(Is There A Difference In The Range Of Cervical Motion Between People With An Overbite And People With A Normal Occlusion?)
Bracken, P. G.
Unpublished MSc thesis, 2013/01
Free full text
1799

Beschwerden in der Schwangerschaft – Kann Osteopathie die Lebensqualität beeinflussen?
(Complaints during pregnancy – Can osteopathy influence the patient’s quality of life?)
Göttlich, G.
Unpublished MSc thesis, 2013/01
Free full text
1800

Response to “Geographic patterns in primary care visits provided by osteopathic physicians“
Fordyce, M. A., Chen, F. M., Doescher, M. P., Hart, L. G.
Family Medicine, 2013/01
Free full text
1801

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1802

Biotensegrity: a unifying theory of biological architecture with applications to osteopathic practice, education, and research--a review and analysis
Swanson, R. L.
The Journal of the American Osteopathic Association, 2013/01
Free full text
1803

A comparative study of cervical hysteresis characteristics after various osteopathic manipulative treatment (OMT) modalities
Barnes, P. L., Laboy, F., Noto-Bell, L., Ferencz, V., Nelson, J., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2013/01
1804

Visceral massage reduces postoperative ileus in a rat model
Chapelle, S. L., Bove, G. M.
Journal of Bodywork and Movement Therapies, 2013/01
1805

Investigating inter-relationships between pain, mobility, and posture following osteopathic treatment in patients with chronic neck pain
Frith, K. L.
Unpublished MSc thesis, 2013/01
Free full text
1806

Thermographic Skin Measurement and Osteopathic Palpation of Tibial Interosseous Strains in Adults A Comparative Pilot Study.
Muntinga, E.
Unpublished D.O. thesis, 2013
1807

Nouvelle technique passive d’ouverture de la trompe d’Eustache. Évaluation par tympanométrie de l’effet d’une nouvelle manipulation sur l’ouverture de la trompe d’Eustache chez les enfants de moins de six ans atteints d’une otite moyenne avec ou sans effusion
(New passive technique for opening the Eustachian tube. Evaluation by tympanometry of the effect of a new manipulation on the opening of the Eustachian tube in children under six years of age with otitis media with or without effusion)
El Hachem, N., Halimi, M.
Kinésithérapie, la Revue, 2012/12
Free full text
1808

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12
1809

Methods of assessment used by osteopathic educational institutions
Vaughan, B., Sullivan, V., Gosling, C., McLaughlin, P., Fryer, G., Wolff, M., Gabb, R.
International Journal of Osteopathic Medicine, 2012/12
1810

A systematic review to evaluate the clinical benefits of craniosacral therapy
Jäkel, A., von Hauenschild, P.
Complementary Therapies in Medicine, 2012/12
1811

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1812

Electronic Medical Records Adoption and Usage Among Osteopathic Physicians in New York State
Rosenthal, J. I.
Unpublished PhD thesis, 2012/12
1813

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1814

Establishing the content validity of palpatory examination for the assessment of the lumbar spine using ultrasonography: a pilot study
Shaw, K. A., Dougherty, J. J., Treffer, K. D., Glaros, A. G.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1815

Depression, somatization, and somatic dysfunction in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Gatchel, R. J., Kearns, C. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2012/12
Free full text
1816

The effect of osteopathic manual therapy on the vascular supply to the lower extremity in individuals with knee osteoarthritis: A randomized trial
Jardine, W. M., Gillis, C., Rutherford, D.
International Journal of Osteopathic Medicine, 2012/12
1817

Investigation into the role subject foot position has on the assessment of the Seated Flexion Test and a test of inter-rater reliability
Silva, M. J., Boudakian, C., Hruby, R.
The AAO Journal, 2012/12
Free full text
1818

Suture restriction of the temporal bone as a risk factor for acute otitis media in children: cohort study
Morin, C., Dorion, D., Moutquin, J.M., Levasseur, M.
BMC Pediatrics, 2012/11
Free full text
1819

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1820

Bibliometric measures and National Institutes of Health funding at colleges of osteopathic medicine, 2006-2010
Suminski, R. R., Hendrix, D., May, L. E., Wasserman, J. A., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/11
Free full text
1821

Bemerkenswerte Fortschritte bei behinderten Patienten durch „evolutionäre Osteopathie“
(Remarkable progress in disabled patients through “evolutionary osteopathy“)
Deslee, E., Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1822

Einfluss der osteopathischen Behandlung auf die Lebensqualität von Kindern und Jugendlichen mit Asthma. Prä-Post Studie.
(The influence of osteopathic treatment on quality of life in children and adolescents with asthma. A pre-post study)
Berning, F., Hagoort, J.
Unpublished D.O. thesis, 2012/10
1823

What is 'fascia'? A review of different nomenclatures
Schleip, R., Jager, H., Klingler, W.
Journal of Bodywork and Movement Therapies, 2012/10
Free full text
1824

Patienteninfo: Wie viel raffinierter Zucker ist gesund?
(Patient information: How much refined sugar is healthy?)
Jongschaap, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1825

Die Auswirkungen von osteopathischen Behandlungen bei Patient/innen mit dem Fibromyalgiesyndrom. Prä-Post Studie.
(Osteopathic treatment effects in patients with fibromyalgia. Pre-Post Study)
Gleich, A., Klein, C., Sheriff, S.
Unpublished D.O. thesis, 2012/10
Free full text
1826

Evaluation der Interindividuellen Reliabilität eines osteopathischen Gewebetests (Gesamtgewebe-Restriktions-Tests/All Tissue Tension Test). Eine diagnostische Studie.
(The All Tissue Tension Test (A Triple T): Evaluation of Interrater Reliability. Diagnostic Study)
Krieger, A., Roggendorf, M.
Unpublished D.O. thesis, 2012/10
1827

Wirksamkeit osteopathischer Behandlungen bei Kindern mit habitueller, idiopathischer Epistaxis. Randomisierte kontrollierte Studie
Effectiveness of osteopathic treatment in children with . A randomized controlled trial.
Bergau, R, Strunk, A
Unpublished D.O. thesis, 2012/10
1828

Osteopathic manipulative treatment in obese patients with chronic low back pain: a pilot study
Vismara, L., Cimolin, V., Menegoni, F., Zaina, F., Galli, M., Negrini, S., Villa, V., Capodaglio, P.
Manual Therapy, 2012/10
Free full text
1829

Geographic patterns in primary care visits provided by osteopathic physicians
Licciardone, J. C.
Family Medicine, 2012/10
1830

Heterotaxien in der menschlichen Entwicklung
(Heterotaxies in human development)
Doll, S.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
1831

Combined manual therapy techniques for the treatment of women with infertility: a case series
Kramp, M. E.
The Journal of the American Osteopathic Association, 2012/10
Free full text
1832

Inter and intra-rater reliability of rating criteria for the Floor Sitting Posture Screen
Houvenagel, M.
Unpublished MSc thesis, 2012/10
Free full text
1833

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text
1834

Osteopathic manipulative treatment of somatic dysfunction as an integral component in the care of patients with chronic medical disease: A thirty-month study in rural Appalachia
Litman, R. G.
The AAO Journal, 2012/09
Free full text
1835

Osteopathic education: Editorial call for papers
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2012/09
1836

Consent and information exchange – A burden or opportunity?
Vogel, S.
International Journal of Osteopathic Medicine, 2012/09
1837

Die Anamnese in der Osteopathie - Theorie und Praxis
(Case History Taking in Osteopathy - Theory and Practice)
Mena, J. E.R.
Unpublished MSc thesis, 2012/09
Free full text
1838

Osteopathie und ihre Effektivität bei Fasciitis plantaris
(Osteopathy and its effectiveness in fasciitis plantaris)
Burmeister, S.
Unpublished MSc thesis, 2012/09
Free full text
1839

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving the quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Gulisano, V., Orfei, S.
Clinical Cases in Mineral and Bone Metabolism, 2012/09
Free full text
1840

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text
1841

Advancing osteopathic medicine through research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2012/09
Free full text
1842

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text
1843

Consent, competence and confidentiality for children and young people: Case problems from osteopathic practice
Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2012/09
1844

What puts the adverse in 'adverse events'? Patients' perceptions of post-treatment experiences in osteopathy - a qualitative study using focus groups
Rajendran, D., Bright, P., Bettles, S., Carnes, D., Mullinger, B.
Manual Therapy, 2012/08
1845

Osteopathy improves the severity of irritable bowel syndrome: a pilot randomized sham-controlled study
Florance, B. M., Frin, G., Dainese, R., Nebot-Vivinus, M. H., Marine Barjoan, E., Marjoux, S., Laurens, J. P., Payrouse, J. L., Hebuterne, X., Piche, T.
European Journal of Gastroenterology & Hepatology, 2012/08
Free full text
1846

Preventative Osteopathic Manipulative Treatment and the Elderly Nursing Home Resident: A Pilot Study
Snider, K. T., Snider, E. J., Johnson, J. C., Hagan, C., Schoenwald, C.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1847

Touch: vital to patient-physician relationships
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/08
Free full text
1848

Putting on White Coats: Professional Socialization of Medical Students Through Narrative Pedagogy in Standardized Patient Labs
Patterson, S. D.
Unpublished PhD thesis, 2012/08
Free full text
1849

Packende Fachartikel – So geht es
(Writing gripping professional articles - Here's how)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
1850

Spiritualität in der Osteopathie
(Spirituality in osteopathy)
Schantl, G.
Unpublished MSc thesis, 2012/07
Free full text
1851

From clinical experience to a model for the human fascial system
Day, J. A., Copetti, L., Rucli, G.
Journal of Bodywork and Movement Therapies, 2012/07
1852

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1853

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1854

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1855

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text
1856

Is the methodological quality of trials on spinal manipulative therapy for low-back pain improving?
Rubinstein, S. M., Terwee, C. B., de Boer, M. R., van Tulder, M. W.
International Journal of Osteopathic Medicine, 2012/06
1857

A consideration of the elbow as a tensegrity structure
Scarr, G.
International Journal of Osteopathic Medicine, 2012/06
1858

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06
1859

Anatomie des Neugeborenen unter besonderer Berücksichtigung des Schädels und der oberen Halswirbelsäule
(Anatomy of the newborn with special consideration of the cranium and the upper cervical spine)
Beck, M.
Osteopathische Medizin, 2012/06
1860

Differenzierung myofaszialer Schmerzpunkte in Genese und Therapie
(Differentiation of myofascial pain points in genesis and treatment)
Eisenreich, U.
Osteopathische Medizin, 2012/06
1861

Kommentar zur HVT-Technik bei Säuglingen und Kleinkindern
(Comment on the HVT technique in infants and small children)
Gillemot, B.
Osteopathische Medizin, 2012/06
1862

Rigor in medical writing: quoting accurately
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
1863

Osteopathic manipulative treatment in pregnant women
Lavelle, J. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
1864

Application of osteopathic manipulative treatment to a patient with unremitting chest pain and shortness of breath undergoing “Rule-Out Myocardial Infarction” protocol for one week
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/06
1865

The White-Coat Dilemma: Are Collaborative Practices the Answer to the Primary Care Shortage?
Murthy, K. K.
Unpublished MSc thesis, 2012/05
Free full text
1866

Thanks but no thanks: how denial of osteopathic service in the world wars shaped the profession
Schriner, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text
1867

The ART of palpation?
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2012/04
Free full text
1868

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1869

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1870

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
1871

Wasser, Licht, Luft, Eis und das 16. Europäische Symposium der Traditionellen Osteopathie
(Report: Water, light, air, ice and the 16th European Symposium of Traditional Osteopathy)
Vellmer, S.
Osteopathische Medizin, 2012/03
1872

Osteopathische Therapie in der Migränebehandlung: eine randomisierte kontrollierte Studie über die Wirksamkeit
(Osteopathic medicine: Osteopathic therapy in the treatment of migraine: A randomized controlled study about the effectiveness)
Burmeister, U., Beck, M., Voigt, K., Liebnitzky, J., Bergmann, A.
Osteopathische Medizin, 2012/03
1873

Osteopathie und Wissenschaft
(Osteopathy and science)
Liem, T., Hilbrecht, H., Schmidt, T.
Osteopathische Medizin, 2012/03
1874

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03
1875

Reflex Relationships of Paravertebral Muscles
Elbe, J. N.
The AAO Journal, 2012/03
Free full text
1876

Spontaneous Release by Positioning
Jones, L. H.
The AAO Journal, 2012/03
Free full text
1877

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text
1878

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03
1879

Reporting new developments in sacroiliac imaging and lymphatic pump techniques
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2012/03
1880

A pilot study to compare the views of traditionally trained and CAM-trained therapists using the clinical exemplar of the management of neck/upper limb pain to assess barriers to effective integration of approaches
Denyer, K., Smith, H., Davies, K., Horne, R., Hankins, M., Walker-Bone, K.
Complementary Therapies in Medicine, 2012/02-04
1881

Osteopathic manipulative treatment effectiveness in severe chronic obstructive pulmonary disease: a pilot study
Zanotti, E., Berardinelli, P., Bizzarri, C., Civardi, A., Manstretta, A., Rossetti, S., Fracchia, C.
Complementary Therapies in Medicine, 2012/02-04
Free full text
1882

Strain counterstrain: current concepts and clinical evidence
Wong, C. K.
Manual Therapy, 2012/02
1883

Hat der Osteopath einen bestimmten Persönlichkeitstypus?
(What is the personality type of an osteopath?)
Och, V.
Unpublished MSc thesis, 2012/02
Free full text
1884

Über den Zugang von Osteopathen zu erwachsenen Patienten im neurologischen Bereich in Österreich
(About the access of osteopaths to adult patients in the neurological field in Austria)
Müntner, A.
Unpublished MSc thesis, 2012/02
Free full text
1885

Osteopathische Einflussmöglichkeiten auf die fetale Kopfposition im mütterlichen Becken bei Erstgebärenden
(Osteopathic possibilities to influence the fetal head position in the maternal pelvis in primipara)
Wünsch, A.
Unpublished MSc thesis, 2012/02
Free full text
1886

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text
1887

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1888

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
1889

Beeinflusst die CV4 - Technik die Anpassungsfähigkeit für große und extreme Höhen?
(Does the CV4 technique influence adaptability to great and extreme heights)
Pichler, M.
Unpublished MSc thesis, 2012/01
Free full text
1890

Vergleichende Analyse der Curricula der Osteopathie Ausbildungen mit Masterabschluss an der European School of Osteopathy, ESO, Großbritannien und der Internationalen Schule für Osteopathie, WSO, Österreich
(A Comparative Analysis of the Curricula of the European School of Osteopathy, ESO, UK and the International School of Osteopathy, WSO, Austria leading to a Master‘s Degree)
Düpree, B.
Unpublished MSc thesis, 2012/01
Free full text
1891

Visceral mobilization can lyse and prevent peritoneal adhesions in a rat model
Bove, G. M., Chapelle, S. L.
Journal of Bodywork and Movement Therapies, 2012/01
1892

Spirituality in collegiate athletics and sports medicine: perceptions, sources and sustainability
Janiski, C.
Unpublished MSc thesis, 2012/01
Free full text
1893

Use of therapies other than disease-modifying agents, including complementary and alternative medicine, by patients with multiple sclerosis: a survey study
Stoll, S. S., Nieves, C., Tabby, D. S., Schwartzman, R.
The Journal of the American Osteopathic Association, 2012/01
Free full text
1894

Cranial osteopathic manipulative medicine's growing evidence base
King, H. H.
The Journal of the American Osteopathic Association, 2012/01
Free full text
1895

The immediate effect of osteopathic ‘rib raising’ technique on heart rate variability: a randomised sham controlled experiment
White, N.
Unpublished MSc thesis, 2012/01
Free full text
1896

A hypothesis to explain the palpatory experience and therapeutic claims in the practice of osteopathy in the cranial field
Hamm, D.
International Journal of Osteopathic Medicine, 2011/12
1897

The effect of thoracic spine high-velocity low-amplitude thrust manipulation on myoelectric activity of the lower trapezius and posterior deltoid muscles during treadmill walking
McChesney, B. D., Haig, L., Gissane, C.
International Journal of Osteopathic Medicine, 2011/12
1898

Towards a more international community in osteopathy
Moran, R. W.
International Journal of Osteopathic Medicine, 2011/12
1899

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12
1900

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
1901

Background and methodology of the Osteopathic Survey of Health Care in America 2010 (OSTEOSURV 2010)
Licciardone, J. C., Kearns, C. M., Ruggiere, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
1902

Consulting parents about the design of a randomized controlled trial of osteopathy for children with cerebral palsy
Edwards, V., Wyatt, K., Logan, S., Britten, N.
Health Expectations, 2011/12
1903

Increasing the number of osteopathic graduate medical education programs–“The time has come…”
Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text
1904

What is health? What is disease? Thoughts on a complex issue
Flatscher, M., Liem, T.
The AAO Journal, 2011/12
Free full text
1905

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text
1906

Perspectives on quality assurance methods – A comparison of osteopathic programmes in two countries: A pilot study
Michelson, H. C.
Unpublished MSc thesis, 2011/12
Free full text
1907

Wirksamkeit einer osteopathischen Behandlung bei Kinetose
(Effectiveness of an osteopathic treatment of motion sickness)
Thiel, O. L.
Osteopathische Medizin, 2011/12
1908

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text
1909

Innenstrukturen des Thorax
(Internal structures of the thorax)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1910

Patienteninfo: Obstruktive Bronchitis im Kindesalter
(Patient information: Obstructive bronchitis in childhood)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
1911

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09
1912

The effect of strain counterstrain (SCS) on forearm strength compared to sham positioning
Wong, C. K., Moskovitz, N., Fabillar, R.
International Journal of Osteopathic Medicine, 2011/09
1913

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text
1914

Hat eine Intervention an der Schädelbasis Einfluss auf das Prämenstruelle Syndrom?
(Does an intervention at the cranial base have an influence on premenstrual syndrome?)
Hödl, S.
Unpublished MSc thesis, 2011/09
Free full text
1915

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text
1916

Lebensqualitätssteigerung bei osteopathischer Behandlung
(Increased Quality of Life in Osteopathic Therapy)
Bordás, R.
Unpublished MSc thesis, 2011/09
Free full text
1917

Interrater-Reliabilität bei der Beurteilung der Körpersprache nach dem Fasziendistorsionsmodell (FDM)
(Interrater reliability in evaluating the body language based on the Fascial Distortion Model (FDM))
Anker, S.
Unpublished MSc thesis, 2011/09
Free full text
1918

Neubewertung der klassischen osteopathischen Feldtheorie am Beispiel von Perzeption und Wahrnehmung
(Reevaluation of the classic osteopathic field theory using perception and cognition as example)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/09
1919

Call for papers: An invitation to contribute to a special issue on osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2011/09
1920

Dynamics of indicators of quality of life in patients with chronic pain syndrome in the lumbus and lower extremities after osteopathic treatment
Yakovets, G. V., Novoseltsev, S. V.
The AAO Journal, 2011/09
Free full text
1921

Spondylogenic-cranial biomechanic disorders in patients with chronic cerebrovascular insufficiency in the vertebrobasilar basin and their osteopathic correction
Novoseltsev, S. V.
The AAO Journal, 2011/09
1922

Eating our seed corn, again!
Berkowitz, M. R.
The AAO Journal, 2011/09
Free full text
1923

Efecto de las técnicas de articulación y manipulación sobre los apoyos plantares en el antepié varo infantil
(Effect of articulation and manipulation techniques on plantar support in varus forefoot in children)
Ángeles Franco, M., Villarroya, A., Marcén, Y., Gómez-Gámez, A.
Osteopatía Científica, 2011/09
1924

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09
1925

Criterios de calidad en investigación osteopática (III)
(Quality criteria for osteopathic research (III))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/09
1926

What Drew You to Osteopathic Medicine? A Survey of Osteopathic Medical Students From 10 Schools
Draper, B. B., Johnson, J. C., Chamberlain, N.
The Journal of the American Osteopathic Association, 2011/08
1927

Using Palpation Technology Feedback to Improve Interexaminer Reliability
Ferencz, V., Klucka, G. M., Myers, N., Nelson, J., Vardy, T., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2011/08
1928

Lymphatic Pump Treatment of Rats With Adjuvant-Induced Arthritis
Shah, P., Zanotti, B., Woods, J. M., Volin, M.
The Journal of the American Osteopathic Association, 2011/08
1929

Osteopathic Medical Students' Attitude Toward Complementary and Alternative Medicine
Shubrook, J. H., Kanadiya, M. K.
The Journal of the American Osteopathic Association, 2011/08
1930

Re: The Fall of the postural-structural-biomechanical model in manual therapy: exemplified by lower back pain. A response to reviewers and further thoughts
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/07
1931

Opinions on research and evidence based medicine within the UK osteopathic profession: A thematic analysis of public documents 2003–2009
Humpage, C.
International Journal of Osteopathic Medicine, 2011/06
1932

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06
1933

Research: A way of helping us be less wrong
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2011/06
1934

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06
1935

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text
1936

Eine empirische Studie zum beruflichen Selbstverständnis von OsteopathInnen und deren Einstellung zur gesetzlichen Anerkennung der Osteopathie
(An Empirical Study on the Professional Self-Conception of Osteopaths and Their Attitude towards the Legal Acknowledgement of Osteopathy)
Riermeier, R.
Unpublished MSc thesis, 2011/06
Free full text
1937

Influence of craniosacral therapy on anxiety, depression and quality of life in patients with fibromyalgia
Mataran-Penarrocha, G. A., Castro-Sanchez, A. M., Garcia, G. C., Moreno-Lorenzo, C., Carreno, T. P., Zafra, M. D.
Evidence-Based Complementary and Alternative Medicine, 2011/06
Free full text
1938

Analysis of AOA/ACGME accredited family medicine residency programs
Terry, R., Hill, F.
Family Medicine, 2011/06
1939

Der Begriff der Ganzheit/Ganzheitlichkeit in der Osteopathie im Wandel der Zeit
(The concept of wholeness in osteopathy over the course of time)
Ziebermayr, B.
Unpublished MSc thesis, 2011/06
Free full text
1940

Osteopathie bei Kindern und Jugendlichen mit juveniler idiopathischer Arthritis
(Osteopathy for children and adolescents with juvenile idiopathic arthritis)
Strohmayer, A.
Unpublished MSc thesis, 2011/06
Free full text
1941

Die Behandlung des Reizdarmsyndroms mit Osteopathie
(Treatment of irritable bowel syndrome with osteopathy)
Scheuchl, F. G.
Unpublished MSc thesis, 2011/06
Free full text
1942

The effectiveness of osteopathic treatment in women with endometriosis-related pain
Schneider-Milo, U.
Unpublished MSc thesis, 2011/06
Free full text
1943

Palpatory accuracy of lumbar spinous processes using multiple bony landmarks
Snider, K. T., Snider, E. J., Degenhardt, B. F., Johnson, J. C., Kribs, J. W.
Journal of Manipulative and Physiological Therapeutics, 2011/06
Free full text
1944

Überblick und Vergleich der in Österreich angebotenen Bildungsmöglichkeiten im Teilbereich Craniosacrale Osteopathie
(Overview and Comparison of the educational possibilities offered in Austria in the section craniosacralic osteopathy)
Berthold, L.
Unpublished MSc thesis, 2011/06
Free full text
1945

Diagnostic Palpation in Osteopathic Medicine: A Putative Neurocognitive Model of Expertise
Esteves, J. E. d. J.
Unpublished PhD thesis, 2011/06
Free full text
1946

Klassische Osteopathie: eine Feldtheorie als Vorbild und Grundlage
(Classic osteopathy: A field theory as a model and basis)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/06
1947

Patients’ perceptions of post-treatment experiences in osteopathy: A qualitative study using focus groups
Bright, P., Rajendran, D., Bettles, S., Carnes, D., Mullinger, B.
European Journal of Integrative Medicine, 2011/06
Free full text
1948

The immediate effects of muscle energy technique on posterior shoulder tightness: a randomized controlled trial
Moore, S. D., Laudner, K. G., McLoda, T. A., Shaffer, M. A.
Journal of Orthopaedic & Sports Physical Therapy, 2011/06
Free full text
1949

Flawed science is not evidence-based osteopathic medicine
Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text
1950

Wechselseitige Beziehungsdynamiken und subjektive Ansätze in der Osteopathie
(Dynamics of reciprocal correlations and subjective approaches in osteopathy)
Liem, T.
Osteopathische Medizin, 2011/06
1951

Der Einfluss von Rudolf Virchow auf Andrew Taylor Still – eine kulturwissenschaftliche Untersuchung
(The influence of Rudolf Virchow on Andrew Taylor Still - A cultural scientific investigation)
Nagel, M., Bahr, C., Ciranna-Raab, C.
Osteopathische Medizin, 2011/06
1952

Überlegungen zur Untersuchung und Behandlung der Pleura parietalis über periphere Faszienanheftungen
(Deliberations about the examination and treatment of the parietal pleura over peripheral fascial fixations)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2011/06
1953

Wirkung des CV4 auf Übelkeit, Erbrechen und Lebensqualität im Verlauf der Chemotherapie
(Effects of the CV4 technique on nausea, vomiting and quality of life during chemotherapy)
Berger, U.
Unpublished MSc thesis, 2011/06
Free full text
1954

Der viszeral assoziierte Schulterschmerz
(Viscerally Associated Shoulder Pain. Subjective Perspectives and Diagnostic Procedures ? The Osteopathic Point of View)
Fischer, U.
Unpublished MSc thesis, 2011/06
Free full text
1955

Entwicklung eines Scores zur Untersuchung der Kopfgelenke von Säuglingen und Bestimmung der Interraterreliabilität
(Development of a score for the examination of the atlantoaxial joint of infants and for the diagnose of interrate reliabilities)
Jakubczyk, M.
Unpublished MSc thesis, 2011/06
Free full text
1956

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1957

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?: a pilot study
Newberry, M. A., Bowen, G. S., Trubey, K., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1958

Gesundheit als Metapher. Welche Konzepte für Gesundheit haben deutschsprachige OsteopathInnen mit akademischem Hintergrund?
(Health as Metaphor - What are the concepts of health of German speaking osteopaths with an academic background?)
Risch, A. J.
Unpublished MSc thesis, 2011/05
Free full text
1959

Global Listening - Ein Test mit vielen Facetten
(Global Listening - a test with many facets)
Krall, B.
Unpublished MSc thesis, 2011/05
Free full text
1960

The Impact of an Osteopathic Medical Program on Information Technology Skills of Physicians Entering the Workforce
Bronsburg, S. E.
Unpublished PhD thesis, 2011/05
1961

One osteopathic physician's path through an ACGME-Accredited Residency
Patchett, D. C.
The Journal of the American Osteopathic Association, 2011/05
Free full text
1962

Técnica de thrust para disfunción posterior unilateral del cóndilo occipital
(Thrust technique for unilateral posterior dysfunction of the occipital condyle)
Pérez Cátedra, P., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
1963

Criterios de calidad en investigación osteopática (II)
(Quality criteria in osteopathic research (II))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/05
1964

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1965

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1966

Osteopathic Issues Raised by the September 2010 JAOA
Patriquin, D. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1967

Understanding osteopathic medical school applicants and the class of 2014
Ramos, R. L., Zhou, C., Hasan, M., Herrera, S. J., Bono, N. A., Hallas, B. H.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1968

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1969

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1970

Evaluation of colleges of osteopathic medicine: training for the evaluators
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text
1971

A rich seam
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04
1972

The fall of the postural-structural-biomechanical model in manual and physical therapies: exemplified by lower back pain
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/04
1973

An Osteopathic Approach to Chronic Sinusitis
Lee-Wong, M., Karagic, M., Doshi, A., Gomez, S., Resnick, D.
Journal of Allergy & Therapy, 2011/04
Free full text
1974

Health care professionalisation: a case study of osteopathy in the United Kingdom and the Osteopaths Act 1993
McClune, T. D. M.
Unpublished MSc thesis, 2011/04
Free full text
1975

Bringing fresh perspective to muscle energy technique
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2011/03
1976

Helical tensegrity as a structural mechanism in human anatomy
Scarr, G.
International Journal of Osteopathic Medicine, 2011/03
1977

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
1978

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
1979

Osteopathische Behandlung bei Schwindel: eine Pilotstudie
(Osteopathic treatment for vertigo: A pilot study)
Fraix, M.
Osteopathische Medizin, 2011/03
1980

Osteopathie an Kliniken (Interviews)
(Osteopathy in hospitals)
Hogrefe, H.C., Graf, A., Bockius, D.
Osteopathische Medizin, 2011/03
1981

Os osteopatas em Portugal: processo de profissionalização e formação identitária
(The Osteopaths in Portugal: Professionalisation and Identity)
Henriques, A. J. d. P. B.
Unpublished MSc thesis, 2011/03
Free full text
1982

Osteopathic Manipulative Treatment of Isolated Chronic Sphenoidal Sinusitis in a Post-Sinus Surgery Patient: A Case Report
Shah, R., Berkowitz, M. R.
The AAO Journal, 2011/03
Free full text
1983

From The Archives: From: Fryette, HH. Principles of Osteopathic Technique. Carmel, CA: American Academy of Osteopathy, 1954. 61-64.
Fryette, H.H.
The AAO Journal, 2011/03
Free full text
1984

Osteopathic Scholarship, Research and Publication
Berkowitz, M. R.
The AAO Journal, 2011/03
Free full text
1985

Prinzipien der osteopathischen Notfalltechniken nach Robert Rousse
(Principles of osteopathic emergency techniques according to Robert Rouse)
Prediger, G.
Osteopathische Medizin, 2011/03
1986

„Hier treffe ich Leute, die was zu sagen haben. Im Sinne von Erfahrung.“
(“Here, I meet people who have something to say. In the sense of experience“)
Vellmer, S.
Osteopathische Medizin, 2011/03
1987

Von Littlejohn lernen: Osteopathie als angewandte biologische Wissenschaft (Teil 2)
(Learning from Littlejohn: Osteopathy as an Applied Biological Science (Part 2))
Pöttner, M., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1988

Chronische Prostatitis: Gemeinsam geht's besser! 
(Chronic prostatitis: Let's work together!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1989

Einschränkungen der Therapierfreiheit des Heilpraktikers im Urogenitalbereich
(Restrictions on the freedom of therapy of the alternative practitioner in the urogenital area)
Ulusal, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
1990

Low back pain, somatic dysfunction, and segmental bone mineral density T-score variation in the lumbar spine
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J.
The Journal of the American Osteopathic Association, 2011/02
Free full text
1991

Management of suppurative cervical lymphadenitis in a healthy 24-year-old man
Hernandez, M., Chowdhury, R., Woods, J., Cabrera, J., Hardigan, P. C.
The Journal of the American Osteopathic Association, 2011/01
Free full text
1992

Student abstracts and poster competitions: encouraging research
Prinsen, J. K.
The Journal of the American Osteopathic Association, 2011/01
Free full text
1993

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text
1994

A randomized controlled trial investigating the effects of craniosacral therapy on pain and heart rate variability in fibromyalgia patients
Castro-Sánchez, A. M., Matarán-Peñarrocha, G. A., Sánchez-Labraca, N., Quesada-Rubio, J. M., Granero-Molina, J., Moreno-Lorenzo, C.
Clinical Rehabilitation, 2011/01
1995

Osteopathy and (hatha) yoga
Liem, T.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text
1996

Manualtherapie bei Insertionstendinosen: Fersensporn, Patellaspitzensyndrom, Tennisellenbogen, Schultersteife
(Manual therapy for insertional tendinosis)
Müller, R., Linz, W., Buchmann, J.
MMW - Fortschritte der Medizin, 2011/01
1997

What really does it have to do with osteopathy anyway? New Zealand osteopath practitioners talk about rural Māori health
Awatere, S. A.
Unpublished MSc thesis, 2011/01
Free full text
1998

“D.O. or die“: identity negotiation among osteopathic medical students
Norander, S., Mazer, J. P., Bates, B. R.
Health Communication, 2011/01
Free full text
1999

Effect of Spinal Manipulation on Corticospinal and Stretch Reflex Excitability in Patients With Chronic Low Back Pain
Goss, D. A., Walkowski, S. A., Ross, A. J., Thomas, J. S., Hoffman, R. L., Clark, B. C.
The Journal of the American Osteopathic Association, 2011/01
2000

Osteopathic Manipulative Medicine in the Andes Mountains of Peru
Harding, S. E., Morse, J. S., Berkowitz, M. R., Tidwell, C., Bishop, K., Tidewell, B., Cruz, M. L., Morris-Mitchell, M.
The Journal of the American Osteopathic Association, 2011/01
2001

OMM and TCM: Comparisons of Manipulative Treatment
Zhang, A., Chen, S., Yen, H.R.
The Journal of the American Osteopathic Association, 2011/01
2002

A preliminary investigation into the attitudes and practices of New Zealand osteopaths in relation to the health care system: Does the future hold a greater degree of integration into the biomedical system?
Rose, L.
Unpublished MSc thesis, 2011/01
Free full text
2003

Structural or cranial osteopathy: Factors influencing practitioner preference
Norrie, J.
Unpublished MSc thesis, 2011/01
Free full text
2004

Women’s attitudes to and experiences of osteopathic care during pregnancy
Kurth, A.
Unpublished MSc thesis, 2011/01
Free full text
2005

An exploration of the experience of parents in the osteopathic treatment of their infants
Gardner, K.
Unpublished MSc thesis, 2011/01
Free full text
2006

What are the factors that guide an osteopath during the process of technique choice?
Albertson, P.
Unpublished MSc thesis, 2011/01
Free full text
2007

Criterios de calidad en investigación osteopática (I)
(Quality criteria for osteopathic research (I))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/01
2008

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011
2009

Osteopathic Treatment for Irritable Bowel Syndrome. A Systematic Review.
Müller, A.
Unpublished MSc thesis, 2011
Free full text
2010

Veränderung der Wurfgenauigkeit und Wurfgeschwindigkeit bei Handballspielerinnen nach osteopathischer Intervention
(Changes in the Throwing Accuracy and Throwing Velocity of Competitive Female Handball Players after Osteopathic Intervention)
Bitter, H.
Unpublished MSc thesis, 2010/12
Free full text
2011

The accuracy of diagnostic palpation: the comparison of soft tissue findings with random blood sugar in diabetic patients
Nelson, K. E., Mnabhi, A. K. S., Glonek, T.
Osteopathic Family Physician, 2010/12
2012

On the Role of the Glossary
Berkowitz, M. R.
The AAO Journal, 2010/12
Free full text
2013

Ist das Global Listening reliabel? Studie zur Intrarater- und Interrater-Reliabilität des Global Listenings
(Intraobserver and Interobserver Reliability of the Global Listening)
Rittler, M.
Unpublished MSc thesis, 2010/12
Free full text
2014

Osteopathic Medicine's Holistic Approach Is More Important Than Ever
Goldberg, P. M.
The Journal of the American Osteopathic Association, 2010/12
Free full text
2015

Progression through osteopathic training in Australia: The student experience
Hartup, J. K., Murphy, R. A., Plowman, L. M., Myers, R.
International Journal of Osteopathic Medicine, 2010/12
2016

Osteopathie und ihre Wirkung auf die „Spastizität“ bei posttraumatischer Rückenmarksläsion
(Osteopathy and its effect on “spasticity“ related to post-traumatic spinal cord lesions)
Riedl, B.
Unpublished MSc thesis, 2010/12
Free full text
2017

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 2: Treatment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
2018

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 1: Assessment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
2019

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text
2020

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text
2021

Integrating Osteopathic Principle into Daily Practice
Hruby, R. J.
The AAO Journal, 2010/12
Free full text
2022

How the AOA established the first national guidelines for OMT
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2010/11
Free full text
2023

Reliability of bony anatomic landmark asymmetry assessment in the lumbopelvic region: application to osteopathic medical education
Stovall, B. A., Kumar, S.
The Journal of the American Osteopathic Association, 2010/11
Free full text
2024

Das Schädeldach als Tensegrity-Struktur
(The cranial roof as a tensegrity structure)
Scarr, G., Hinz, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
2025

Systematische Übersichtsarbeit über Definition, Nomenklatur und Klassifikation der Säuglingsasymmetrie bzw. Schiefhals bei Säuglingen.
(A Systematic Review on the Definition, Nomenclature and Classification on Infantile Asymmetry, respectively, Torticolllis in Infants)
Wagner, C.
Unpublished D.O. thesis, 2010/10
2026

Management of benign paroxysmal positional vertigo with the canalith repositioning maneuver in the emergency department setting
Burmeister, D. B., Sacco, R., Rupp, V.
The Journal of the American Osteopathic Association, 2010/10
Free full text
2027

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests over a 4-month period
Degenhardt, B. F., Johnson, J. C., Snider, K. T., Snider, E. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text
2028

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text
2029

Von Littlejohn lernen: Osteopathie – angewandte Wissenschaft (Teil 1)
(Learning from Littlejohn: Osteopathy as an Applied Science (Part 1))
Pöttner, M., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
2030

Test-dependent osteopathic treatment of patients with tinnitus and craniomandibular dysfunctions (CMD): A pre-post pilot trial
Salomon, J., Kronau, S., Moshövel, N., Niggemeier, H., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09/
2031

Osteopathic manipulative treatment in a patient with idiopathic dysautonomia: a case presentation
Cromeens, B., Gamber, R.
Osteopathic Family Physician, 2010/09
2032

Intertester Reliabilität von Palpationsbefunden von Dysfunktionen der Synchondrosis Sphenobasilaris
(Intertester reliability of palpation findings concerning synchondrosis sphenobasilaris dysfunctions)
Mitterlehner, T.
Unpublished MSc thesis, 2010/09
Free full text
2033

Admitting International Osteopathic Physicians and Osteopaths to Osteopathic Graduate Medical Education Programs
Berkowitz, M. R.
The AAO Journal, 2010/09
Free full text
2034

Alexander-Technik – Grundlagen und Parallelen zur Osteopathie
(The Alexander Technique Principles and parallels to osteopathy)
Eisenreich, U.
Osteopathische Medizin, 2010/09
2035

Übertragener Muskelschmerz ist primär peripheren Ursprungs: die Barrier-Dam-Hypothese
(Referred muscle pain is primarily of peripheral origin: The barrier-dam theory)
Farasyn, A.
Osteopathische Medizin, 2010/09
2036

Tensegrity in der Osteopathie
(Tensegrity in osteopathy)
Pflüger, C.
Osteopathische Medizin, 2010/09
2037

The use of spinal and sacroiliac joint assessment and treatment procedures within the British osteopathic profession
Fryer, G., Johnson, J. C.
International Journal of Osteopathic Medicine, 2010/09
2038

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Mosca, G., Orfei, S.
International Journal of Osteopathic Medicine, 2010/09
2039

Hamo-Study 3, Phase 1: Effects of sternotomy on the mobility of the heart under influence of respiration at 3-months postoperative
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2010/09
2040

Adverse events and treatment reactions in osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2010/09
2041

Exploring European osteopathic identity: An analysis of the professional websites of European osteopathic organizations
Wagner, C., van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2010/09
2042

Objetivación de las diferencias en la movilidad del cráneo a través del rodamiento alternativo de temporales
(Objectifcation of differences in cranial mobility through the alternative rocking of temporal bones)
Ratto, G. D., Cascales, M. M., Martínez Mateo, D.
Osteopatía Científica, 2010/09
2043

Efectos de la desactivación de los puntos-gatillo de los músculos de la pantorrilla en las fascitis plantares
(The effects of calf muscle trigger-points disactivation in plantar fasciitis)
Renan Ordine, R., Alburquerque Sendín, F.
Osteopatía Científica, 2010/09
2044

Investigación en osteopatía en el ámbito internacional
(Research in osteopathy at the international level)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/09
2045

Differential Effects of Suboccipital Inhibition and Fourth Ventricle Compression On Heart Rate Variability: Evidence For Bi-Directional Modulation Of Autonomic Tone
Snider, E. J., Snider, K. T., Halma, K. D., Fossum, C., Fryer, G., Yang, Q., Mueller, G., Bluml, E. M., Purcell, E.
The Journal of the American Osteopathic Association, 2010/08
2046

Assessment of Anterior Superior Iliac Spine Asymmetry by Osteopathic Predoctoral Fellows and Osteopathic Physicians
Stovall, B. A., Bae, S., Kumar, S.
The Journal of the American Osteopathic Association, 2010/08
2047

Osteopathic manipulative treatment and vertigo: a pilot study
Fraix, M.
PM&R: The Journal of Injury, Function and Rehabilitation, 2010/07
2048

Characteristics of pediatric patients seen in medical school-based osteopathic manipulative medicine clinics
Lund, G., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/07
Free full text
2049

Defining osteopathic medicine: can you put your finger on it?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2010/07
Free full text
2050

Osteopathische Techniken bei Nasennebenhöhlenentzündung
(Osteopathic techniques in sinusitis)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
2051

What is 'manipulation'? A reappraisal
Evans, D. W., Lucas, N.
Manual Therapy, 2010/06
Free full text
2052

Comparison of muscle energy technique and positional release therapy in acute low back pain – RCT
Naik, P. P., Heggannavar, A., Khatri, S. M.
Indian Journal of Physiotherapy & Occupational Therapy, 2010/06
Free full text
2053

Evidence Does Not Grow Stale with Age
Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text
2054

Kognitive Gruppen-Verhaltenstherapie in der primären Gesundheitsversorgung bei LWS-Syndrom: eine randomisierte, kontrollierte Studie und Analyse der Kostenwirksamkeit
(Group cognitive behavioral intervention in primary care in low back pain: A randomized, controlled study and analysis of cost-effectiveness)
Lamb, S. E., Hansen, Z., Lall, R., Castelnuova, E., Withers, E., Nichols, V., Potter, R.
Osteopathische Medizin, 2010/06
2055

Fließende Kunst an Körper und Seele: die traditionelle Thai-Massage
(Flowing art on body and soul: The traditional Thai massage)
Möller, H.
Osteopathische Medizin, 2010/06
2056

Methoden der osteopathischen Diagnostik und der Reflexdiagnostik bei Zervikalgiepatienten
(Methods of osteopathic diagnostics and reflex diagnostics in patients with cervicalgia)
Usupbékova, B. C., Mokhov, D. E., Vasilenko, A. M., Paoletti, S.
Osteopathische Medizin, 2010/06
2057

A delayed and innocuous presentation of odontoid peg fracture – Implications for osteopaths
Chakraverty, J. K., Snelling, N. J., Thomas, G., Uzoigwe, C.
International Journal of Osteopathic Medicine, 2010/06
2058

Mindfulness meditation practise as a healthcare intervention: A systematic review
Mars, T. S., Abbey, H.
International Journal of Osteopathic Medicine, 2010/06
2059

On the biopsychosocial model, mindfulness meditation and improving teaching and learning in osteopathy technique
Moran, R.
International Journal of Osteopathic Medicine, 2010/06
2060

Diagnostyka fizjoterapeutyczna i osteopatyczna w zawodowych zaburzeniach glosu.
(The application of physiotherapeutic and ostheopatic diagnostics in occupational voice disorders)
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Kowalska, M. S.
Medycyna Pracy, 2010/06
2061

The challenges of primary care and innovative responses in osteopathic education
Shannon, S. C., Ferretti, S. M., Wood, D., Levitan, T.
Health Affairs, 2010/05
2062

Validación del test de movilidad en flexión-extensión de tobillo para la articulación tibioperonea superior comparado con radiología
(Validation of the ankle tibiofibular flexion-extension test compared to radiology)
Bazzolo, R. J. L., Legal, L.
Osteopatía Científica, 2010/05
2063

Modificaciones radiológicas del espacio entre el occipucio y el cuerpo del atlas tras una manipulación global (OAA) de Fryette
(Radiological changes in the atlanto-occipital space after Fryette global manipulation (OAA))
Otaño, L., Legal, L.
Osteopatía Científica, 2010/05
2064

Brief report of a clinical trial on the duration of middle ear effusion in young children using a standardized osteopathic manipulative medicine protocol
Steele, K. M., Viola, J., Burns, E., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text
2065

El desarrollo científico de la osteopatía en el ámbito internacional
(Scientific development of osteopathy at international level)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/05
2066

Osteopathische Behandlung von homonymen Gesichtsfeldausfällen bei Erwachsenen mit erworbener Hirnschädigung im Zuge des stationären Rehabilitationsaufenthaltes
(Osteopathy relating to homonymous hemianoptic failures with adults with acquired brain damage in the course of the stationary rehabilitation phase)
Fäßlacher, W.
Unpublished MSc thesis, 2010/05
Free full text
2067

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text
2068

Ursprung, Raum und Wirklichkeit faszialer Motilität
(Origin, Space and Reality of Fascial Motility)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
2069

Call to action: aggressively managing lipid levels
Carr, L. L.
The Journal of the American Osteopathic Association, 2010/04
Free full text
2070

Effect of osteopathy in the cranial field on visual function--a pilot study
Sandhouse, M. E., Shechtman, D., Sorkin, R., Drowos, J. L., Caban-Martinez III., A. J., Patterson, M. M., Shallo-Hoffmann, J., Hardigan, P., Snyder, A.
The Journal of the American Osteopathic Association, 2010/04
Free full text
2071

Musculoskeletal dysfunction and drop foot: diagnosis and management using OMM
Sucher, B. M.
The Journal of the American Osteopathic Association, 2010/04
Free full text
2072

14. Europäisches Symposium der traditionellen Osteopathie
(14th European Symposium of Traditional Osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
2073

Kontraktilität von Faszien
(Contractility of Fascias – How is This Behavior Possible?)
Brand, E.M.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
2074

Assessment of ADHD documentation from candidates requesting Americans With Disabilities Act (ADA) accommodations for the National Board of Osteopathic Medical Examiners COMLEX exam
Joy, J. A., Julius, R. J., Akter, R., Baron, D. A.
Journal of Attention Disorders, 2010/04
2075

Admitting Allopathic Physicians to Osteopathic Graduate Medical Education Programs: the Case for Competency-Based NMM/OMM Training in OGME
Berkowitz, M. R.
The AAO Journal, 2010/03
Free full text
2076

Relevanz der Intuition in der Osteopathie – Überlegungen und ein Literaturüberblick
(Relevance of intuition in osteopathy - Considerations and a literature overview)
Sidler, S.
Osteopathische Medizin, 2010/03
2077

Osteopathic neuromuscular re-abilitation
Lederman, E.
International Journal of Osteopathic Medicine, 2010/03
2078

Osteopathy 2.0: Osteopathy and the new web
Lucas, N. P.
International Journal of Osteopathic Medicine, 2010/03
2079

Composite sacroiliac joint pain provocation tests: A question of clinical significance
McGrath, M. C.
International Journal of Osteopathic Medicine, 2010/03
2080

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text
2081

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text
2082

Uniform instruction using web-based, asynchronous technology in a geographically distributed clinical clerkship: analysis of osteopathic medical student participation and satisfaction
Peska, D. N., Lewis, K. O.
The Journal of the American Osteopathic Association, 2010/03
Free full text
2083

Osteopathic medical education in 2010: another decade of growth
Shannon, S. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
2084

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
2085

Use of osteopathic manipulative treatment to manage compensated trendelenburg gait caused by sacroiliac somatic dysfunction
Gilliss, A. C., Swanson II., R. L., Janora, D., Venkataraman, V.
The Journal of the American Osteopathic Association, 2010/02
Free full text
2086

The myth of core stability
Lederman, E.
Journal of Bodywork and Movement Therapies, 2010/01
2087

Fascia: A missing link in our understanding of the pathology of fibromyalgia
Liptan, G. L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text
2088

DO • Korrespondenten berichten - Die Entwicklung der Osteopathie in der Schweiz
(DO • Correspondents reporting - The development of osteopathy in Switzerland)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
Free full text
2089

Accreditation standards of DO- and MD-granting medical schools: an incomplete comparison
Hunt, D., Barzansky, B., Sabalis, R.
Academic Medicine, 2010/01
Free full text
2090

Relationship between COMLEX and USMLE scores among osteopathic medical students who take both examinations
Chick, D. A., Friedman, H. P., Young, V. B., Solomon, D.
Teaching and Learning in Medicine, 2010/01
2091

Using standardized patients to assess the communication skills of graduating physicians for the comprehensive osteopathic medical licensing examination (COMLEX) level 2-performance evaluation (level 2-PE)
Weidner, A. C., Gimpel, J. R., Boulet, J. R., Solomon, M.
Teaching and Learning in Medicine, 2010/01
2092

Inter-Intrareabilitätsstudie zur Testung cranialer Strukturen im Konzept der ''Mechanischen Vernetzung'' (Lien Mechanik Osteopathy-LMO)
(Inter-examiner Study for cranial Structures in the examination record of Lien Mechanique Osteopatique (LMO))
Richter-Schultz, K.
Unpublished MSc thesis, 2010/01
Free full text
2093

Osteopathic Medicine and Primary Care: one journal, two audiences
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2010/01
Free full text
2094

El enfoque holístico de la osteopatía y la investigación multidisciplinar
(The holistic approach of osteopathy and multidisciplinary research)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/01
2095

Modificaciones inmediatas en la dinámica uterina tras la realización de la técnica de equilibración de la sincondrosis esfenobasilar según Upledger
(Immediate changes in the uterine dynamics after application of the balancing technique in the sphenobasilar synchondrosis according Upledger)
Vecino Rodríguez, A., Martínez Loza, E.
Osteopatía Científica, 2010/01
2096

Inter-Intrareabilitätsstudie zur Testung cranialer Strukturen im Konzept der ''Mechanischen Vernetzung'' (Lien Mechanik Osteopathy-LMO)
(Inter-examiner Study for cranial Structures in the examination record of Lien Mechanique Osteopatique (LMO))
Richter-Schultz, K.
Unpublished MSc thesis, 2010/01
Free full text
2097

Correlación entre el diagnóstico de lesiones osteopáticas de la articulación sacroilíaca obtenido mediante la aplicación del Test de Movilidad de Espinas Ilíacas Postero Superiores (EIPS), el test de flexión de cadera de Gillet y el downing test, en pacientes con dolor de espalda bajo
(Correlation between diagnosis of osteopathic lesions of the sacro iliac joint obtained by applying The test of Mobility of Posterior Superior Iliac Spines (PSIS), the test of flexion of hip of Gillet and downing test, in patients with low back pain)
Ramírez Cumplido, B. E.
Unpublished MSc thesis, 2010/01
Free full text
2098

Das viszerale Faszienskelett des Bauchraums
(The Visceral Fascial Skeleton of the Abdominal Cavity)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
2099

Erkenntnisfindung in der Osteopathie des 20. Jahrhunderts – J. M. Littlejohn versus Sutherland Cranial Teaching Foundation
(Gaining Knowledge in the Osteopathy of the 20th Century)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
2100

Development of a preliminary questionnaire to investigate the attitudes of NZ osteopaths regarding the use of exercise in osteopathy
Mckay-Watts, R.
Unpublished MSc thesis, 2010/01
Free full text
2101

An exploration of the influences that shape the opinions and practices of osteopaths in relation to osteopathy in the cranial field
Braybrook, J. E.
Unpublished MSc thesis, 2010/01
Free full text
2102

Perception of osteopathic medicine among allopathic physicians in the deep central southern United States
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text
2103

Musculoskeletal dysfunction and drop foot: diagnosis and management using osteopathic manipulative medicine
Lavelle, J. M., McKeigue, M. E.
The Journal of the American Osteopathic Association, 2009/12
Free full text
2104

NICE clinical guidelines. Low back pain: The early management of persistent non-specific back pain
Vogel, S.
International Journal of Osteopathic Medicine, 2009/12
Free full text
2105

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text
2106

Osteopathic Education and Training – Advocating the Adoption of an External Paradigm for Residency Training in NMM/OMM
Berkowitz, M. R.
The AAO Journal, 2009/12
Free full text
2107

Empathie als Teil des Wahrnehmungsprozesses in der Osteopathie Teil II
(Empathy as part of the perception process in osteopathy, part 2)
Fiedler, I. C.
Unpublished MSc thesis, 2009/12
Free full text
2108

Unilateral cross-bite and possible interrelations with the loading of the foot in the stance phase
Pichorner, C.
Unpublished MSc thesis, 2009/12
Free full text
2109

Der Einfluss der osteopathischen Behandlung auf die respiratorische Leistung bei Kindern mit Asthma bronchiale
(The influence of osteopathic treatment on the respiratory capabilities of children suffering from asthma)
Schäfer, E.M.
Unpublished MSc thesis, 2009/12
Free full text
2110

Discrimination against DOs alive and well
Hoegerl, C.
The Journal of the American Osteopathic Association, 2009/12
Free full text
2111

Osteopathic manipulative treatment in the management of notalgia paresthetica
Richardson, B. S., Way, B. V., Speece III., A. J.
The Journal of the American Osteopathic Association, 2009/11
Free full text
2112

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text
2113

Complementary and alternative health care use in young children with physical disabilities waiting for rehabilitation services in Canada
April, K. T., Feldman, D. E., Zunzunegui, M. V., Descarreaux, M., Grilli, L.
Disability and Rehabilitation, 2009/11
2114

Chronische Prostatitis/chronisches Beckenschmerzsyndrom. Einfluss osteopathischer Behandlungen - eine randomisiert kontrollierte Studie.
(Chronic prostatitis/chronic pelvic pain syndrome. Influence of osteopathic treatment - a randomized controlled study)
Marx, S., Cimniak, U., Beckert, R., Schwerla, F., Resch, K.L.
Urologe A, 2009/11
2115

The difference on weight bearing asymmetry in the frontal plane by treating the upper cervical spine with HVLA- Thrust or Strain/Counterstrain
Bauer, K.H.
Unpublished MSc thesis, 2009/11
Free full text
2116

Reliabilitätsstudie über die Befunderhebung der Wirbelsäule nach der Methode der Lien Mécanique Ostéopathique
(A reliability study on spine findings according to the LMO method)
Hafen-Bardella, C.
Unpublished MSc thesis, 2009/11
Free full text
2117

Schulmedizin – Osteopathie Das Wissen zur Osteopathie und deren Akzeptanz bei Ärzten im Kanton Zürich
(Conventional Medicine vs. Osteopathy: Knowledge of Osteopathy and its Acceptance by Conventionally Trained Physicians in the Canton of Zurich)
Wiesend, K.
Unpublished MSc thesis, 2009/11
Free full text
2118

Personality types and performance: COMLEX-USA Level 2-CE
Getz, R., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2009/10
Free full text
2119

Personality types and performance on aptitude and achievement tests
Kimmelman, M., Giacobbe, J., Switala, C. A.
The Journal of the American Osteopathic Association, 2009/10
Free full text
2120

Osteopathie bei saisonal bedingter allergischer Rhinokonjunktivitis. Eine randomisierte kontrollierte Studie
Osteopathic treatment on Seasonal Allergic Rhinoconjuntivitis. A randomized controlled trial
Sachse-Sterlemann, K., Wernicke, K.
Unpublished D.O. thesis, 2009/10
2121

Effekte osteopathischer Behandlung auf Adipositias im Jugenalter. Eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment on adolescent obesity. A randomized controlled trial)
Schöndorfer, S., Wentzke, S.
Unpublished D.O. thesis, 2009/10
2122

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
2123

Management of chronic posttraumatic headache: a multidisciplinary approach
Channell, M. K., Mueller, L. L., Hahn, R.
The Journal of the American Osteopathic Association, 2009/09
Free full text
2124

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09
2125

Editorial - Of originality, breathing dysfunction and clinical education
Lucas, N. P., Moran, R.
International Journal of Osteopathic Medicine, 2009/09
2126

Kräfteverteilungen im Körper des Menschen am Beispiel von Gewichthebern – Tensegrity als Erklärungsmodell
(The distribution of forces in the human body using the example of a weightlifter - Tensegrity as explanatory model)
Siemsen, C.H., Dittrich, H.
Osteopathische Medizin, 2009/09
2127

Efectos de la variación muscular en la prueba neurodinámica del nervio mediano en una población sana con arco axilar de Langer
(The impact of muscular variation on the neurodynamic test for the median nerve in a healthy population with Langer's axillary arch)
Van Hoof, T., Vangestel, C., Forward, M., Eng, C., Verhaeghe, B., Van Thilborgh, L., Plasschaert, F., de Muynck, M., Vanderstraeten, G., D&rsquo, Herde, K.
Osteopatía Científica, 2009/09
2128

La langue : déglutition, fonctions oro-faciales, croissance crânio-faciale
(The tongue: deglutition, orofacial functions and craniofacial growth)
Landouzy, J.M., Sergent Delattre, A., Fenart, R., Delattre, B., Claire, J., Biecq, M.
International Orthodontics, 2009/09
2129

Hamstring flexibility in young women following passive stretch and muscle energy technique
Shadmehr, A., Hadian, M. R., Naiemi, S. S., Jalaie, S.
Journal of Back and Musculoskeletal Rehabilitation, 2009/09
2130

Interest in rural medicine among osteopathic residents and medical students
Colegrove, D. J., Whitacre, B. E.
Rural and Remote Health, 2009/09
2131

Survey, systematisation and comparison of the Master of Science in Osteopathy training programmes by means of three schools
Höltl, A.
Unpublished MSc thesis, 2009/09
Free full text
2132

Ist die Ernährung Bestandteil der osteopathischen Untersuchung und Behandlung von selbständigen Osteopathen?
(Do self-employed osteopaths take nutrition into account when conducting diagnosis and treatment?)
Meuser-Scheliga, M.
Unpublished MSc thesis, 2009/09
Free full text
2133

Inter-examiner reliability of palpation for tissue texture abnormality in the thoracic paraspinal region
Paulet, T., Fryer, G.
International Journal of Osteopathic Medicine, 2009/09
2134

Principios de la osteopatía en la investigación
(Osteopathic principles in research)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/09
2135

Cavitation of the cervical spine using rotational high velocity/low amplitude thrusts: finding consistency, relationships and beliefs
Naysmith, N.
Unpublished MSc thesis, 2009/09
Free full text
2136

The use of osteopathic manipulative treatment as adjuvant therapy in patients with peripheral arterial disease
Lombardini, R., Marchesi, S., Collebrusco, L., Vaudo, G., Pasqualini, L., Ciuffetti, G., Brozzetti, M., Lupattelli, G., Mannarino, E.
Manual Therapy, 2009/08
Free full text
2137

Use and Spread of Osteopathic Medical Literature and Research Findings
Lipoff, D., Sharma, S., Sharma, S., Hallas, B. H., Ramos, R. L.
The Journal of the American Osteopathic Association, 2009/08
2138

Spiritual and Religious Characteristics of Osteopathic Medical Students
Workman, G. M., Lee, M. M., Nichols, K. J., Workman, D. E., Christian, V. L., Orlinsky, D. E.
The Journal of the American Osteopathic Association, 2009/08
2139

Headache (chronic tension-type)
Krishnan, A., Silver, N.
BMJ Clinical Evidence, 2009/07
Free full text
2140

Exploring European osteopathic identity: An analysis of professional websites of European osteopathic organizations
Wagner, C.
Unpublished MSc thesis, 2009/07
Free full text
2141

Magenulkus
(Gastric ulcer)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
2142

Sinusitis
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
2143

Measuring awareness, interest, and involvement in the osteopathic community through board certification: a survey of DO residents in ACGME-accredited training programs
Scott, S. C., O'Connor, E. M., Marlow, R. A.
The Journal of the American Osteopathic Association, 2009/06
Free full text
2144

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text
2145

Clinical guidelines, adverse events and SQUID
Lucas, N. P., Moran, R.
International Journal of Osteopathic Medicine, 2009/06
2146

Die gewollte Spaltung
(Deliberate division)
Gröbmüller, J.
Osteopathische Medizin, 2009/06
2147

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text
2148

Clinical practice characteristics of osteopathic and allopathic primary care physicians at academic health centers: results from the National Ambulatory Medical Care Survey
Licciardone, J. C., Clearfield, M. B., Guillory, V. J.
Academic Medicine, 2009/06
Free full text
2149

Osteopathic postdoctoral training institutions: a decentralized model for facilitating accreditation and program quality
Peska, D. N., Opipari, M. I., Watson, D. K.
Academic Medicine, 2009/06
Free full text
2150

Osteopathic medical graduates in ACGME residencies: another way to embrace the osteopathic philosophy.
Reed, K.
Academic Medicine, 2009/06
Free full text
2151

Strukturelle Integration durch Rolfing® und Normal Function
(Structural integration with Rolfing® and normal function)
Specka, I.
Osteopathische Medizin, 2009/06
2152

Osteopathic medical graduates in ACGME residencies: a threat to the core philosophy and distinctiveness of osteopathic medicine.
Veit, K. J.
Academic Medicine, 2009/06
Free full text
2153

Ein Wintermärchen: 13. Europäisches Symposium der Traditionellen Osteopathie
(A winter fairy tale: The 13th European Symposium on Traditional Osteopathy)
Vellmer, S.
Osteopathische Medizin, 2009/06
2154

Accreditation standards of osteopathic and allopathic medical schools: could they affect educational quality?
Wood, D. L., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
2155

Staatliche Anerkennung: Hessische Osteopathie-Verordnung im Fokus von Standesinteressen
(State accreditation: Hessian osteopathy law focuses on the interests of the profession)
Wehr, M.
Osteopathische Medizin, 2009/06
2156

The separate osteopathic medical education pathway: isn't it time we got our acts together? Counterpoint
Cohen, J. J.
Academic Medicine, 2009/06
Free full text
2157

The impact of osteopathic physicians' participation in ACGME-accredited postdoctoral programs, 1985-2006
Cummings, M., Sefcik, D. J.
Academic Medicine, 2009/06
Free full text
2158

Contraindications in Osteopathy
Gatterbauer, A.
Unpublished MSc thesis, 2009/05
Free full text
2159

Treatment approaches in osteopathy for the therapy of migraine
Michal, I.
Unpublished MSc thesis, 2009/05
Free full text
2160

Umstellung von Physiotherapie auf Osteopathie – ein problembelasteter Prozess für Therapeuten in Deutschland?
(Re-orientation of a Practice from Physiotherapy to Osteopathy - A problematic process for therapists in Germany?)
Wieligmann, J.
Unpublished MSc thesis, 2009/05
Free full text
2161

The Changing Face of Medical Education: The Role of Religion, Integrative Medicine and Osteopathy
Grossoehme, D. H., Ragsdale, J., Dixon, C., Berz, K., Zimmer, M.
The Open Medical Education Journal, 2009/05
Free full text
2162

Osteopatía basada en la evidencia
(Evidence-based osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/05
2163

Intent to “teach“ and pay to play in osteopathic medical education
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/04
Free full text
2164

Comparative analysis on the efficacy of G.D. Maitland's concept of mobilization & muscle energy technique in treating sacroiliac joint dysfunction
Rana, K., Bansal, N.
Indian Journal of Physiotherapy & Occupational Therapy, 2009/04
Free full text
2165

Modificaciones en la presión intraocular y la presión arterial en pacientes con diabetes mellitus tipo 1 tras la manipulación global occipucio-atlas-axis según Fryette. Ensayo clínico aleatorizado
(Modifications in intraocular and blood pressure in type I diabetics after Fryette's occiput-atlas-axis manipulation. A randomized clinical trial)
Díaz Cerrato, I., Martínez Loza, E., Martín-Ampudia Ugena, M. I.
Osteopatía Científica, 2009/04
2166

Validez del test de deslizamiento posteroanterior cervical medio respecto a análisis radiológico dinámico
(Validity of the postero-anterior middle cervical spine gliding test with respect to dynamic radiological analysis)
Rey Eiriz, G., Alburquerque Sendín, F., Barrera Mellado, I., Martín Vallejo, F. J.
Osteopatía Científica, 2009/04
2167

La investigación, el desarrollo y la innovación en osteopatía
(Research, development and innovation in osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/04
2168

Etudiant osteopathe en geriatrie
(Osteopathy student in geriatrics. Interview by Agnes Maillard)
Forget, S.
Soins. Gerontologie, 2009/03-04
2169

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text
2170

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03
2171

Osteopathic medical education in 2009: sails set for improved healthcare?
Shannon, S. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text
2172

Introducing the new masterclass section
Moran, R.
International Journal of Osteopathic Medicine, 2009/03
2173

Evolution of colleges of osteopathic medicine: a discussion of the COCA's “substantive change“ policies
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text
2174

The Use Of Heel Lifts and Custom Orthotics In Reducing Self-Reported Chronic Musculoskeletal Pain Scores
Lipton, J. A., Flowers-Johnson, J., Bunnell, M. T., Carter, L.
The AAO Journal, 2009/03
Free full text
2175

Osteopathic Manipulative Treatment as Adjuvant Therapy in Peripheral Arterial Disease.
Lombardini, R., Collebrusco, L.
Manual Therapy, 2009/03
Free full text
2176

Fred Mitchell Jr. und die Entwicklung der Muskel–Energie–Techniken
(Fred Mitchell Jr. and the Development of the Muscle Energy Techniques)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
2177

Wie gestalten Osteopathen die Beziehung zu ihren Patienten? – Eine qualitative Studie
(How do osteopaths form relationships with their patients? - A qualitative study)
Novy, R., Sommerfeld, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
2178

Professional satisfaction among new osteopathic family physicians: a survey-based investigation of residency-trained graduates
Simpson, C., Cutright, M., Heh, V., Simpson, M. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text
2179

Grenzen des Konzepts der Symmetrie in der osteopathischen Beurteilung: Eine Erweiterung des Konzepts in Hinblick auf Proportionalität führt zu besseren klinischen Ergebnissen
(The limits of the concept of symmetry in osteopathic diagnostics: Expanding the concept in regards to proportionality leads to improved clinical results)
Brooks, W.
Osteopathische Medizin, 2009/02
2180

Osteopathic Medicine and Primary Care looks forward to 2009
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/02
Free full text
2181

Leserbrief zum Artikel „Tensegrity und Mechanoregulation: Vom Skelett zum Zytoskelett”
(Letter to the editor in regards to the article 'Tensegrity and mechanoregulation: From skeleton to cytoskeleton')
Pflüger, C.
Osteopathische Medizin, 2009/02
2182

„Osteopath” in Hessen staatlich anerkannt: Erfolg für den VOD: Weiterbildungs- und Prüfungsordnung tritt in Kraft
('Osteopath' approved by Hessian government: The VOD succeeds: Regulations for advanced training and examinations comes into effect)
Wehr, M.
Osteopathische Medizin, 2009/02
2183

The meaning of the German terms ‘HEIL’ (wellbeing, salvation, blessedness etc.) / ‘HEILUNG’ (healing) in osteopathy with regard to the modality of LEIBLICHKEIT
Suppanz, H.
Unpublished MSc thesis, 2009/02
Free full text
2184

Einfluss der Osteopathie auf Uroflowmetrie, Miktionsbeschwerden und Lebensqualität bei Männern mit einer symptomatischen benignen Prostatahyperplasie
(Influence of Osteopathy on Uroflowmetry, Lower Urinary Tract Symptoms and Quality of Life in Men with Symptomatic Benign Prostatic Hyperplasia)
Gadringer, K.H.
Unpublished MSc thesis, 2009/02
Free full text
2185

Criteria to Determine Intervals of Treatment
Halasz, C.
Unpublished MSc thesis, 2009/02
Free full text
2186

Dissecting: how does it change the professional practice and the perspective of an osteopath?
Kober, E.
Unpublished MSc thesis, 2009/02
Free full text
2187

Osteopathy - the way from therapy to prevention
May, M.
Unpublished MSc thesis, 2009/02
Free full text
2188

What do patients expect, who come to an osteopathic clinic?
Meuser, A.
Unpublished MSc thesis, 2009/02
Free full text
2189

What is potency? Exploring practitioners’ experiences of the phenomenon of potency in osteopathy in the cranial field
Harrison, H.
Unpublished MSc thesis, 2009/01
Free full text
2190

An investigation of patient experiences of treatment in the cranial field of osteopathy
Greene, D.
Unpublished MSc thesis, 2009/01
Free full text
2191

Attitudes and beliefs of New Zealand osteopaths towards chronic pain
Carrington, A. L.
Unpublished MSc thesis, 2009/01
Free full text
2192

An investigation of the experience of osteopathically treating babies with breastfeeding problems
Carey, L.
Unpublished MSc thesis, 2009/01
Free full text
2193

Reliability of visual assessment of forward head posture in standing
Aitken, A. W.
Unpublished MSc thesis, 2009/01
Free full text
2194

Collaboration and excellence in osteopathic medical research
Manion, K. M.
The Journal of the American Osteopathic Association, 2009/01
Free full text
2195

Changes in masseter muscle trigger points following strain-counterstrain or neuro-muscular technique
Ibanez-Garcia, J., Alburquerque-Sendin, F., Rodriguez-Blanco, C., Girao, D., Atienza-Meseguer, A., Planella-Abella, S., Fernandez-de-Las Penas, C.
Journal of Bodywork and Movement Therapies, 2009/01
2196

Treating patellar tendinopathy with Fascial Manipulation
Pedrelli, A., Stecco, C., Day, J. A.
Journal of Bodywork and Movement Therapies, 2009/01
2197

Comparing Changes in Serum Nitric Oxide Levels and Heart Rate After Osteopathic Manipulative Treatment (OMT) Using the Dalrymple Pedal Pump to Changes Measured After Active Exercise
Overberger, R., Hoyt, J. A., Daghigh, F., Bell, M., Schoenfeldt, B., Bailey, J. W., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2009/01
2198

Osteopathen/innen und ihre eigene Gesundheit
(Osteopaths and their own health)
Hlucil, C.
Unpublished MSc thesis, 2009/01
2199

Auswirkungen persistierender Reflexe auf die auditorische und visuelle Wahrnehmung
(Effects of Persisting Reflexes on the Auditory and Visual Perception)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
2200

Auditive Verarbeitungs– und Wahrnehmungsstörung
(Auditory processing and perception disorder)
Nerreter, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
2201

New Zealand osteopaths’ attitudes to ‘Evidence-based practice’ – development of a questionnaire and preliminary results
Wittwer Blaser, P.
Unpublished MSc thesis, 2009/01
Free full text
2202

Exploring the use of exercise therapy in UK osteopathic practice
Zamani, J., Vogel, S., Moore, A., Lucas, K.
International Journal of Osteopathic Medicine, 2008/12
2203

Influence of a mobilization of the mesentery on the hepatic portal vein capacity measured with doppler echo
van Dun, P. L. S., Dobbelaere, E., Dillies, P., Inghelbrecht, F., Van Eeghem, P., Steyaert, L., Danse, E., Rosseel, Y.
International Journal of Osteopathic Medicine, 2008/12
2204

The effects of lumbar spine high velocity low amplitude thrust (HVLAT) manipulation on upper limb cutaneous blood supply
Sugrue, N., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12
2205

Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with chronic rhino sinusitis (CRS)? A randomized controlled trial
Steinbauer, U., Roos, S., Amann, P., Schwerla, F., Resch, K.L.
International Journal of Osteopathic Medicine, 2008/12
2206

The effects of upper cervical complex high velocity low amplitude thrust technique and sub-occipital muscle group inhibition techniques on standing balance
Smith, L., Mehta, M.
International Journal of Osteopathic Medicine, 2008/12
2207

Hamo-study i: investigation of the effect of breathing on the position of the heart
Roncada, G., Bijnens, E., Dendale, P., Buekens, J.
International Journal of Osteopathic Medicine, 2008/12
2208

Hamo-study ii: effects of sternotomy on the mobility of the heart under influence of respiration
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2008/12
2209

The standing flexion test is reproducible but fails to reveal sacroiliac joint ankylosis
Mandara, A., Sosio, S., Di Mattia, C.
International Journal of Osteopathic Medicine, 2008/12
2210

The assessment of clinical practice in osteopathic education: Is there a need to define a gold standard?
London, S.
International Journal of Osteopathic Medicine, 2008/12
2211

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12
2212

Research underpins the evidence base for osteopathic medicine
Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12
Free full text
2213

Defining adverse events in manual therapies
Carnes, D., Underwood, M.
International Journal of Osteopathic Medicine, 2008/12
2214

Three pathways to a physician career: applicants to U.S. MD and DO schools and U.S. Citizen applicants to international medical schools
Jolly, P., Garrison, G., Boulet, J. R., Levitan, T., Cooper, R. A.
Academic Medicine, 2008/12
2215

Mathematical analysis of applied loads on skeletal muscles during manual therapy
Chaudhry, H., Bukiet, B., Findley, T.
The Journal of the American Osteopathic Association, 2008/12
Free full text
2216

Response: Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Fitzgerald, M.
The Journal of the American Osteopathic Association, 2008/12
Free full text
2217

Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Lanier, W. L.
The Journal of the American Osteopathic Association, 2008/12
Free full text
2218

Eficacia del tratamiento osteopático en la rinosinusitis crónica del adulto
(Efficacy of osteopathic treatment in adult chronic rhinosinusitis)
Méndez Sánchez, R.
Osteopatía Científica, 2008/12
2219

Evidencia científica de los métodos de evaluación de la elasticidad de la musculatura isquiosural
(Scientific evidence on methods to assess the elasticity of the ischiotibial muscle)
Quintana Aparicio, E., Alburquerque Sendín, F.
Osteopatía Científica, 2008/12
2220

La osteopatía como método científico
(Osteopathy as a scientific method)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2008/12
2221

Eine Annäherung an die Craniosacral-Arbeit in der Kinderkrankenpflege.
(Familiarity with craniosacral nursing in pediatric nursing)
Potzinger, S.
Kinderkrankenschwester, 2008/12
2222

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12
2223

The hands of the osteopaths. Thinking fingers. Their special training
Hansak, S.
Unpublished MSc thesis, 2008/11
Free full text
2224

Neurobiologische Aspekte eines Knackgeräusches im Rahmen einer HVLA Technik
(Neurobiological aspects of a cracking noise within the framework of an HVLA technique)
Beck, M.
Osteopathische Medizin, 2008/11
2225

Tensegrity und Mechanoregulation: Vom Skelett zum Zytoskelett
(Tensegrity and mechanoregulation: From skeleton to cytoskeleton)
Chen, C. S., Ingber, D. E.
Osteopathische Medizin, 2008/11
2226

Osteopathie zur Optimierung des Golfschwunges
(Osteopathy for the optimization of the golf swing)
Marcucci, S.
Osteopathische Medizin, 2008/11
2227

Faszien besitzen eine der glatten Muskulatur vergleichbare Kontraktionsfähigkeit und können so die muskuloskelettale Mechanik beeinflussen
(Fasciae possess a contraction capability comparable to one of the smooth musculatures and thus can influence the musculoskeletal mechanics)
Schleip, R., Klingler, W., Lehmann-Horn, F.
Osteopathische Medizin, 2008/11
2228

Mobility and other parameters of the musculoskeletal system before and after an osteopathic treatment of the eye and its directly connected structures with patients having myopia, hyperopia and/or astigmatism
Pesendorfer, M.
Unpublished MSc thesis, 2008/11
Free full text
2229

Die Wirksamkeit einer osteopathischen Intervention bei Patienten mit einem einseitigen Tinnitus-aurium
(The effectiveness of osteopathic intervention at patients with a single-sided tinnitus aurium)
Twigt, P.
Unpublished MSc thesis, 2008/11
Free full text
2230

The Influence of a Mobilisation of the Lesser Omentum on the Capacity of the Portal Vein, Measured with Echo-Doppler
Halbeisen, H.
Unpublished MSc thesis, 2008/11
Free full text
2231

Framingham–Studie
(Framingham Study)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
2232

Functional gestational problems and osteopathy
Steinbauer, S.
Unpublished MSc thesis, 2008/11
Free full text
2233

Patient perception of osteopathic manipulative treatment in a hospitalized setting: a survey-based study
Pomykala, M., McElhinney, B., Beck, B. L., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2008/11
Free full text
2234

The epidemiology and medical management of low back pain during ambulatory medical care visits in the United States
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2008/11
2235

„Tensegrity” – ursprünglich ein Begriff aus der Architektur
('Tensegrity' – originally an architectonic term)
Eichhorn, V.
Osteopathische Medizin, 2008/11
2236

Manuelle Medizin an der Halswirbelsäule: Atraumatische Weichtechnik der Chirotherapie und HVLA-Technik der Osteopathie im Synergismus
(Manuel medicine targeting the cervical spine: Synergies between atraumatic chiropractic techniques and osteopathy's HLVA-technique)
Stahlhofer, H.
Osteopathische Medizin, 2008/11
2237

Patients' perceptions and satisfaction with treatment in a UK osteopathic training clinic
Strutt, R., Shaw, Q., Leach, J.
Manual Therapy, 2008/10
2238

Die osteopathische Behandlung von Säuglingen zwischen dem 4. und 12. Lebensmonat mit kongenitaler Tränenwegsstenose. Eine randomisierte kontrollierte Studie
(The osteopathic treatment in infants (4 to 12 month) with congenital nasolacrimal duct obstruction. A randomized controlled trial)
Heinisch, M., Oberhuber, H.
Unpublished D.O. thesis, 2008/10
2239

Intra- and Inter-Rater Reliability of the Test: Anteromedial Position of the Talus in the Talocrural Joint
Dornieden, R.
Unpublished MSc thesis, 2008/10
Free full text
2240

Echinacea purpurea and osteopathic manipulative treatment in children with recurrent otitis media: a randomized controlled trial
Wahl, R. A., Aldous, M. B., Worden, K. A., Grant, K. L.
BMC Complementary and Alternative Medicine, 2008/10
Free full text
2241

Supporting and promoting osteopathic medicine through community-based family practice preceptorships: a survey-based study
Aguwa, M. I., Monson, C. L., Liechty, D. K., Fowler, L. V., Kost, M. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
2242

Effectiveness of osteopathy in the cranial field and myofascial release versus acupuncture as complementary treatment for children with spastic cerebral palsy: a pilot study
Duncan, B., McDonough-Means, S., Worden, K., Schnyer, R., Andrews, J., Meaney, F. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text
2243

Osteopathische Behandlung von Patienten mit Tinnitus und craniomandibulären Dysfunktionen
(Test-dependent osteopathic treatment of patients suffering from craniomandibular disorders (CMD) and tinnitus. A pre-post pilot trial)
Kronau, J. S., Moshövel, N.
Unpublished D.O. thesis, 2008/10
2244

Improvement of L4-L5 disc positioning following treatment with orthotics used to correct gait dysfunction and level the sacral base
Lipton, J. A., Carter, L.
The AAO Journal, 2008/09
Free full text
2245

A model of the cranial vault as a tensegrity structure, and its significance to normal and abnormal cranial development
Scarr, G.
International Journal of Osteopathic Medicine, 2008/09
2246

Osteopathic support for a survivor of gastric cancer: A case report
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/09
2247

Osteopathen/innen und Ärzte/innen - ein Spannungsfeld ?
(Osteopaths and Physicians - An area of conflict?)
Lammer, M.
Unpublished MSc thesis, 2008/09
Free full text
2248

Aetiology of idiopathic scoliosis. Current biomedical research and osteopathic theories
Lüftinger, M.
Unpublished MSc thesis, 2008/09
Free full text
2249

The Meaning of Tensegrity Principles in Osteopathic Medicine
Pflüger, C.
Unpublished MSc thesis, 2008/09
Free full text
2250

Will the ‘real’ osteopathy please speak up?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/09
Free full text
2251

Commentary on ‘Is there a place for science in the definition of osteopathy’?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09
2252

Le perinee douloureux sous toutes ses formes. Apport de la medecine manuelle et osteopathie. Etude clinique.
(Painful perineum in all its forms. Contribution of manual medicine and osteopathy. Clinical study)
Grimaldi, M.
Journal de Gynecologie, Obstetrique et Biologie de la Reproduction, 2008/09
2253

Intraobserver reliability of cranial strain patterns as evaluated by osteopathic physicians: a pilot study
Halma, K. D., Degenhardt, B. F., Snider, K. T., Johnson, J. C., Flaim, M. S., Bradshaw, D.
The Journal of the American Osteopathic Association, 2008/09
Free full text
2254

Efficacy of Manipulative Treatment for Acute Low Back Pain in Active Duty Military Personnel
Stoll, S. T., Maurer, D., Hensel, K., Cruser, D.
The Journal of the American Osteopathic Association, 2008/08
2255

Osteopathic Manipulative Medicine in the Treatment of Acute Otitis Media Symptoms
Torres, J. W., Mason, D. C., Kaari, J.
The Journal of the American Osteopathic Association, 2008/08
2256

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
2257

Querschnitt– und Längsschnittstudien
(Cross-sectional and longitudinal studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
2258

Sonne statt Krebs?
(Sun instead of cancer?)
Moan, J., Porojnicu, A. C., Dahlback, A., Setlow, R. B.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
2259

Atopische Dermatitis: (osteopathische) Hand anlegen!
(Atopic dermatitis: (osteopathic) hands on!)
Oezbay, I., Reckwerth, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
2260

Evidence-based publications: balancing research mission and our community's needs
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2008/08
Free full text
2261

12. Europäisches Symposium der traditionellen Osteopathie – Februar 2008 auf Frauenchiemsee
(12th European Symposium of Traditional Osteopathy - February 2008 at Frauenchiemsee)
Torres, I. L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
2262

ED physicians beware when using OMT for patients with motor vehicle injuries
Fletcher, S. A.
The Journal of the American Osteopathic Association, 2008/08
Free full text
2263

Keeping the flames of OMM burning
Hogarty, D. C.
The Journal of the American Osteopathic Association, 2008/08
Free full text
2264

Osteopathic Manipulative Treatment for Postoperative Nausea and Vomiting
Schrick-Senasac, S. L., King, H. H.
The Journal of the American Osteopathic Association, 2008/08
2265

Validación del test de movilidad mandibular comparado con tomografía computarizada
(Validation of the mandibular mobility test compared with computed tomography)
García García, C., Rodríguez Díaz, J.
Osteopatía Científica, 2008/08
2266

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text
2267

Eliminating bad, bad medicine: problems with P4P initiatives
McDonald, R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
2268

Dangers of for-profit education: more than just words
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2008/08
Free full text
2269

Election year's first shot over the bow: reforms needed
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2008/08
Free full text
2270

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
2271

Relationship of Osteopathic Manipulative Treatment During Labor and Delivery on Selected Maternal Morbidity Outcomes: A Randomized Controlled Trial
Keurentjes, A., Showalter, A., James, C., Vawter, A., Cross, B. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text
2272

Sind Habits, Tics, Bruxismus, Sprechfehler und orofaziale Dyskinesien eine Expression notwendiger kraniosakraler und posturaler Autoregulation des Menschen?: Das Balance-Behandlungskonzept
(Are habits, tics, bruxism, speech disorder and orofacial dyskinesia an expression of necessary craniosacral and postural autoregulation in humans?)
Entrup, W.
Osteopathische Medizin, 2008/07
2273

Rediscovering the classic osteopathic literature to advance contemporary patient-oriented research: A new look at diabetes mellitus
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2008/07
2274

Inpatient osteopathic structural examinations: is “red tape“ getting in the way of personalized patient care?
Fennig Jr., G. A., Shubrook Jr., J. H.
The Journal of the American Osteopathic Association, 2008/07
Free full text
2275

DOs need to define value of osteopathic medicine
Snow, R. J., Seffinger, M. A., McGill, S. L., Vincent, R. A.
The Journal of the American Osteopathic Association, 2008/07
Free full text
2276

Role of exercise therapy in osteopathic education, treatment and management
Zamani, J. M.
Unpublished PhD thesis, 2008/07
Free full text
2277

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06
2278

Due thanks, moving forward, and valuing the journey
Vogel, S.
International Journal of Osteopathic Medicine, 2008/06
Free full text
2279

Consistency of standing and seated posture of asymptomatic male adults over a one-week interval: A digital camera analysis of multiple landmarks
Pownall, P. J., Moran, R. W., Stewart, A. M.
International Journal of Osteopathic Medicine, 2008/06
2280

Place de l’ostéopathie dans la correction des déformations crâniennes du nouveau-né et du jeune enfant
(Cranial osteopathy as a complementary treatment of postural plagiocephaly)
Amiel-Tison, C., Soyez-Papiernik, E.
Archives de Pédiatrie, 2008/06
2281

Solitary fibrous pleural tumor
Jenkins, L. A., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2008/06
Free full text
2282

Saying what you mean and meaning what you say
Rogers, F. J.
The Journal of the American Osteopathic Association, 2008/06
Free full text
2283

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text
2284

Osteopathische Medizin und ihre Anpassung an das Älterwerden
(Osteopathic medicine and its adjustment to aging patients)
Hruby, R.
Osteopathische Medizin, 2008/05
2285

Constraints to caring: service to medically indigent patients by allopathic and osteopathic physicians
Chirayath, H. T., Wentworth, A. L.
Journal of Health Care for the Poor and Underserved, 2008/05
2286

A randomized controlled trial of the effectiveness of osteopathy-based manual physical therapy in treating pediatric dysfunctional voiding
Nemett, D. R., Fivush, B. A., Mathews, R., Camirand, N., Eldridge, M. A., Finney, K., Gerson, A. C.
Journal of Pediatric Urology, 2008/04
Free full text
2287

Asociación entre hipomovilidad cervical y cambios morfológicos de los músculos multífidos cervicales en pacientes con cervicalgia mecánica
(Association between cervical joint dysfunction and morphological changes in the cervical multifidus in patients with mechanical neck pain)
Albert i Sanchis, J. C., Boscá Gandía, J. J.
Osteopatía Científica, 2008/04
2288

Repercusiones sobre los niveles de glucosa en sangre venosa periférica, tras la manipulación con thrust del segmento vertebral T8T9 en sujetos sanos
(Effects of T8 and T9 vertebras HVT manipulations on glycemic 8 levels in peripheral venous blood in healthy people)
Durá Soler, A. M., Boscá Gandía, J. J.
Osteopatía Científica, 2008/04
2289

Spirituality and medicine: prevalence of spirituality-in-medicine instruction at osteopathic medical schools
McClain, E. K., McClain, R. L., Desai, G. J., Pyle, S. A.
The Journal of the American Osteopathic Association, 2008/04
Free full text
2290

Dolor del miembro superior, disfunción somática y deslizamiento neural
(Arm pain, somatic dysfunction and nerve movement)
Oliva Pascual-Vaca, Á.
Osteopatía Científica, 2008/04
2291

Un caso de pelviespondilitis atípica
(A case of atypical pelvispondylitis)
Ricard, F.
Osteopatía Científica, 2008/04
2292

Técnica semidirecta de thrust para torsión anterior derecha del sacro: TDD
(Indirect thrust manipulation for right anterior torsion of the sacrum on a right oblique axis)
Rodríguez Blanco, C.
Osteopatía Científica, 2008/04
2293

A short questionnaire to identify patient characteristics indicating improved compliance to exercise rehabilitation programs: A pilot investigation
Howard, D. B., Gosling, C. M. R.
International Journal of Osteopathic Medicine, 2008/03
2294

10 Years of research in the journal: What's next?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2008/03
Free full text
2295

Clinical inquiries. Is osteopathic manipulation effective for headaches?
Keays, A. C., Neher, J. O., Safranek, S., Webb, C. W.
The Journal of Family Practice, 2008/03
2296

Pushing bodies through COMs
Lisowsky, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text
2297

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03
2298

The importance of monitoring patient's ability to achieve functional tasks in those with musculoskeletal pain
Carnes, D., Underwood, M.
International Journal of Osteopathic Medicine, 2008/03
2299

Osteopathic medical education in 2008: course corrections and new horizons
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/03
Free full text
2300

Does osteopathic treatment influence the hormone level of hyperandrogenaemic infertile women?
Heim, S.
Unpublished MSc thesis, 2008/02
Free full text
2301

Communication Concept for the Austrian Osteopathic Association and the Individual Osteopath
Rüscher, M.
Unpublished MSc thesis, 2008/02
Free full text
2302

The Phenomenon Spondylolisthesis from an Osteopathic Point of View
Schiener, M.
Unpublished MSc thesis, 2008/02
Free full text
2303

Osteopathie in der Pädiatrie, Teil 2: Intraossäre Läsionen des Os occipitale
(Osteopathy in Pediatrics, Part 2: Intraosseus Lesions of the Occipital Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
2304

Bundesarbeitsgemeinschaft Osteopathie e.V. (BAO)
(Federal Working Group Osteopathy e.V. (BAO))
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
2305

Visceral Motility. Which osteopathic approaches are there, and how are they implemented?
Behrens, A.
Unpublished MSc thesis, 2008/02
Free full text
2306

Pregnancy-related pelvic girdle pain: intertester reliability of 3 tests to determine asymmetric mobility of the sacroiliac joints
van Kessel-Cobelens, A. M., Verhagen, A. P., Mens, J. M., Snijders, C. J., Koes, B. W.
Journal of Manipulative and Physiological Therapeutics, 2008/02
Free full text
2307

Eigenrhythmizität von Blutgefäßen
(The Innate Rhythmicity of Blood Vessels)
Schmid-Schönbein, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
2308

Inter-examiner reliability of four static palpation tests used for assessing pelvic dysfunction
Holmgren, U., Waling, K.
Manual Therapy, 2008/02
2309

Doctors’ knowledge of osteopathy in the district of Bregenz
Seewald, S.
Unpublished MSc thesis, 2008/02
Free full text
2310

The Historical Background of the German Law Regulating Health Practitioners
Einenkel, T.
Unpublished MSc thesis, 2008/02
Free full text
2311

The role of osteopaths in the recognition of melanoma: attitudes, knowledge and practices in melanoma screening within the osteopathic community
Friedlander, T.
Unpublished MSc thesis, 2008/01
Free full text
2312

Knowing hands converse with an expressive body: An experience of osteopathic touch
Consedine, S.
Unpublished MSc thesis, 2008/01
Free full text
2313

Spirit(ualität) in der Osteopathie heute: Entwicklung des SpREUK-Fragebogens zur Analyse der unterschiedlichen Phänomene und Perspektiven der Spiritualität bei chronisch Kranken
(Spirit(uality) in osteopathy today)
Büssing, A.
Osteopathische Medizin, 2008/01
2314

Die Gleitfähigkeit subkutaner Strukturen beim Menschen – eine Einführung
(Introduction to the knowledge of subcutaneous sliding system in humans)
Guimberteau, J. C., Sentucy-Rigall, J., Panconi, B., Bouleau, R., Mouton, P., Bakhach, J.
Osteopathische Medizin, 2008/01
2315

Sinnsuche: Krankheit, Spiritualität und Heilung
(The search for meaning: Illness, spirituality and healing)
Kalitzkus, V.
Osteopathische Medizin, 2008/01
2316

Spiritualität und Manuelle Medizin: Perspektiven für ein wiederentdecktes Forschungsthema
(Spirituality and manual medicine: Perspectives for a rediscovered topic of research)
Ostermann, T.
Osteopathische Medizin, 2008/01
2317

The post-baccalaureate premedical certification program at the University of North Texas Health Science Center strengthens admission qualifications for entrance into medical school
Reeves, R. E., Vishwanatha, J. K., Yorio, T., Budd, M., Sheedlo, H. J.
Academic Medicine, 2008/01
2318

Female osteopathic medical students: When the minority become the majority
Johnson, K. D.
Unpublished PhD thesis, 2008/01
2319

Attitudes toward pay-for-performance initiatives among primary care osteopathic physicians in small group practices
Locke, R. G., Srinivasan, M.
The Journal of the American Osteopathic Association, 2008/01
Free full text
2320

„Attentionality”: Osteosophische Basisschritte zur sensorischen Körper-Spiritualität in der osteopathischen Medizin
('Attentionality': Basic osteosophic steps towards a sensory spirituality of the body in osteopathic medicine)
Beuckels, J. M.
Osteopathische Medizin, 2008/01
2321

„Leben ist Bewegung, Leben ist Begegnung”
(“Life is movement, life is meeting“; Under this motto the “World of Osteopathy“ met in May in Zurich)
Rüdiger, J.
Osteopathische Medizin, 2008/01
2322

Intertester reliability and validity of motion assessments during lumbar spine accessory motion testing
Landel, R., Kulig, K., Fredericson, M., Li, B., Powers, C. M.
Physical Therapy & Rehabilitation Journal, 2008/01
Free full text
2323

Current legal framework governing manual-therapeutic osteopathic work by physiotherapists in Austria. An analysis from the perspective of self-employed physical therapists
Panovits, V.
Unpublished MSc thesis, 2007/12
Free full text
2324

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text
2325

Who are our guests?
Sumesgutner, A.
Unpublished MSc thesis, 2007/12
Free full text
2326

Osteopathic manipulative treatment for pandemic influenza: many questions, few answers
Sanderlin, B. W., Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2007/12
Free full text
2327

An investigation into the side of joint cavitation associated with cervical spine manipulation
Bolton, A., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/12
2328

Is there a place for science in the definition of osteopathy?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/12
2329

Analysis of exercise content in undergraduate osteopathic education – A content analysis of UK curricula
Zamani, J., Vogel, S., Moore, A., Lucas, K.
International Journal of Osteopathic Medicine, 2007/12
2330

How and in what context do osteopathic medical students learn about interprofessional practice
Head French, J.
Unpublished Dissertation, 2007/12
Free full text
2331

Applying osteopathic principles to formulate treatment for patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2007/11
Free full text
2332

Hypermobility and the hypermobility syndrome
Simmonds, J. V., Keer, R. J.
Manual Therapy, 2007/11
Free full text
2333

Using integrative therapies to treat women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2007/11
Free full text
2334

Manuelle Medizin wirkt auf schmerzhemmende Systeme!
(Manual medicine acts on pain inhibitory systems)
Locher, H., Sell, K.
Osteopathische Medizin, 2007/10
2335

The influence of an Osteopathic treatment on the performance of a high - performance athlete
Böhmüller, E.
Unpublished MSc thesis, 2007/10
Free full text
2336

Ist eine funktionelle Verbindung zwischen Diaphragma und Cranium palpierbar? Versuch der Deutung mittels des Tensegrity-Modells
(Is a functional connection between diaphragm and cranium palpatable? Attempt to interpret by means of the Tensegrity Model)
Koschella, S.
Unpublished D.O. thesis, 2007/10
2337

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
2338

Lebensqualität
(Quality of Life)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
2339

Nonprofit and for-profit COMs: investing in the future of osteopathic medicine
Ajluni, P. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text
2340

Chronic pelvic pain: Pelvic floor problems, sacro-iliac dysfunction and the trigger point connection
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2007/10
2341

Effektivität der osteopathischen Behandlung bei Patienten mit Patellofemoralen Schmerzsyndrom. Eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with patellofemoral pain syndrome. A randomized controlled trial)
Wendel, J., Rudisch, B., Berger, G.
Unpublished D.O. thesis, 2007/10
2342

Surgical workforce since the 1975 study of surgical services in the United States: an update
Sheldon, G. F.
Annals of Surgery, 2007/10
2343

Occipital Compression and its Potential Uses in Obstetrics
McAfee, S. N., Chila, A. G.
The AAO Journal, 2007/09
Free full text
2344

A three-year accelerated medical school curriculum designed to encourage and facilitate primary care careers
Bell, H. S., Ferretti, S. M., Ortoski, R. A.
Academic Medicine, 2007/09
2345

Role of osteopathic manipulative treatment in altering pain biomarkers: a pilot study
Degenhardt, B. F., Darmani, N. A., Johnson, J. C., Towns, L. C., Rhodes, D. C., Trinh, C., McClanahan, B., DiMarzo, V.
The Journal of the American Osteopathic Association, 2007/09
Free full text
2346

Treatment of irritable bowel syndrome with osteopathy: results of a randomized controlled pilot study
Hundscheid, H. W., Pepels, M. J., Engels, L. G., Loffeld, R. J.
Journal of Gastroenterology and Hepatology, 2007/09
Free full text
2347

Chiropractic through the eyes of physiotherapists, manual therapists, and osteopaths in the Netherlands
Langworthy, J. M., Smink, R. D.
The Journal of Alternative and Complementary Medicine, 2007/09
2348

Attitudes towards Osteopathic Manipulation in Career Choices (ATOMICC)
Dunbar, B. D., Desai, G. J.
The Journal of the American Osteopathic Association, 2007/08
2349

Inter-rater Reliability of Rib Strain-Counterstrain Tenderpoints
Hartinger, J., Cloar, N., Seffinger, M.
The Journal of the American Osteopathic Association, 2007/08
2350

Foot Ankle Biomechanics: Effects of Manipulative Intervention on Plantar Fasciitis Subjects
Morton, A. L., McGrew, A., Burns, J. M., Karodogan, E., Conatser, R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2007/08
2351

Comparing the Effects of Cranial Manipulation on Heart Rate Variability and Traube-Hering-Mayer Waves
Pexton, T., Nelson, K., Glonek, T., Heinking, K., Kappler, R., Sergueef, N.
The Journal of the American Osteopathic Association, 2007/08
2352

Factors Contributing to Osteopathic Manipulation Usage at Army Family Medicine Residency Programs
Platz, K. E., Asplund, C. A.
The Journal of the American Osteopathic Association, 2007/08
2353

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
2354

Medizin und Kreativität
(Medicine and creativity)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
2355

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
2356

Hope for larger study on otitis media
Galgano, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
2357

Getting “beyond the barriers“ in reforming osteopathic medical education
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
2358

Reported prevalence rates of somatic dysfunction raise an... Heel?
Kotoske, D. E.
The Journal of the American Osteopathic Association, 2007/07
Free full text
2359

COM Accreditation: the Flexner Report revisited
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2007/07
Free full text
2360

Study on recurrent otitis media: potential value vs actual value of OMT
Orenstein, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
2361

Ehlers Danlos Syndrome: A Case Report
Kumar, A., Stoll, S. T., Hensel, K.
The AAO Journal, 2007/06
Free full text
2362

Is estimating USMLE performance useful?
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2007/06
Free full text
2363

Editorial comment on ‘developing clinical guidelines for the physiotherapy management of whiplash associated disorder (WAD)’ by C. Mercer, A. Jackson and A. Moore
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2007/06
2364

Should your GP be an osteopath? Patients' views of an osteopathy clinic based in primary care
Westmoreland, J. L., Williams, N. H., Wilkinson, C., Wood, F., Westmoreland, A.
Complementary Therapies in Medicine, 2007/06
Free full text
2365

Researching osteopathy: Who is responsible?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/06
2366

Manuscript preparation and publication for would-be writers: An aid to disseminating osteopathic research
Mullinger, B.
International Journal of Osteopathic Medicine, 2007/06
2367

The effects of high-velocity, low-amplitude manipulation and muscle energy technique on suboccipital tenderness
Hamilton, L., Boswell, C., Fryer, G.
International Journal of Osteopathic Medicine, 2007/06
2368

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 1
(The craniomandibular system (cms). Part 1: The cms and its effects on the body posture)
Honikel, M., Bruderhofer, A.
Osteopathische Medizin, 2007/05
2369

Symposium der traditionellen Osteopathie
(Symposium of traditional osteopathy)
Prediger, G.
Osteopathische Medizin, 2007/05
2370

Step forward to stop bird flu
Austin, D. L.
The Journal of the American Osteopathic Association, 2007/05
Free full text
2371

Repatriating DOs with MD-affiliated residencies
Forte, T. E.
The Journal of the American Osteopathic Association, 2007/05
Free full text
2372

Attitudes to back pain amongst musculoskeletal practitioners: a comparison of professional groups and practice settings using the ABS-mp
Pincus, T., Foster, N. E., Vogel, S., Santos, R., Breen, A., Underwood, M.
Manual Therapy, 2007/05
2373

Competence levels in musculoskeletal medicine: a call to action
Ruane, J. J.
The Journal of the American Osteopathic Association, 2007/05
Free full text
2374

Irresistible indexes for somatic dysfunction
Sucher, B. M.
The Journal of the American Osteopathic Association, 2007/05
Free full text
2375

Osteopathic focus in the biomedical sciences: A survey of biomedical science faculty at osteopathic medical schools in the United States
Ebert, D. E.
Unpublished MSc thesis, 2007/05
2376

Latino success stories in higher education: A qualitative study of recent graduates from a health science center
Colley, K. L.
Unpublished PhD thesis, 2007/05
Free full text
2377

Die Motrizität
(Motricity)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
2378

Das 11. Europäische Symposium der traditionellen Osteopathie
(The 11th European Symposium of Traditional Osteopathy)
Prediger, G.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
2379

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text
2380

Unexplained Subfertility and Osteopathic Treatment
Kapper, A.
Unpublished MSc thesis, 2007/03
Free full text
2381

Is it possible to help people suffering from chronic subjective tinnitus with osteopathic treatments to improve their acceptance of their sound perception?
Schlatte-Cehovin, B.
Unpublished MSc thesis, 2007/03
Free full text
2382

Dysgnathia as a correlative to an SBS – Lesion?
Krenner, E.
Unpublished MSc thesis, 2007/03
Free full text
2383

The Effectiveness of Osteopathic Treatment in Perimenopause
Zanon, B.
Unpublished MSc thesis, 2007/03
Free full text
2384

The Midline in Osteopathy – A Balancing Act between Structure and Spirituality
Dunshirn, M.
Unpublished MSc thesis, 2007/03
Free full text
2385

Development of a Questionnaire to Analyse the Knowledge of Medical Doctors About Osteopathy
Eppensteiner, M.
Unpublished MSc thesis, 2007/03
Free full text
2386

Osteopathy is not only a job, it is a vocation!
Forthuber, K.
Unpublished MSc thesis, 2007/03
Free full text
2387

The Influence of osteopathy on the vegetative nervous system in chronic pain patients
Fürpaß, E.
Unpublished MSc thesis, 2007/03
Free full text
2388

Effects of Osteopathic Work to Mother and Child Regarding Foetal Heart Rate, Uterine contractions, Lumbosacral Mobility, and Objective Parameters of Delivery
Hampel, E.
Unpublished MSc thesis, 2007/03
Free full text
2389

The Influence of Osteopathy on ADHD
Hubmann, B.
Unpublished MSc thesis, 2007/03
Free full text
2390

Osteopathic medical education in 2007: plumbing the depths with the questions we ask
Shannon, S. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text
2391

Practice patterns among osteopathic dermatologists in the United States
Yoo, J. Y., Lee, H., Kimball, A. B.
Journal of the American Academy of Dermatology, 2007/03
2392

Osteopathy in idiopathic sudden hearing loss
Staffa, U.
Unpublished MSc thesis, 2007/03
Free full text
2393

Craniosacral Osteopathy: “Personal Perspectives of Osteopaths with several years of professional experience”
Wojna, S.
Unpublished MSc thesis, 2007/03
Free full text
2394

Beyond spinal manipulation
McClune, T.
International Journal of Osteopathic Medicine, 2007/03
2395

Validity of an electronic pressure algometer
Vaughan, B., McLaughlin, P., Gosling, C.
International Journal of Osteopathic Medicine, 2007/03
2396

Biomechanische Annäherung an die Dysfunktion - Teil 1
(Biomechanical approach to dysfunction - Part 1)
Klein, P., Sommerfeld, P.
Osteopathische Medizin, 2007/02
2397

Experimentelle in-vivo-Studie zur ISG Mobilität
(An experimental in vivo study on the mobility of the sacroiliac joints)
Otte, C.
Osteopathische Medizin, 2007/02
2398

Mechanical Link. Ein osteopathisches Diagnose- und Behandlungskonzept
(The mechanical link: An osteopathic diagnosis and treatment concept)
Somody-Neplaz, I., Chauffour, P., Prat, E.
Osteopathische Medizin, 2007/02
2399

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2007/02
Free full text
2400

Comparison between CV4 and EV4 via Biofeedback-measurement
Grill, M.
Unpublished MSc thesis, 2007/01
Free full text
2401

Otitis media in nursery and primary schoolstage osteopathic treatment of otitis media with effusion
Stadler, K.
Unpublished MSc thesis, 2007/01
Free full text
2402

Does Osteopathy Influence Diabetes Mellitus Type II?
Kiegerl, G.
Unpublished MSc thesis, 2007/01
Free full text
2403

Osteopathic Treatment During Transition of Perimenopause
Mückler, A.
Unpublished MSc thesis, 2007/01
Free full text
2404

Influence of Osteopathic Treatment on Congestive Menstrual Disorders and Premenstrual Syndrome
Riepler-Reisecker, I.
Unpublished MSc thesis, 2007/01
Free full text
2405

Touching Reliability
Sommerfeld, P.
Unpublished MSc thesis, 2007/01
Free full text
2406

The significance of osteopathic interventions in the treatment of congenital hip dysplasia (Type IIa/IIb)
Ellmerer, H.
Unpublished MSc thesis, 2007/01
Free full text
2407

The influence of sitting position on (ventro-) dorsal head translation
Hoffmann, F.
Unpublished MSc thesis, 2007/01
Free full text
2408

Osteopathic degrees overseas
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2007/01
Free full text
2409

The influence of osteopathic treatment during gestation onto the course of delivery - a comparative study on the frequency of medical intervation during child birth
Ruspeckhofer, M.
Unpublished MSc thesis, 2007/01
Free full text
2410

A woman with the problem of Infertility receiving osteopathic treatment has an increased chance of becoming pregnant
Kirchmayr, M.
Unpublished MSc thesis, 2007/01
Free full text
2411

Can Vital Capacity be Improved by Osteopathic Treatment of the Mediastinum?
Wieser, R.
Unpublished MSc thesis, 2007/01
Free full text
2412

Changing the practice of osteopaths, chiropractors and musculoskeletal physiotherapists in relation to the management of low back pain
Evans, D. W.
Unpublished PhD thesis, 2007/01
2413

Osteopathy and Tinnitus
Plamberger, M.
Unpublished MSc thesis, 2007
Free full text
2414

Approval of ACGME Training as an AOA-approved internship: history and review of current data
Bulger, J. B.
The Journal of the American Osteopathic Association, 2006/12
Free full text
2415

The Use of OMT in Patients with Osteoarthritis: Case Report
Zaidi, T., Williams, S.
The AAO Journal, 2006/12
Free full text
2416

Do any treatments work for irritable bowel syndrome?
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/12
2417

Algometer reliability in measuring pain pressure threshold over normal spinal muscles to allow quantification of anti-nociceptive treatment effects
Potter, L., McCarthy, C., Oldham, J.
International Journal of Osteopathic Medicine, 2006/12
2418

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text
2419

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11
2420

Craniosacral therapy and professional responsibility
Flynn, T. W., Cleland, J. A., Schaible, P.
The Journal of Orthopaedic and Sports Physical Therapy, 2006/11
Free full text
2421

Topographische Untersuchung der Anhaftungen des Pericards (im Mediastinum) zu seinen kaudalen, dorsalen, anterioren und lateralen Nachbarstrukturen. Grundlage zur weiteren Optimierung von osteopathischen Techniken
(Topographic examination to the connections of the pericardium to its neighboring organs from cranial to caudal, anterior to posterior and medial to lateral. To create a basis for the optimization of osteopathic methods)
Bartmer-Leitl, E., Kaufer, C.
Unpublished D.O. thesis, 2006/10
2422

Studie zur Patientenzufriedenheit mit der osteopathischen Behandlung. Eine Fragebogenaktion der ÖGO
(A study on patient satisfaction with osteopathic treatment)
Weber, K.H., Woisetschläger, G.
Osteopathische Medizin, 2006/10
2423

Nitric oxide and anandamide in OMT research
Stefano, G. B., Salamon, E. J.
The Journal of the American Osteopathic Association, 2006/10
Free full text
2424

Folgen des intrauterinen Gefängnis: Fußdeformitäten
(Consequences of intrauterine imprisonment: Deformities of the Foot)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
2425

Können osteopathische Behandlungen die Symptomatik des Kopfschmerzes bzw. des Kopfdrucks bei Patienten mit chronischer Rhinosinusitis (CRS) verbessern? Eine randomisierte kontrollierte Studie
(Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with Chronic Rhino sinusitis (CRS)? A randomized controlled trial)
Roos, S., Steinbauer, U., Amann, P.
Unpublished D.O. thesis, 2006/10
2426

Osteopathische Behandlung bei frühkindlichem Innenschielen. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of congenital and infantile esotropia)
Reimann, B., Schiedt, R.
Unpublished D.O. thesis, 2006/10
2427

Mechanisms of change: animal models in osteopathic medical research
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/10
Free full text
2428

Aspekte der traditionellen chinesischen Medizin bei der osteopathischen Behandlung des Fußes
(Aspects of traditional Chinese medicine in osteopathic treatment of the foot)
Kaufmann, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
2429

Die Bewegungen der Viszera: Die Mobilität - Teil 1
(Visceral Movements: Mobility - Part 1)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
2430

Was bringt die Ganganalyse? - Pro und Contra
(What are the benefits of gait analysis? - Pros and cons)
Fink, M., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
2431

Patient confidentiality vs disclosure of inheritable risk: a survey-based study
Erde, E. L., McCormack, M. K., Steer, R. A., Ciervo, C. A., Jr., McAbee
The Journal of the American Osteopathic Association, 2006/10
Free full text
2432

Interventions need to be consistent with osteopathic philosophy
Vasquez, A.
The Journal of the American Osteopathic Association, 2006/09
Free full text
2433

Embryological study of the spinal dura and its attachment into the vertebral canal
van Dun, P. L. S., Girardin, M. R. G
International Journal of Osteopathic Medicine, 2006/09
2434

One Heritage, Two Traditions; A Look to the Future
Steele, K. M.
The AAO Journal, 2006/09
Free full text
2435

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text
2436

Osteopathic medicine in transition: postmortem of the Osteopathic Medical Center of Texas
Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2006/09
Free full text
2437

Computer-assisted instruction: a survey on the attitudes of osteopathic medical students
Forman, L. J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text
2438

Zen-Bewusstsein bei der Lehre der Palpation: Ein osteopathischer Ansatz
(Zen awareness in the teaching of palpation: An osteopathic perspective)
Comeaux, Z.
Osteopathische Medizin, 2006/08
2439

Establishing a case for cause and effect
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text
2440

Attitudes, Knowledge, and Use of Osteopathic Manipulative Treatment by Osteopathic Sports Medicine Physicians: Is OMT Being Used in the Sports Arena?
Clearfield, D.
The Journal of the American Osteopathic Association, 2006/08
2441

Patient Expectations Between OMT, Subtherapeutic Ultrasound and Light Touch Placebo Controls
Fulda, K., Slicho, T., Marshall, K., Stoll, S. T.
The Journal of the American Osteopathic Association, 2006/08
2442

Determining the Intra-observer Reliability of the Evaluation of Cranial Strain Patterns
Halma, K. D., Snider, K. T., Johnson, J. C., Schaun Flaim, M., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2006/08
2443

AOA certifying boards are credible and capable
Reeves, R. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text
2444

Das Mitchell-Johnston-Experiment: Funktioneller versus strukturellem Ansatz)
(The Mitchell-Johnston experiment: Functional versus structural approach)
Mitchell Jr., F. L.
Osteopathische Medizin, 2006/08
2445

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08
2446

Worlds of Western medicine and Chinese medicine learning from each other
Wu, E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
2447

Neuropsychiatric symptoms and medical illness in patients with dementia: an exploratory study
Tran, P., Schmidt, K., Gallo, J., Tuppo, E., Scheinthal, S., Chopra, A., Libon, D. J.
The Journal of the American Osteopathic Association, 2006/07
Free full text
2448

Nervus vestibulocochlearis (VIII.)
(Vestibulocochlear nerve)
Toth, A. B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
2449

Das Ohr, Anatomie und Physiologie
(The Ear, Anatomy and Physiology)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
2450

Behandlung eines temporomandibulären Problems bessert langfristig Tinnitus-Symptome
(Treatment of a temporomandibular problem improves tinnitus symptoms in the long term)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
2451

Akuter Tinnitus: Selbstheilungskräfte dominieren
(Acute tinnitus: self-healing powers dominate)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
2452

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
2453

Violations of the 80-duty-hours work standard to be investigated
Opipari, M. I.
The Journal of the American Osteopathic Association, 2006/07
2454

Tinnitus aurium - Wenn das Ohr pfeift
(Tinnitus - When the ear whistles)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
2455

Sciatic Neuritis: A Research Study
Beal, M. C.
The AAO Journal, 2006/06
Free full text
2456

Osteopathy and pain: Does psychology matter?
Pincus, T.
International Journal of Osteopathic Medicine, 2006/06
2457

Manipulation of Adhesive Capsulitis under Anesthesia
Hurrell, J., Speece, A. J., Williams, S. F.
The AAO Journal, 2006/06
Free full text
2458

Front-line osteopathic medicine
Hayes, D. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text
2459

Osteopathic manipulative treatment of a 27-year-old man after anterior cruciate ligament reconstruction
Gugel, M. R., Johnston, W. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text
2460

Factors affecting the intra-examiner and inter-examiner reliability of palpation for supine medial malleoli asymmetry
Fryer, G.
International Journal of Osteopathic Medicine, 2006/06
2461

Osteopathic evaluation and manipulative treatment in reducing the morbidity of otitis media: a pilot study
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text
2462

Progressive idea for osteopathic medical education
Belsky, D. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text
2463

Understanding comorbidity with depression and anxiety disorders
Aina, Y., Susman, J. L.
The Journal of the American Osteopathic Association, 2006/05
2464

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05
2465

In wieweit kann die Tiefenpsychologie von C.G.Jung die Osteopathie befruchten?
(Can Jung's depth psychology be used to benefit osteopathy?)
Kirchschlager, M.
Unpublished MSc thesis, 2006/05
Free full text
2466

Let the beauty of the marketplace benefit healthcare
Bliss, G.
The Journal of the American Osteopathic Association, 2006/04
Free full text
2467

The Drive for Legitimation by Osteopathy and Chiropractic in Australia: Between Heterodoxy and Orthodoxy
Baer, H. A.
Complementary Health Practice Review, 2006/04
Free full text
2468

Zur Übersetzung grundlegender Konzepte von A.T. Still: Spiritual Being
(Regarding the translation of A.T. Still's basic concepts: Spiritual Being)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
2469

The public's attitudes, knowledge and perceptions towards osteopathic medicine in Melbourne
Tomolo, R.
Unpublished MSc thesis, 2006/04
Free full text
2470

Im Gedenken an Anne Wales, D.O. 1904-2005
(In memory of Anne Wales, D.O. 1904-2005)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
2471

Women's reproductive health and neonatal care
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/04
Free full text
2472

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
2473

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
2474

Trunk and limb muscle activity during the application of a mobilisation type force to the vertebral column
Blaich, R., Ginn, K., Cathers, I., Lee, M.
International Journal of Osteopathic Medicine, 2006/03
2475

Lower extremity Extension Dynamic Test: sensitivity and specificity in diagnosing a leg length inequality (LLI)
Alfonso, M., Andrea, M.
International Journal of Osteopathic Medicine, 2006/03
2476

Intraexaminer Reliability of Identifying a Dysfunctional Segment in the Thoracic and Lumbar Spine
Potter, L., McCarthy, C., Oldham, J.
Journal of Manipulative and Physiological Therapeutics, 2006/03
2477

Faith without works
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/03
Free full text
2478

Reliability of visual assessment for lumbar curves in standing: Does clinical experience matter?
Moran, R. W., Ljubotenski, E.
International Journal of Osteopathic Medicine, 2006/03
2479

Does osteopathic treatment have an influence on the symptoms of patients with chronic prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial
Marx, S.
International Journal of Osteopathic Medicine, 2006/03
2480

Risk and negligence: A minefield or an opportunity?
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2006/03
2481

The temporal effect of a high velocity thrust technique to the lumbar spine on cutaneous blood flow in the lower limb, comparing smokers and non-smokers
Howard, J.
International Journal of Osteopathic Medicine, 2006/03
2482

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03
2483

Center or periphery? The future of osteopathic principles and practices
Gevitz, N.
The Journal of the American Osteopathic Association, 2006/03
Free full text
2484

The electromyographic activity of thoracic paraspinal muscles identified as abnormal with palpation
Fryer, G., Morris, T., Gibbons, P., Briggs, A.
International Journal of Osteopathic Medicine, 2006/03
2485

A comparison of the effect of muscle energy technique (Chaitow method) and passive stretching on hanstring extensibility
Featherston, J.
Unpublished MSc thesis, 2006/03
Free full text
2486

In vitro biophysical strain model for understanding mechanisms of osteopathic manipulative treatment
Dodd, J. G., Good, M. M., Nguyen, T. L., Grigg, A. I., Batia, L. M., Standley, P. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
2487

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text
2488

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text
2489

Osteopathic medical education in 2006: charting a course for the future
Shannon, S. C.
The Journal of the American Osteopathic Association, 2006/02
Free full text
2490

Eine Studie über die Fähigkeit der Faszien, sich aktiv zu kontrahieren und zu entspannen und dadurch die Biomechanik des Körpers zu beeinflussen
(A study on the ability of fasciae to actively contract and relax and thereby influence the body biomechanics)
Schleip, R., Klingler, W.
Osteopathische Medizin, 2006/02
2491

Das bedeutende Vermächtnis der osteopathischen Prinzipien
(The most important legacy of osteopathic principles)
McGovern, J. J.
Osteopathische Medizin, 2006/02
2492

Das Berufsbild Osteopathie im Großraum Bodensee
(The osteopathic profession in the region of Lake Constance)
Feurstein, D.
Unpublished MSc thesis, 2006/02
Free full text
2493

A phenomenological single case study of African American medical students in a predominantly White college of osteopathic medicine
Brown, T. A. Sr.
Unpublished PhD thesis, 2006/01
2494

Cranial State of Mind - Does cranial osteopathy influence the patient's state of consciousness?
Engel, R.
Unpublished MSc thesis, 2006/01
Free full text
2495

Women in Osteopathy. A Synopsis of the Journals “DO” and “Osteopathic Medicine”
Schmid, A.
Unpublished MSc thesis, 2005/12
Free full text
2496

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text
2497

Immediate changes in radiographically determined lateral flexion range of motion following a single cervical HVLA manipulation in patients presenting with mechanical neck pain: A case series
Fernández-de-las-Peñas, C., Downey, C., Miangolarra-Page, J. C.
International Journal of Osteopathic Medicine, 2005/12
2498

To what should we attribute the effects of OMT?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/12
2499

The effect of training on the inter-examiner and intra-examiner reliability of the seated flexion test and assessment of pelvic anatomical landmarks with palpation
Fryer, G., McPherson, H. C., O'Keefe, P.
International Journal of Osteopathic Medicine, 2005/12
2500

The coming influenza pandemic: lessons from the past for the future
Patterson, M. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text
2501

American Osteopathic Association's policy statement on end-of-life care
Issues, Council on Palliative Care
The Journal of the American Osteopathic Association, 2005/11
Free full text
2502

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text
2503

Haben osteopathische Behandlungen einen Effekt bei Patienten mit Gonarthrose im Vergleich zu physikalischer und medikamentöser Therapie? Eine randomisierte kontrollierte Studie
(How effective are osteopathic treatments to patients with gonarthritis in comparison to the two most current forms of treatment namely physiotherapy and medication. A randomized controlled trial)
Auracher, M.
Unpublished D.O. thesis, 2005/10
2504

Systematic review of effects of manual therapy in infants with kinetic imbalance due to suboccipital strain (KISS) syndrome
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Journal of Manual and Manipulative Therapy, 2005/10
2505

Interobserver reliability of osteopathic palpatory diagnostic tests of the lumbar spine: improvements from consensus training
Degenhardt, B. F., Snider, K. T., Snider, E. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2005/10
Free full text
2506

Cost-effective osteopathic manipulative medicine: a literature review of cost-effectiveness analyses for osteopathic manipulative treatment
Gamber, R., Holland, S., Russo, D. P., Cruser d, A., Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2005/10
Free full text
2507

Osteopathische versus orthopädische Behandlung der chronischen Epicondylopathia humeri radialis: Eine randomisiert kontrollierte Untersuchung
(Osteopathic versus Orthopedic Interventions for Chronic Epicondylopathia humeri radialis: A randomized controlled trial)
Geldschläger, S.
Unpublished D.O. thesis, 2005/10
2508

Missed opportunity for osteopathic medical education
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
2509

Effektivität der osteopathischen Behandlung von Patienten mit chronischer Achilles-Tendinopathie. Eine randomisierte kontrollierte Studie
(Can osteopathic treatments effectively influence symptoms of patients with chronic achillotendinitis? A randomized controlled trial)
Hölscher, M., Notarius, R.
Unpublished D.O. thesis, 2005/10
2510

Haben osteopathische Behandlungen einen Einfluss auf die Symptome bei Patienten mit chronischer abakterieller Prostatitis/chronischem Beckenschmerzsyndrom ? Eine randomisierte kontrollierte Studie
(Does an osteopathic treatment have an influence on the symptoms of patients with a chronic abacterial prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial)
Marx, S.
Unpublished D.O. thesis, 2005/10
2511

Die therapeutische Wirksamkeit osteopathischer Behandlungen bei Säuglingen und Kindern mit Atopic Dermatitis. Eine randomisierte, kontrollierte Studie.
(The therapeutic effectiveness of osteopathic treatments of babies and children with atopic dermatitis. A randomized controlled trial)
Özbay, I., Reckwerth, M.
Unpublished D.O. thesis, 2005/10
2512

Die osteopathische Medizin im Dilemma zwischen Tradition und Moderne
(Osteopathic medicine in the dilemma between tradition and modern approach)
Beck, M., Unverricht, R.
Osteopathische Medizin, 2005/10
2513

Akkomodationsfähigkeit der Augen und ihre Beeinflussung durch osteopathische Behandlung bei Presbyopie – eine randomisierte kontrollierte Studie
(Accommodative ability of the eyes and its impact by a series of osteopathic treatments in presbyopia. A randomized controlled trial)
Stelzer, F.
Unpublished D.O. thesis, 2005/10
2514

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
2515

Der fasziale Test und die Behandlung der Articulatio coxae
(The fascial test and treatment of the articulatio coxae)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
2516

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
2517

Die akute Hüfte. Differenzialdiagnostische Überlegungen aus orthopädischer Sicht
(The Acute Hip. Considerations in Differential Diagnosis from an Orthopedic Aspect)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
2518

Osteopathie als Chance bei Kindern mit ADS/ADHS
“Osteopathy as an opportunity for children with ADD/ADHD“
Bierent-Vass, A.
Osteopathische Medizin, 2005/09
2519

Clinical Prevention and Population Health Curriculum Framework: the nursing perspective
Allan, J. D., Stanley, J., Crabtree, M. K., Werner, K. E., Swenson, M.
Journal of Professional Nursing, 2005/09
Free full text
2520

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text
2521

Management of osteoarthritic knee pain
Rubin, B. R.
The Journal of the American Osteopathic Association, 2005/09
Free full text
2522

Attention applicants: please submit emotional intelligence scores
Sefcik, D. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text
2523

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text
2524

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text
2525

Osteopathie als Chance für Kinder mit ADS/ADHS?
(Osteopathy as an opportunity for children with ADD/ADHD?)
Bierent-Vass, A.
Osteopathische Medizin, 2005/09
2526

Somatische Dysfunktion - Reflektion über die Anwendung des Begriffs in der osteopathischen Praxis
(Somatic dysfunction - Reflection on the use of the term in osteopathic practice)
Comeaux, Z.
Osteopathische Medizin, 2005/09
2527

Muscle energy technique: Geschichte, Modell und Wirksamkeit, Teil 2 - Das Modell
(Muscle energy technique. History, model and effectiveness, part 2 - The model)
Franke, H.
Osteopathische Medizin, 2005/09
2528

Interview mit Karel Lewit
(An interview with Karel Lewit)
Schmidt, S.
Osteopathische Medizin, 2005/09
2529

The cranio-cervical flexion test using pressure biofeedback: A useful measure of cervical dysfunction in the clinical setting?
Hudswell, S., von Mengersen, M., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09
2530

The active knee extension test and Slump test in subjects with perceived hamstring tightness
Kuilart, K. E., Woollam, M., Barling, E., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09
2531

Osteopathy in the cranial field – moving towards evidence for causality and effectiveness
Moran, R. W.
International Journal of Osteopathic Medicine, 2005/09
2532

Antwort auf: Crow TW: “Letter to the editor“ zu: Osteopath. Med. 5(4): 4-10, 2004: Sommerfeld P, Kaider A, Klein P: Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Answer to the letter to the editor: “Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept“ )
Sommerfeld, P.
Osteopathische Medizin, 2005/07
2533

Interexaminer Reliability of Osteopathic Palpatory Findings
Licciardone, J. C., Fulda, K., Stoll, S. T., Gamber, R. G., Cage, A. C.
The Journal of the American Osteopathic Association, 2005/07
2534

Muscle Energy Technique. Geschichte, Modell und Wirksamkeit, Teil 1
(Muscle energy technique. History, model and effectiveness - Part 1)
Franke, H.
Osteopathische Medizin, 2005/07
2535

Zum Thema der “osteopathischen Dreifaltigkeit“
(Osteopathic trinity 2)
Meert, G. F.
Osteopathische Medizin, 2005/07
2536

Qualitätssicherung in der Osteopathie in Österreich
(Quality assurance in osteopathy in Austria)
Mückler, A.
Osteopathische Medizin, 2005/07
2537

Effect of Counterstrain on Reflexes and Clinical Outcomes in Subjects with Plantar Fasciitis
Wynne, M. M., Burns, J. M., Eland, D. C., Conatser, R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2005/07
2538

Etienne Cloet - Was wirklich zählt
(Etienne Cloet - What really matters)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
2539

Erfahrungsprozess oder Bungee-Sprung in den Interzellularraum? Zu den Grundlagen osteopathischer Spiritualität
(A matter of experience or a bungee jump into intercellular space? On the foundations of osteopathic spirituality)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
2540

Antwort auf: Crow TW: “Letter to the editor“ zu: Osteopath. Med. 5(4): 4-10, 2004: Sommerfeld P, Kaider A, Klein P: Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Answer to the letter to the editor: “Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept“ )
Sommerfeld, P.
Osteopathische Medizin, 2005/07
2541

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text
2542

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text
2543

Active fascial contractility: Fascia may be able to contract in a smooth muscle-like manner and thereby influence musculoskeletal dynamics
Schleip, R., Klingler, W., Lehmann-Horn, F.
Medical Hypotheses, 2005/06
2544

What is the significance of somatic dysfunction in a multicausal model of aetiology?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2005/06
2545

IM ketorolac versus OMT: was agent at peak analgesic effect in JAOA study?
Coston, J. L., McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
2546

Taking osteopathic distinctiveness seriously: historical and philosophical perspectives
Osborn, G. G.
The Journal of the American Osteopathic Association, 2005/05
Free full text
2547

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
2548

The Cost of Professionalization: A Case Study Of Osteopathic Medicine In the United States
Harris, R.
Unpublished PhD thesis, 2005/05
Free full text
2549

A Pilot Study to Investigate the Validity of the Rule of Threes of the Thoracic Spine
Geelhoed, M. A., Viti, J. A., Brewer, P. A.
Journal of Manual & Manipulative Therapy, 2005/04/01
2550

Systematisch literatuuronderzoek naar de effecten van behandeling bij zuigelingen met 'kopgewrichteninvloed bij storingen in de symmetrie' ('KISS-syndroom')
(Systematic review of the effects of therapy in infants with the KISS-syndrome (kinetic imbalance due to suboccipital strain))
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Nederlands Tijdschrift voor Geneeskunde, 2005/04
Free full text
2551

Zur Übersetzung grundlegender Konzepte von A.T. Still: „Man is Triune“
(Regarding the translation of fundamental concepts of A.T. Still: “Man is Triune“)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
2552

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text
2553

Inter- und Intratester-Reliabilität der Palpation des “ Primären Respiratorischen Mechanismus“ innerhalb des “ Cranialen Konzeptes“
(Intertester and intratester reliability of population of the “ primary respiratory mechanism“ within the “cranial concept“)
Crow, T.
Osteopathische Medizin, 2005/03
2554

Specialist or Generalist?
Chila, A. G.
The AAO Journal, 2005/03
Free full text
2555

Survey of osteopathic and allopathic residents' attitudes toward osteopathic manipulative treatment
Allee, B. A., Pollak, M. H., Malnar, K. F.
The Journal of the American Osteopathic Association, 2005/03
Free full text
2556

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03
2557

Acute Intermittent Porphyria Mimic of Guillain-Barré Syndrome: A Case Report with the Use of Osteopathic Manipulation for Management of Pain
McClennen, E. R., Gamber, R.
The AAO Journal, 2005/03
Free full text
2558

Rolfing und Osteopathie: Form und Funktion aus der Sicht des Rolfing
(Rolfing and osteopathy: Form and function from the viewpoint of rolfing)
Flury, H.
Osteopathische Medizin, 2005/03
2559

Qualität in der Osteopathiepraxis
(Quality in osteopathy practice)
Hafen, F.
Osteopathische Medizin, 2005/03
2560

Palpation und Forschung
(Palpation and research in osteopathy)
Muzzi, D.
Osteopathische Medizin, 2005/03
2561

Heilige Einfalt/Spannungsreiche Dreifaltigkeit
(Philosophy in osteopathic medicine: Sacred naivety/excoting trinity)
Wührl, P.
Osteopathische Medizin, 2005/03
2562

From small acorns
Gibbons, P.
International Journal of Osteopathic Medicine, 2005/03
2563

Attitudes towards prescribing rights: a qualitative focus group study with UK osteopaths
Grundy, M., Vogel, S.
International Journal of Osteopathic Medicine, 2005/03
2564

Welcome to IJOM
Moore, A. P.
International Journal of Osteopathic Medicine, 2005/03
2565

IJOM: An international journal for an international readership
Moran, R. W., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/03
2566

An account of the development of the conceptual basis of osteopathy course at the British School of Osteopathy
Nash, K., Tyreman, S.
International Journal of Osteopathic Medicine, 2005/03
2567

Inter- und Intratester-Reliabilität der Palpation des “ Primären Respiratorischen Mechanismus“ innerhalb des “ Cranialen Konzeptes“
(Intertester and intratester reliability of population of the “ primary respiratory mechanism“ within the “cranial concept“)
Crow, T.
Osteopathische Medizin, 2005/03
2568

Intramuscular ketorolac versus osteopathic manipulative treatment in the management of acute neck pain in the emergency department: a randomized clinical trial
McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/02
Free full text
2569

Cranial manipulation can alter sleep latency and sympathetic nerve activity in humans: a pilot study
Cutler, M. J., Holland, B. S., Stupski, B. A., Gamber, R. G., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2005/02
2570

Hysteresis as a measure of ankle dysfunction
Cohen, A. M., Mertz, J., Stewart, P., Warner, M. J., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/01
Free full text
2571

Chronic low back pain: osteopaths' attitudes and management
Griffiths, L.
Unpublished MSc thesis, 2005/01
Free full text
2572

Patient compliance to exercise prescription at the Victoria University osteopathic medicine clinic
Wheller, R.
Unpublished MSc thesis, 2005/01
Free full text
2573

The effect of a muscle energy stretch on suboccipital tenderness
Boswell, C.
Unpublished MSc thesis, 2005/01
Free full text
2574

Osteopaths' views on prescription rights: a qualitative pilot study
Burns, R.
Unpublished MSc thesis, 2005/01
Free full text
2575

Compliance to verbal and diagrammatic Patient Rehabilitation Advice (PRA) at the Victoria University Osteopathic Medicine Clinic (VUOMC)
Herman, N.
Unpublished MSc thesis, 2005/01
Free full text
2576

A pilot study investigating professional standardisation and harmonisation in osteopathic institutions within Europe and Australia
Hristov, A.
Unpublished MSc thesis, 2005/01
Free full text
2577

An investigation into the effects of intermittent hypoxia on patients with essential hypertension
Kemlo, G.
Unpublished MSc thesis, 2005/01
Free full text
2578

Spondylodiszitis
(Spondylodiscitis)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
2579

The Involvement of Cerebrospinal Fluid and Lymphatic Drainage in Chronic Fatigue Syndrome (CFS/ME)
Perrin, R.
Unpublished PhD thesis, 2005/01
2580

A Case Study of Left Adhesive Capsulitis Presumably Resulting from Previous Treatment with Protease Inhibitors
Lipton, J. A., Neil, M.
The AAO Journal, 2004/12
Free full text
2581

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text
2582

Cost-utility analysis of osteopathy in primary care: results from a pragmatic randomized controlled trial
Williams, N. H., Edwards, R. T., Linck, P., Muntz, R., Hibbs, R., Wilkinson, C., Russell, I., Russell, D., Hounsome, B.
Family Practice, 2004/12
Free full text
2583

Die sensomotorische Entwicklung des Kindes
(The sensomotoric development of the child)
Darraillans, B.
Osteopathische Medizin, 2004/11
2584

Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept)
Sommerfeld, P., Kaider, A., Klein, P.
Osteopathische Medizin, 2004/11
Free full text
2585

Ist das alte Modell der sphenobasilaren Symphyse noch aktuell? Pro und Contra
(Is the old sphenobasilar symphysis model still relevant? Pros and cons)
Esser, T., Guillaume, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
2586

Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept)
Sommerfeld, P., Kaider, A., Klein, P.
Osteopathische Medizin, 2004/11
2587

Kann die Osteopathie einen spezifischen Beitrag in der Behandlung von Kindern mit Aufmerksamkeitsstörungen ohne Hyperaktivität und mit Hyperaktivität – ADS/ADHS leisten? Eine randomisierte kontrollierte Studie
(Osteopathic treatment of children with attention deficit disorders, with or without hyperactivity (ADD/ADHD) - is there any effect? A randomized controlled trial)
Bierent-Vass, A., Lang, J., Neumann, N.
Unpublished D.O. thesis, 2004/10
2588

Kann eine osteopathische Behandlung die Dyspareunie beeinflussen?
(Can patients, suffering from Dyspareunia, expect improvement from an osteopathic treatment? A controlled and prospective trial)
Hoffmann, A., Band, I.
Unpublished D.O. thesis, 2004/10
2589

Die osteopathische Behandlung von Patienten mit Coxarthrose
(The osteopathic treatment of patients with coxarthritis)
Kießling, G., Trantenroth, M.
Unpublished D.O. thesis, 2004/10
2590

Schädelformauffälligkeiten bei Säuglingen – Bestandsauf-nahme aus der Literatur und Entwicklung einer Messmethode
(Skull shape abnormalities in infants - review from the literature and development of a measurement method.)
Kleemann, E.
Unpublished D.O. thesis, 2004/10
2591

Knochen und Suturen im nasomaxillären Bereich des Schädels. Entwicklung, Ossifikation, Wachstum und Mobilität
(Bones and sutures within the nasomaxillary region of the cranium: Development, ossification, growth and mobility of those bones)
Lippmann, C.
Unpublished D.O. thesis, 2004/10
2592

The international conference on advances in osteopathic research (ICAOR) — the first five years
Walters, N.
Journal of Osteopathic Medicine, 2004/10
Free full text
2593

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09
2594

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09
2595

Am I a carer and do I care? An exploration of the concept of care as applied to osteopathic practice
Barnes, A.
Medicine, Health Care and Philosophy, 2004/09
2596

The hospitalist: a patient-focused paradigm?
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2004/09
Free full text
2597

Influenza epidemic or pandemic? Time to roll up sleeves, vaccinate patients, and hone osteopathic manipulative skills
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/09
Free full text
2598

The Effect of Osteopathic Manipulative Treatment on Gait Disturbance in Multiple Sclerosis Patients
Mann, J. M., Steele, K. M.
The AAO Journal, 2004/09
Free full text
2599

Chronic Pelvic Pain Syndrome
Rossi, P. J., Dickey, J. L.
The AAO Journal, 2004/09
Free full text
2600

A review of King HH and Lay EM, “Osteopathy in the Cranial Field,“ in Foundations for Osteopathic Medicine, 2nd ed
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2004/09
2601

Das Selbstverständnis eines Osteopathen
(Self-image of an osteopath)
Dräger, K.
Osteopathische Medizin, 2004/08
2602

Osteopathie- ein viel versprechender Ansatz zur Verbesserung der Lebensqualität bei Panikattacken
(Osteopathy - A very promising approach to improve the quality of life in persons suffering from panic attacks)
Michaud, C.
Osteopathische Medizin, 2004/08
2603

Literaturrecherche mithilfe des Internets
(Literature search on the internet)
Müller, T. M.
Osteopathische Medizin, 2004/08
2604

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text
2605

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text
2606

Treatment Credibility in Osteopathic Manipulative Treatment Research
Russo, D. P., Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/08
2607

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
2608

Yes, Dr Still, an MD won the 2004 Northup Writing Award!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/07
Free full text
2609

Wither the Osteopathic Hospital
Chila, A. G.
The AAO Journal, 2004/06
Free full text
2610

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text
2611

Health Promotion and Disease Prevention (HPDP) Programs of Osteopathic Hospitals: A Comparative Analysis Abstract
Sinay, T., Geletta, S.
The AAO Journal, 2004/06
Free full text
2612

Osteopathie und Senkung der Arbeitsunfähigkeitszeit
(Osteopathy and disability reduction)
Hack, A.
Manuelle Medizin, 2004/05
2613

Pseudokrupp
(Pseudo Croup)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
2614

8. Europäisches Symposium der traditionellen Osteopathie
(8th European Symposium of Traditional Osteopathy)
Frühwein, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
2615

A randomized controlled trial of osteopathic manipulative treatment following knee or hip arthroplasty
Licciardone, J. C., Stoll, S. T., Cardarelli, K. M., Gamber, R. G., Swift, J. N., Jr., Winn
The Journal of the American Osteopathic Association, 2004/05
Free full text
2616

Aspekte des Dialogs zwischen Kinderarzt und Osteopath
(Aspects of dialogue between paediatricians and osteopath)
Philippi, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
2617

Infantile Schluckstörungen - in die Hand des Osteopathen
(Infantile swallowing disorder: To the hands of osteopaths)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
2618

Osteopathie auf der Intensivstation
(Osteopathy in the intensive care unit)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
Free full text
2619

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text
2620

The effect of manipulation and mobilisation on pressure pain thresholds in the thoracic spine
Fryer, G., Carub, J., McIver, S.
Journal of Osteopathic Medicine, 2004/04
2621

Musculoskeletal disorders: does the osteopathic medical profession demonstrate its unique and distinctive characteristics?
Sun, C., Desai, G. J., Pucci, D. S., Jew, S.
The Journal of the American Osteopathic Association, 2004/04
Free full text
2622

The seven year itch
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2004/04
Free full text
2623

Interdisciplinary approach to teaching medication adherence to pharmacy and osteopathic medical students
Singla, D. L., MacKinnon, G. E., 3rd, MacKinnon, K. J., Younis, W., Field
The Journal of the American Osteopathic Association, 2004/03
Free full text
2624

Inter- and intraexaminer reliability in palpation of the “primary respiratory mechanism” within the “cranial concept”
Sommerfeld, P., Kaider, A., Klein, P.
Manual Therapy, 2004/02
2625

John Martin Littlejohn, Vater der europäischen Osteopathie
(John Martin Littlejohn, father of European osteopathy)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
2626

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text
2627

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text
2628

Forces generated in high velocity, low amplitude manipulations of both the dominant and non-dominant rib 1 costotransverse joints: a pilot study
Buttigieg, D.
Unpublished MSc thesis, 2004/01
Free full text
2629

Accuracy of the OMRON M4 automatic sphygmomanometer
Clarke, A.
Unpublished MSc thesis, 2004/01
Free full text
2630

Migraine and emotion: a qualitative pilot study
Conroy, K.
Unpublished MSc thesis, 2004/01
Free full text
2631

The effect of manipulation to the proximal tibiofibular joint and talocrural joint on ankle dorsiflexion range of motion
de Caneva, D.
Unpublished MSc thesis, 2004/01
Free full text
2632

Pain, depression, anxiety and disability in back pain: do people seeking osteopathic treatment fit known profiles?
Delaney, C.
Unpublished MSc thesis, 2004/01
Free full text
2633

The effect of thoracolumbar high velocity low amplitude manipulation on gross trunk range of motion: is the direction of thrust important?
Fuller, L.
Unpublished MSc thesis, 2004/01
Free full text
2634

Presumption of perception: people with arthritis challenge the importance of pain in treatment
Goodwin, R.
Unpublished MSc thesis, 2004/01
Free full text
2635

The importance of an early positive change in pain and function in determining overall clinical improvement following strengthening treatment for chronic neck pain
Harding, L.
Unpublished MSc thesis, 2004/01
Free full text
2636

Spirituality and osteopathy: a practitioners' views
Huggett, S.
Unpublished MSc thesis, 2004/01
Free full text
2637

The effect of osteopathic manipulative therapy applied to the lumbar spine on postural stability: a pilot study
Jones, D.
Unpublished MSc thesis, 2004/01
Free full text
2638

Erectile dysfunction and comorbid diseases, androgen deficiency, and diminished libido in men
Fine, S. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text
2639

The effect of training on the inter-examiner and intra-examiner reliability of static palpation for assessing pelvic landmarks
McPherson, H. C.
Unpublished MSc thesis, 2004/01
Free full text
2640

The effect of thoracolumbar high velocity low amplitutde manipulation on gross trunk rotational range of motion: is the position of the technique important?
Mudge, P.
Unpublished MSc thesis, 2004/01
Free full text
2641

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text
2642

A comparison between muscle energy technique and high velocity low amplitude thrust technique on gross trunk rotation range of motion
Nawrocki, S.
Unpublished MSc thesis, 2004/01
Free full text
2643

Inter-examiner and intra-examiner reliability of the seated flexion test
O'Keefe, P.
Unpublished MSc thesis, 2004/01
Free full text
2644

Lasting effects of atlanto-axial manipulation on edge light pupil cycle time
Olarenshaw, A.
Unpublished MSc thesis, 2004/01
Free full text
2645

Osteopathic emergency physician training and use of osteopathic manipulative treatment
Ray, A. M., Cohen, J. E., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text
2646

Emu oil for osteoarthritic hand pain
Power, R.
Unpublished MSc thesis, 2004/01
Free full text
2647

The effect of osteopathic treatment on the irritable bowel syndrome: a case series
Stasiuk, D.
Unpublished MSc thesis, 2004/01
Free full text
2648

The effect of high velocity low amplitude manipulation on the amelioration of cervical spine rotation asymmetries: is the cavitation important?
Strachan, D.
Unpublished MSc thesis, 2004/01
Free full text
2649

Effects of osteopathic treatment on people with psoriatic arthritis: a pilot study
Wall, R., Ryan, E., Kiatos, J.
Unpublished MSc thesis, 2004/01
Free full text
2650

The effect of manipulation on pressure pain thresholds in the lumbar spine in asymptomatic participants
Wallis, C.
Unpublished MSc thesis, 2004/01
Free full text
2651

Postmenopause: womens' experiences
Walshe, S.
Unpublished MSc thesis, 2004/01
Free full text
2652

Support needed for clinical faculty in osteopathic emergency medicine residencies
Minor, S. K., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2003/12
Free full text
2653

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11
2654

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text
2655

Osteopathie hilft bei Prävention & Reha
(Osteopathy helps in prevention and rehabilitation)
Schaa, J.
Pflege Aktuell, 2003/11
2656

Position-Assisted Combination Technique (PACT) in the Management of Type-II Impairment in the Thoracic and Lumbar Spine
Makofsky, H. W.
Journal of Manual and Manipulative Therapy, 2003/10
2657

The effect of muscle energy technique on hamstring extensibility: the mechanism of altered flexibility
Ballantyne, F., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/10
2658

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10
2659

William L. Johnston, DO, 1921–2003
McPartland, J. M.
Journal of Osteopathic Medicine, 2003/10
2660

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10
2661

A prospective study of osteopathic medical students' attitudes toward use of osteopathic manipulative treatment in caring for patients
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2003/10
Free full text
2662

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text
2663

Presence of Chapman reflex points in hospitalized patients with pneumonia
Washington, K., Mosiello, R., Venditto, M., Simelaro, J., Coughlin, P., Crow, W. T., Nicholas, A.
The Journal of the American Osteopathic Association, 2003/10
Free full text
2664

Os sphenoidale und Os ethmoidale – Entwicklung, Verknöcherung und Frage nach der Möglichkeit einer Mobilität
(Sphenoid bone and Ethmoid bone – Development, Ossification and the Question of a possible Mobility)
Eser-Bindl, U.
Unpublished D.O. thesis, 2003/10
2665

Die therapeutische Wirksamkeit der osteopathischen Behandlung bei Kindern mit auditiven Verarbeitungs- und Wahrnehmungsstörungen - Pilotstudie -
(The therapeutic efficacy of osteopathy in treating children with auditory processing and perception disorders - pilot study)
Guerassimiouk, D., Markhoff, J.P.
Unpublished D.O. thesis, 2003/10
2666

Pilotstudie zur Untersuchung der Wirksamkeit der osteopathischen Tuba auditiva Technik bei akuten Tinnituspatienten mit und ohne Hörstörungen
(Randomized clinical trial to investigate the efficacy of osteopathic tuba auditiva technique in acute tinnitus patients with and without hearing disorders - a pilot study.)
Mayer, M.
Unpublished D.O. thesis, 2003/10
2667

Editorial
Moran, R., Lucas, N.
Journal of Osteopathic Medicine, 2003/10
Free full text
2668

Ist der Osteopath in Deutschland zur selbstständigen Berufsausübung berechtigt?
(Is the osteopath authorized to practice independently in Germany?)
Boxberg, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2669

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2670

Osteopathische Selbsthilfe bei Unterleibsschmerzen und Beckenbodendysfunktion
(Osteopathic self-help for abdominal pain and pelvic floor dysfunction)
Tettambel, M. A.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
2671

Osteopathic manipulative treatment in the emergency department for patients with acute ankle injuries
Eisenhart, A. W., Gaeta, T. J., Yens, D. P.
The Journal of the American Osteopathic Association, 2003/09
Free full text
2672

Development of the Attitudes Toward Osteopathic Principles and Practice Scale (ATOPPS): preliminary results
Russo, D. P., Stoll, S. T., Shores, J. H.
The Journal of the American Osteopathic Association, 2003/09
Free full text
2673

Facilitated Oscillatory Release - a method of dynamic assessment and treatment of Somatic Dysfunction
Comeaux, Z. J.
The AAO Journal, 2003/09
Free full text
2674

The use of osteopathic manipulative treatment as adjuvant therapy in children with recurrent acute otitis media
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F.
Archives of Pediatrics & Adolescent Medicine, 2003/09
Free full text
2675

Osteopathic manipulation to prevent otitis media--does it work?
Pichichero, M. E.
Archives of Pediatrics & Adolescent Medicine, 2003/09
2676

Osteopathic and Allopathic Family Practice Residents' Attitudes Toward OMT/OPP
Allee, B. A., Pollak, M. H., Malnar, K. F., Elfrink, L. D., Mulkey, L. E.
Journal of Osteopathic Medicine, 2003/08
2677

Determining the Impact of Osteopathic Manipulative Therapy in the Management of Irritable Bowel Syndrome
Chiesa, J. C., Pomerantz, S. C., Shinkle, J. W., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08
2678

A primary care approach to comprehensive care of patients with type 1 and type 2 diabetes mellitus
Keilers, R. K.
The Journal of the American Osteopathic Association, 2003/08
Free full text
2679

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text
2680

Die Wirksamkeit des multimodalen (manualtherapeutischen, osteopathischen) Therapiekonzeptes bei Kindern mit infantiler Cerebralparese
(The effectiveness of multimodal therapy concepts in children with cerebral palsy)
Steingrube-Bradtke, E.
Kranken Gymnastik, 2003/08
2681

The passive straight leg raising test in the diagnosis and treatment of lumbar disc herniation: a survey of United kingdom osteopathic opinion and clinical practice
Rebain, R., Baxter, G. D., McDonough, S.
Spine (Phila Pa 1976), 2003/08
2682

Osteopathic Manipulative Therapy (OMT) as a Non-pharmacological Treatment for Stable Patients with Emphysema and Chronic Bronchitis
Morley, T. F., Shinkle, J. W., Pomerantz, S. C., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08
2683

Aufbau und Funktion des Peritoneums
(Structure and function of the peritoneum)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2684

Schlüsselfunktionen des Peritoneums bei Rückenschmerzen
(Key functions of the peritoneum in back pain)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2685

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
2686

Die Klavikula
(The clavicle. The key to the shoulder)
Hack, A.
Manuelle Medizin, 2003/06
2687

Somatovisceral response following osteopathic HVLAT: a pilot study on the effect of unilateral lumbosacral high-velocity low-amplitude thrust technique on the cutaneous blood flow in the lower limb
Karason, A. B., Drysdale, I. P.
Journal of Manipulative and Physiological Therapeutics, 2003/05
2688

Osteopathic manipulative treatment techniques preferred by contemporary osteopathic physicians
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2003/05
Free full text
2689

Practice-based osteopathic research
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2003/04
2690

Osteopathie bei chronischer Sinusitis
(Osteopathy for chronic sinusitis)
Häfner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2691

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2692

Die chronische Sinusitis: Eine Übersicht
(A review of chronic sinusitis)
Resch, K.L., Häfner, S., Stadler, M., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2693

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2694

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2695

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2696

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
2697

Time to forge affiliations between osteopathic medical schools and hospitals
Belsky, D. H.
The Journal of the American Osteopathic Association, 2003/03
Free full text
2698

Tobaccoism revisited
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/03
Free full text
2699

Bibliotherapy: the therapeutic use of didactic and literary texts in treatment, diagnosis, prevention, and training
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2003/03
Free full text
2700

Bioelectric responsiveness of fascia: A model for understanding the effects of manipulation
O'Connell, J. A.
Techniques in Orthopaedics, 2003/03
2701

Etiological Factors in Sacral Somatic Dysfunctions
Danto, J. B.
The AAO Journal, 2003/03
Free full text
2702

From the Archives: The Contribution of John Martin Littlejohn to Osteopathy
Hall, T. E., Wernham, J.
The AAO Journal, 2003/03
Free full text
2703

Validity and reliability of the Osteopathic Survey of Health Care in America (OSTEOSURV)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/02
Free full text
2704

Results of a survey of inaugural class graduates of a college of osteopathic medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2003/01
Free full text
2705

The effect of talo-crural joint manipulation on range of motion at the ankle joint in subjects with a history of ankle injury
Andersen, S.
Unpublished MSc thesis, 2003/01
Free full text
2706

A pilot study of the fundamental elements of osteopathic diagnosis as currently taught in the osteopathy course at Victoria University
Chisari, M.
Unpublished MSc thesis, 2003/01
Free full text
2707

DOs should embrace increased emphasis on care for older adults
Vieder, J. N.
The Journal of the American Osteopathic Association, 2003/01
Free full text
2708

Osteopathic treatments and the techniques used in the treatment of acute mechanical low back pain
Daskalou, D.
Unpublished MSc thesis, 2003/01
Free full text
2709

A comparison of the immediate and lasting effects between passive stretch and muscle energy technique on hamstring muscle extensibility
Ng, C. S. A.
Unpublished MSc thesis, 2003/01
Free full text
2710

The effect of lymphatic pump techniques on the FEV and FVC measurements in people with asthma: a pilot study
Falzon, M.
Unpublished MSc thesis, 2003/01
Free full text
2711

A study of physiotherapists' and chiropractors' knowledge and opinions of osteopaths
Hough, N.
Unpublished MSc thesis, 2003/01
Free full text
2712

Functional instability of the ankle and its relationship to the Q angle
Kenney, M.
Unpublished MSc thesis, 2003/01
Free full text
2713

The effect of manipulation on pressure pain thresholds in the thoracic spine
McIver, S.
Unpublished MSc thesis, 2003/01
Free full text
2714

The acute effects of taping on proprioception in the ankle with previous inversion sprain
Mumford, K.
Unpublished MSc thesis, 2003/01
Free full text
2715

The association of osteopathic tests and diagnoses of sacroiliac joint dysfunction with ground reaction forces during gait
Orrock, P.
Unpublished MSc thesis, 2003/01
Free full text
2716

Reliability and validity of selected pain provocation tests at the sacroiliac joint
Thompson, J.
Unpublished MSc thesis, 2003/01
Free full text
2717

Complementary therapies and general practitioners: a survey investigating the referral patterns of general practitioners in regional Victoria
Williams, H.
Unpublished MSc thesis, 2003/01
Free full text
2718

An investigation of the lasting effects of thoracic manipulation and rib raising on spirometric measurements of asymptomatic participants
Williams, K.
Unpublished MSc thesis, 2003/01
Free full text
2719

Hausaufgaben und Tipps für’s Knie
(Homework and tips for the knee)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2720

Die Arthrose in die Knie gezwungen? Studie zu chronisch-degenerativen Knie- bzw. Hüftschmerzen
(Osteoarthritis brought to its knees? Study on chronic degenerative knee or hip pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2721

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
2722

Social Capital and Osteopathic Medicine in Transition
Ward, R. C.
The AAO Journal, 2002/12
Free full text
2723

Aptitude for osteopathic training. 1939
Yarborough, J. U.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2724

Training family medicine residents for assessment and advocacy of older adults
Robbins, M. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2725

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2726

The effect of cranial manipulation on the Traube-Hering-Mayer oscillation as measured by laser-Doppler flowmetry
Sergueef, N., Nelson, K. E., Glonek, T.
Alternative Therapies in Health and Medicine, 2002/11
2727

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text
2728

Hat eine osteopathische Behandlung einen Effekt bei Kindern mit Hyperaktivität und/oder eines Aufmerksamkeits-Defizitsyndroms.
(Can osteopathic treatment have an effect on children with Attention Deficit Hyperactivity Disorder Syndrome (ADHD) and/or Attention Disorder Syndrome (ADD)? A randomized controlled trial.)
Haas, J, Käser, D, Werner, M
Unpublished D.O. thesis, 2002/10
2729

Osteopathie und chronische Sinusitis: Eine randomisierte kontrollierte Pilotstudie
(Osteopathic treatment of chronic sinusitis: a randomized controlled pilot trial)
Häfner, S., Stadler, M.
Unpublished D.O. thesis, 2002/10
2730

Untersuchung der Reproduzierbarkeit osteopathischer Tests am Beispiel des Beckens
(Study of the reproducibility of osteopathic tests using the pelvis as an example.)
L, Monteiro-Ferreira J. Rößel-Bretschneider A. Thuillier
Unpublished D.O. thesis, 2002/10
2731

Einfluss osteopathischer Behandlungen auf Konzentrationsstörungen bei Kindern [Pilotstudie]
(Effect of osteopathic treatments on concentration disorders in children. A pilot study)
Lamberts, A.
Unpublished D.O. thesis, 2002/10
2732

Die therapeutische Wirksamkeit einer osteopathischen Behandlung beim Reizdarmsyndrom: Eine randomisierte kontrollierte Studie
(Osteopathy as a promising short-term strategy for irritable bowel syndrome: randomized controlled trial)
Müller, A., Salomon, J., Stiedl, M.
Unpublished D.O. thesis, 2002/10
2733

Editorial
Moran, R., Lucas, N.
Journal of Osteopathic Medicine, 2002/10
2734

Editorial
Moran, R., Lucas, N.
Journal of Osteopathic Medicine, 2002/10
Free full text
2735

How physicians approach advance care planning in patients with mild to moderate Alzheimer's disease
Cavalieri, T. A., Latif, W., Ciesielski, J., Ciervo, C. A., Jr., Forman
The Journal of the American Osteopathic Association, 2002/10
Free full text
2736

Developing research at The British School of Osteopathy
Nash, K., Vogel, S.
Journal of Osteopathic Medicine, 2002/10
2737

Inter-examiner and intra-examiner agreement for assessing simulated leg length inequality using palpation and observation during a standing assessment
Gibbons, P., Dumper, C., Gosling, C.
Journal of Osteopathic Medicine, 2002/10
2738

Re: Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
McGovern, J. J., McGovern, R. J., Lemley, W. W.
The AAO Journal, 2002/09
Free full text
2739

Osteopathic Manipulative Treatment and Task Specific Practice Enhance Locomotor Recovery after Unilateral Sensorimotor Cortex Lesions in Rats
Schmanke, T., Rosario, H., Chughtai, H., Ruiz, C., O'Halpin, S., Wells, M. R., Hallas, B. H., Scandalis, T. A.
The Journal of the American Osteopathic Association, 2002/09
2740

Establishment of a Research Culture in an Osteopathic Family Medicine Department: Results of a Three-Year Project
Smith-Barbaro, P., Knisley, C., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2002/09
2741

Long nights a long time ago
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2002/09
Free full text
2742

Osteopathic Manipulation Increases Active Range of Motion and Gait Parameters in Osteoarthritis: A Pilot Study
Bahamonde, L. G., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
Journal of Osteopathic Medicine, 2002/08
2743

The Effects of Cranio-Sacral CV-4 on Muscle Sympathetic Nerve Activity
Cutler, M. J., Stupski, B. A., Gamber, R. G., Smith, M. L.
The Journal of the American Osteopathic Association, 2002/08
2744

Impact of Osteopathic Manual Medicine in Patients with Knee Osteoarthritis
Degenhardt, B. F., Kenney, R. G., McGovern, R. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/08
2745

Interexaminer Reliability in Palpatory Evaluation of the Lumbar Spine
Degenhardt, B. F., Snider, K. T., Johnson, J. C., Snider, E. J.
The Journal of the American Osteopathic Association, 2002/08
2746

Joint Kinetic Parameters as Indicators of Osteopathic Manipulative Treatment Effect in Osteoarthritis of the Knee
Kilbury Nason, L. L., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
The Journal of the American Osteopathic Association, 2002/08
2747

Effect of Osteopathic Manipulative Treatment (OMT) On Recurrent Acute Otitis Media in Children
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F., Worden, K.
The Journal of the American Osteopathic Association, 2002/08
2748

High Velocity Low Amplitude Thrust Techniques: How Much Force is Applied During These Therapeutic Maneuvers?
Rivera-Martinez, S., DiGiovanna, E. L., Yao, S. C., Mazzie, J., Protopapas, M. G.
The Journal of the American Osteopathic Association, 2002/08
2749

Interexaminer Reliability of Somatic Palpatory Findings Associated With Chronic Low Back Pain
Russo, D. P., Stoll, S. T., Licciardone, J. C., Gamber, R. G.
The Journal of the American Osteopathic Association, 2002/08
2750

The anatomy professor that ate New York: some dinosaurs are teachers, and some teach about dinosaurs
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2002/08
Free full text
2751

Rating interest in clinical research among osteopathic medical students
Licciardone, J. C., Fulda, K. G., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/08
Free full text
2752

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
2753

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text
2754

A Discussion of Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
Lemley, W. W.
The AAO Journal, 2002/06
Free full text
2755

Osteopathic manipulative treatment in conjunction with medication relieves pain associated with fibromyalgia syndrome: results of a randomized clinical pilot project
Gamber, R. G., Shores, J. H., Russo, D. P., Jimenez, C., Rubin, B. R.
The Journal of the American Osteopathic Association, 2002/06
Free full text
2756

Resources in bioethics at osteopathic medical schools
Peppin, J., Leeper, K., Garloff, D.
Academic Medicine, 2002/05
Free full text
2757

Can we afford to lose another osteopathic teaching facility?
Dickason, R. H.
The Journal of the American Osteopathic Association, 2002/05
Free full text
2758

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text
2759

Health status and satisfaction of patients receiving ambulatory care at osteopathic training clinics
Licciardone, J. C., Brittain, P. D., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2002/04
Free full text
2760

Inter-examiner reliability in detecting cervical spine dysfunction: A short review
Vaughan, B.
Journal of Osteopathic Medicine, 2002/04
2761

Editorial
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2002/04
2762

Search Words: Osteopath, Osteopathy, Osteopathic
Chila, A. G.
The AAO Journal, 2002/03
Free full text
2763

Quality of life in referred patients presenting to a specialty clinic for osteopathic manipulative treatment
Licciardone, J. C., Gamber, R. G., Russo, D. P.
The Journal of the American Osteopathic Association, 2002/03
Free full text
2764

Evaluation of osteopathic manipulative treatment training by practicing physicians in Ohio
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2002/03
Free full text
2765

The Anatomy Professor That Ate New York: Some Dinosaurs Are Teachers, And Some Teach About Dinosaurs
Cammarata, J.
The AAO Journal, 2002/03
Free full text
2766

Spirituality and end-of-life care
Reeves, R. R., Reynolds, M.
The Journal of the American Osteopathic Association, 2002/02
Free full text
2767

Interexaminer reliability and cranial osteopathy
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2002/01
2768

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text
2769

An Investigation into the Efficacy of an Osteopathic/Naturopathic Treatment Regime on the Symptoms of Irritable Bowel Syndrome
Mitchell, S.
Unpublished Dissertation, 2002/01
2770

Attitudes of osteopathic physicians toward physician-assisted suicide
Cavalieri, T. A., Pomerantz, S. C., Ciesielski, J., Shinkle, J. W., Forman, L. J.
The Journal of the American Osteopathic Association, 2002/01
Free full text
2771

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text
2772

FIMM 2001
Chila, A. G.
The AAO Journal, 2001/12
Free full text
2773

Is there any osteopathy in the specialty training of osteopathic residents?
Glover, J. C.
The AAO Journal, 2001/12
Free full text
2774

An adventure in excellence. 1962
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/12
2775

A Fact: The Medical Industry Doesn't Support Hands-On CME!
Noone, S. J.
The AAO Journal, 2001/12
Free full text
2776

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text
2777

The value of magnetic resonance imaging of the lumbar spine to predict low-back pain in asymptomatic subjects: a seven-year follow-up study
Borenstein, D. G., O'Mara, J. W., Boden, S. D., Lauerman, W. C., Jacobson, A., Platenberg, C., Schellinger, D., Wiesel, S. W.
Journal of Osteopathic Medicine, 2001/10
2778

Measurement challenges in physical diagnosis: refining inter-rater palpation, perception and communication
Comeaux, Z., Eland, D., Chila, A. G., Pheley, A., Tate, M.
Journal of Osteopathic Medicine, 2001/10
2779

Comparison of effects of spinal manipulation and massage on motoneuron excitability
Dishman, J. D., Bulbulian, R.
Journal of Osteopathic Medicine, 2001/10
2780

Good and compassionate care for dying patients
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/10
2781

Patient positioning and spinal locking for lumbar spine rotation manipulation
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10
2782

Motivation for change and personal resources in patients with prolonged musculoskeletal disorders
Grahn, E. B. M., Stigmar, G. K. E., Ekdahl, C. S.
Journal of Osteopathic Medicine, 2001/10
2783

The effective forces transmitted by high-speed, low-amplitude thoracic manipulation
Herzog, W., Kats, M., Symons, B.
Journal of Osteopathic Medicine, 2001/10
2784

Thoracic spine dysfunction in upper extremity complex regional pain syndrome type I
Menck, J. Y., Requejo, S. M., Kulik, K.
Journal of Osteopathic Medicine, 2001/10
2785

Intra-examiner and inter-examiner reliability of a positional diagnostic screen for the lumbar spine
Spring, F., Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10
2786

Pain and muscular responses to a neural tissue provocation test in the upper limb
van der Heide, B., Allison, G. T., Zusman, M.
Journal of Osteopathic Medicine, 2001/10
2787

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text
2788

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09
2789

Respect the friendly adversary
Anderson, R. B.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2790

Marketing lessons and retaining the traditional osteopathic internship
Broder, D. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2791

Knowing more than the score: providing sideline medical care coverage for athletic competition
Brolinson, G., Cibor, G. M.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2792

Decline in structural examination compliance in the hospital medical record with advancing level of training
Essig-Beatty, D. R., Klebba, G. E., LaPointe, N. G., Miller, E. D., Strong, R. E.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2793

Has our profession become its own worst enemy?
Fettig, L. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text
2794

Development of the Attitudes Toward Osteopathic Principles and Practices Scale (ATOPPS): Preliminary Results of a Pilot Project
Russo, D. P., Stoll, S. T., Shores, J.
The Journal of the American Osteopathic Association, 2001/09
2795

Developing and evaluating complementary therapy services: part 2. Examining the effects of treatment on health status
Richardson, J.
The Journal of Alternative and Complementary Medicine, 2001/08
2796

The Effects of OMT on Vital Signs During Headache
Parikh, A. S.
The Journal of the American Osteopathic Association, 2001/08
2797

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
2798

A new year--a new era
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text
2799

Who is there to listen?
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text
2800

Signifying what?
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text
2801

Vox populi
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text
2802

Sixty-five pieces of silver
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text
2803

“The judgment is reversed“
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text
2804

Sinusitis in children: the importance of diagnosis and treatment
Shrum, K. M., Grogg, S. E., Barton, P., Shaw, H. H., Dyer, R. R.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2805

More on spirituality
Chin, W. L.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2806

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2807

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2808

President Bush's 2002 budget proposal would hamper geriatric education
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2809

Allergy test results of a rural and small-city population compared with those of an urban population
Taksey, J., Craig, T. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
2810

More on spirituality
Horton, J. G.
The Journal of the American Osteopathic Association, 2001/05
2811

Spirituality and medical practice: Using the HOPE questions as a practical tool for spiritual assessment
Anandarajah, G., Hight, E.
Journal of Osteopathic Medicine, 2001/04
2812

The amelioration of atlanto-axial rotation asymmetry using high velocity low amplitude manipulation: Is the direction of thrust important?
Clements, B., Gibbons, P., McLaughlin, P.
Journal of Osteopathic Medicine, 2001/04
2813

Inter-examiner reliability of the Johnson and Friedman percussion scan of the thoracic spine
Ghoukassian, M., Nicholls, B., McLaughlin, B.
Journal of Osteopathic Medicine, 2001/04
2814

Spinal manipulation: Indications, risks and benefits
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/04
2815

Extensibility and stiffness of the hamstrings in patients with nonspecific low back pain
Halbertsma, J. P. K., Göeken, L. N. H., Hof, A. L., Groothoff, J. W., Eisma, W. H.
Journal of Osteopathic Medicine, 2001/04
2816

Effects of acupuncture, cervical manipulation and NSAID therapy on dizziness and impaired head repositioning of suspected cervical origin: a pilot study
Heikkilä, H., Johansson, M., Wenngren, B. I.
Journal of Osteopathic Medicine, 2001/04
2817

Centralization phenomenon as a prognostic factor for chronic low back pain and disability
Werneke, M., Hart, D. L.
Journal of Osteopathic Medicine, 2001/04
2818

Intraexaminer and interexaminer reliability for palpation of the cranial rhythmic impulse at the head and sacrum
Moran, R. W., Gibbons, P.
Journal of Manipulative and Physiological Therapeutics, 2001/03
2819

International growth of osteopathy
Noone, S. J.
The AAO Journal, 2001/03
Free full text
2820

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text
2821

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text
2822

Going global with osteopathic medicine
Smith, D. A.
The Journal of the American Osteopathic Association, 2001/03
Free full text
2823

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text
2824

On becoming a doctor
Kelly, M.
The Journal of the American Osteopathic Association, 2001/02
Free full text
2825

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text
2826

Testing osteopathic medical school graduates for licensure: is COMLEX-USA the most appropriate examination?
Graneto, J.
The Journal of the American Osteopathic Association, 2001/01
Free full text
2827

Minor depression in primary care
Banazak, D. A.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2828

Endoscopic retrograde cholangiopancreatography: what role does it have in primary care?
Biery, D. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2829

Fair hearing/peer review: truth or oxymoron?
Chalifoux, R. F.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2830

Sleep-related gastroesophageal reflux
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2831

Spirituality in Osteopathic Medicine
Lee, R. P.
The AAO Journal, 2000/12
Free full text
2832

Time for Medicare reform is now
Linz, A. J.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2833

Benefits of osteopathic manipulative treatment for hospitalized elderly patients with pneumonia
Noll, D. R., Shores, J. H., Gamber, R. G., Herron, K. M., Swift, J.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2834

The future in retrospect. 1935
Swope, C. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2835

Tendencies in a social, political, and governmental way which may influence doctors. 1937
Thomas, E. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2836

Spirituality in medicine
Travaline, J. M., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2000/12
Free full text
2837

Long-term therapy of coronary artery disease: a vascular biology perspective
Mathé, A. J., Clearfield, M. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2838

A fresh look at osteopathic medical education in 2000
Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2000/11
2839

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2840

Thrombolytic, antithrombin, and antiplatelet treatment of acute coronary syndromes
Puma, J. A., Sketch, M. H.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2841

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text
2842

Galbreath technique: a manipulative treatment for otitis media revisited
Pratt-Harrington, D.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2843

Osteopathic Treatment of Secretory Otitis Media (SOM)(Glue Ear)
Zingerle, M.L.
Unpublished MSc thesis, 2000/10
Free full text
2844

Osteoporosis
Cymet, T. C., Wood, B., Orbach, N.
The Journal of the American Osteopathic Association, 2000/10
2845

Managing common problems in perimenopausal women
Forstein, D. A.
The Journal of the American Osteopathic Association, 2000/10
2846

Glycation as the glucose link to diabetic complications
Gugliucci, A.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2847

Diagnosis and medical management of patients with intermittent claudication
LaPerna, L.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2848

Schließung und Mobilität der Synchondrosis sphenobasilaris
(Closure and mobility of the spheno-occipital synchondrosis)
Schalkhaußer, A.
Unpublished D.O. thesis, 2000/10
2849

Spirituality in history taking
Spaeth, D. G.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2850

Individualizing treatment plan and combining approaches key to pain management and holistic care: a student's perspective
Lawlor, T. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text
2851

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2852

Headache as a manifestation of otolaryngologic disease
Cosenza, M. J.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2853

An Ancient Persian High-Velocity, Low-Amplitude Thrusting Technique for Somatic Dysfunctions of the Thoracic Spine
Namazian, M., Clark, R. C., Binkerd, J.
The AAO Journal, 2000/09
Free full text
2854

Osteopathic research imperative-III. 1936
McCaughan, R. C., Hulburt, R. G.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2855

Psychologic aspects of chronic headache
Mueller, L.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2856

Effects of a structured curriculum in osteopathic manipulative treatment (OMT) on osteopathic structural examinations and use of OMT for hospitalized patients
Shubrook, J. H., Jr., Dooley
The Journal of the American Osteopathic Association, 2000/09
Free full text
2857

Clinical research and the office-based physician
Smutny, C. J.
The Journal of the American Osteopathic Association, 2000/09
Free full text
2858

Patients' satisfaction with osteopathic and GP management of low back pain in the same surgery
Pincus, T., Vogel, S., Savage, R., Newman, S.
Complementary Therapies in Medicine, 2000/09
2859

Workup and indications for polysomnography in patients with sleep-related complaints
Knox, K. S., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2860

Effects of Osteopathic Manipulative Treatment on Knee Osteoarthritis
Pham, C. N., Knebl, J.
The Journal of the American Osteopathic Association, 2000/08
2861

Osteopathic Manipulation in the Management of Parkinson's Disease
Wells, M. R., McCarty, C. L., Smutny, C. J., Scandalis, T. A., Dittrich, F., Fazzini, E. A.
The Journal of the American Osteopathic Association, 2000/08
2862

Opinions Toward The Use of OMT by Oklahoma D.O.s Responding to Surveys in 1984 and 1999
Yates, H., Johnson, J. C.
The Journal of the American Osteopathic Association, 2000/08
2863

Profession's research has come a long way, Dr Still!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2000/08
Free full text
2864

Efficacy of a steroid nasal spray compared with an antihistamine nasal spray in the treatment of perennial allergic rhinitis
Berlin, J. M., Golden, S. J., Teets, S., Lehman, E. B., Lucas, T., Craig, T. J.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2865

Latex allergy: a primary care primer
Mahmoudi, M., Hunt, L. W.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2866

Inhaled corticosteroid-induced bone loss and preventive strategies
Singh, R. F., Muskelly, C. C.
The Journal of the American Osteopathic Association, 2000/07
Free full text
2867

Cardiovascular disease and obstructive sleep apnea: implications for physicians
Foresman, B. H., Gwirtz, P. A., McMahon, J. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2868

Consortium publishes guidelines to lessen “headache“ of treating migraine
Freitag, F. G.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2869

Study underscores need to consider multiple factors in debate on physician-assisted suicide
Goldstein, F. J.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2870

Time to take bolder initiative with regard to public accountability
Harper, D. L.
The Journal of the American Osteopathic Association, 2000/06
Free full text
2871

Opinions and reactions of physicians in New Jersey regarding the Oregon Death with Dignity Act
Kersh, S., 3rd, Cavalieri, T. A., Ciesielski, J., Forman
The Journal of the American Osteopathic Association, 2000/06
Free full text
2872

Progressive inhibition of neuromuscular structures (PINS) technique
Dowling, D. J.
The Journal of the American Osteopathic Association, 2000/05
Free full text
2873

The treatment of influenza. 1918
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/05
Free full text
2874

Opportunities for the osteopathic medical profession to pursue worldwide acclaim and recognition
Smith, D. A.
The Journal of the American Osteopathic Association, 2000/05
Free full text
2875

His eighty-five years. 1913
Chiles, H.L.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2876

A home for research. 1913
Chiles, H. L.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2877

Are there any more Louisa Burnses out there?
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2878

Use of magnetic resonance imaging to diagnose common wrist disorders
DiMarcangelo, M. T., Smith, P. A.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2879

Early research: the A.T. Still Research Institute and Louisa Burns
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/04
Free full text
2880

Lift Treatment in Naval Special Warfare (NSW) Personnel: A Retrospective Study
Lipton, J. A., Brooks, J. S., Hickey, M. J., Drew, B. G., Eggleston, M. T., Gemmer, C. H.
The AAO Journal, 2000/03
Free full text
2881

AOA's voice supporting fair treatment of physicians in quality review process
Loniewski, E. A.
The Journal of the American Osteopathic Association, 2000/03
Free full text
2882

Interstitial cystitis: a retrospective analysis of treatment with pentosan polysulfate and follow-up patient survey
Waters, M. G., Suleskey, J. F., Finkelstein, L. J., Van Overbeke, M. E., Zizza, V. J., Stommel, M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
2883

Research on OPP/OMT is Critical to the Profession's Future
Noone, S. J.
The AAO Journal, 2000/03
Free full text
2884

Letters to the Editor
Orlando, C., Field, L.
The New England Journal of Medicine, 2000/03
2885

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02
2886

Inter-examiner and intra-examiner agreement for assessing sacroiliac anatomical landmarks using palpation and observation: pilot study
O'Haire, C., Gibbons, P.
Manual Therapy, 2000/02
2887

Beyond MEDLINE
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2000/02
Free full text
2888

Passing of the “Old Doctor“. 1918
Hildreth, A. G., Macon, D. O.
The Journal of the American Osteopathic Association, 2000/02
Free full text
2889

Reiter's syndrome and reactive arthritis
Parker, C. T., Thomas, D.
The Journal of the American Osteopathic Association, 2000/02
2890

Death of Dr. Still
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/02
Free full text
2891

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
2892

Effective strategies for the prevention of osteoporosis across the life span
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2000/01
2893

Role of antileukotriene agents in asthma therapy
Gawchik, S. M., Saccar, C. L.
The Journal of the American Osteopathic Association, 2000/01
Free full text
2894

Evaluation of osteoporosis
Nichols, K. J.
The Journal of the American Osteopathic Association, 2000/01
2895

Troponin I sensitivity and specificity for the diagnosis of acute myocardial infarction
Ross, G., Bever, F. N., Uddin, Z., Hockman, E. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text
2896

In defense of Dr Kevorkian
Suls, M. E.
The Journal of the American Osteopathic Association, 2000/01
Free full text
2897

Muscle energy concepts - a need for change.
Fryer, G.
Journal of Osteopathic Medicine, 2000
Free full text
2898

A systematic review of craniosacral therapy: Biological plausibility, assessment reliability and clinical effectiveness
Green, C., Martin, C. W., Bassett, K., Kazanjian, A.
Complementary Therapies in Medicine, 1999/12/01/
2899

Pilot study relating pulmonary function to leg length inequality
Crosby, C. J.
The AAO Journal, 1999/12
Free full text
2900

Comparison of osteopathic and allopathic medical schools' support for primary care
Peters, A. S., Clark-Chiarelli, N., Block, S. D.
Journal of General Internal Medicine, 1999/12
2901

What's in a name? For DOs, plenty
Guglielmo, W. J.
Medical Economics, 1999/12
2902

Mechanism of action of high-velocity, low amplitude thrust technique
Mesina, J., Balmer, J., Esper, S., Esper, E., Evans, R., Hampton, D.
The AAO Journal, 1999/12
Free full text
2903

Evaluierung und kritische Bewertung von in der europaischen Literatur veroffentlichten, osteopathischen Studien im klinischen Bereich und im Bereich der Grundlagenforschung.
(Evaluation and critical review published in the European literature on osteopathic studies in the clinical field and in the area of fundamental research)
Schwerla, F., Hass-Degg, K., Schwerla, B.
Forschende Komplementärmedizin, 1999/12
2904

Obesity article ignores surgery as possible option
Sing, R. F., Backus, C. L., Heniford, B. T.
Journal of Osteopathic Medicine, 1999/11
Free full text
2905

The paradox of osteopathy
Howell, J. D.
The New England Journal of Medicine, 1999/11
2906

New England Journal of Medicine article may be misleading about OMT
Coughlin, P., Kriebel, R., Fogel, R.
Journal of Osteopathic Medicine, 1999/11
Free full text
2907

Interrater Zuverlässigkeit des Beinlängentests und des Downing Test
(Inter rater reliability of the Downing test regarding leg length discrepancy)
Hösele, K.
Unpublished D.O. thesis, 1999/10
2908

Osteopathic unity must continue
Ross, K. E.
Journal of Osteopathic Medicine, 1999/10
Free full text
2909

Die Entspannung der intracranialen Membranen bei Kindern mit hyperaktivem Verhaltenssyndrom
(Intracranial membrane tension release of children with hyperactive disorder)
Röh, N., Rütz, M.
Unpublished D.O. thesis, 1999/10
2910

(Inter rater reliability of the Downing test regarding leg length discrepancy)
Interrater Zuverlässigkeit des Beinlängentests und des Downing Test
Hösele, K.
Unpublished D.O. thesis, 1999/10
2911

(Intracranial membrane tension release of children with hyperactive disorder)
Die Entspannung der intracranialen Membranen bei Kindern mit hyperaktivem Verhaltenssyndrom
Röh, N., Rütz, M.
Unpublished D.O. thesis, 1999/10
2912

DOs need more training in diagnosing and treating addiction
Goldstein, F. J.
Journal of Osteopathic Medicine, 1999/09
Free full text
2913

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text
2914

Meniere's syndromes resulting from multiple traumatic brain injury: Two case studies
Lockhart, W. C.
The AAO Journal, 1999/09
Free full text
2915

Osteopathic medical education in the 21st century--translating educational challenges into professional opportunities
Kasovac, M.
Journal of Osteopathic Medicine, 1999/08
Free full text
2916

As uniquely trained holistic caregivers, DOs have duty to overweight patients
Perkins, R. C.
Journal of Osteopathic Medicine, 1999/07
Free full text
2917

Osteopathic family physicians' attitudes, knowledge, and self-reported practices regarding obesity
Harris, J. E., Hamaday, V., Mochan, E.
Journal of Osteopathic Medicine, 1999/07
Free full text
2918

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text
2919

DO's approach to patient is 'wholistic'--not holistic
Gotfried, R.
Journal of Osteopathic Medicine, 1999/05
Free full text
2920

Beyond the 'box'
Foresman, B. H.
Journal of Osteopathic Medicine, 1999/05
Free full text
2921

Support programs for minority students at Ohio University College of Osteopathic Medicine
Thompson, H. C., Weiser, M. A.
Academic Medicine, 1999/04
2922

Meeting the challenges of the 'triple threat' makes for a complete osteopathic physician
Patterson, M. M.
Journal of Osteopathic Medicine, 1999/03
Free full text
2923

Chiropractic and osteopathic education at Royal Melbourne Institute of Technology. A student perspective
French, S. D., Marshall, S. J., Webb, M., Tucker, C.
Australasian Chiropractic & Osteopathy, 1999/03
Free full text
2924

The Use of OMT in Stroke Rehabilitation
Maxwell, S.
The AAO Journal, 1999/03
Free full text
2925

The management of low back pain: Short leg syndrome/postural balance
Nelson, K. E.
The AAO Journal, 1999/03
Free full text
2926

A model for teaching and assessing high velocity low amplitude thrust techniques
Wells, K.
The AAO Journal, 1999/03
Free full text
2927

Standard osteopathic manipulative treatment acutely improves gait performance in patients with Parkinson's disease
Wells, M. R., Giantinoto, S., D'Agate, D., Areman, R. D., Fazzini, E. A., Dowling, D., Bosak, A.
Journal of Osteopathic Medicine, 1999/02
Free full text
2928

Opinions of MDs, RNs, allied health practitioners toward osteopathic medicine and alternative therapies: results from a Vermont survey
McPartland, J. M., Pruit, P. L.
Journal of Osteopathic Medicine, 1999/02
Free full text
2929

Revisiting the role of osteopathic manipulation in primary care
Hopp, R. J.
Journal of Osteopathic Medicine, 1999/02
Free full text
2930

What we have to be is what we are
Chila, A. G.
Journal of Osteopathic Medicine, 1999/02
Free full text
2931

The evolution of professional identity: the case of osteopathic medicine
Miller, K.
Social Science & Medicine, 1998/12
2932

The meaning of natural medicine: an interpretive study
Di Stefano, V.
Unpublished MSc thesis, 1998/12
Free full text
2933

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text
2934

Osteopathic medical education in 1998 prepares for the future
Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text
2935

Comparison of personality styles between students enrolled in osteopathic medical, pharmacy, physical therapy, physician assistant, and occupational therapy programs
Hardigan, P. C., Cohen, S. R.
Journal of Osteopathic Medicine, 1998/11
Free full text
2936

International recognition of osteopathic medicine
Glassman, J.
Journal of Osteopathic Medicine, 1998/11
Free full text
2937

Simultaneous palpation of the craniosacral rate at the head and feet: intrarater and interrater reliability and rate comparisons
Rogers, J. S., Witt, P. L., Gross, M. T., Hacke, J. D., Genova, P. A.
Physical Therapy, 1998/11
2938

Evaluierung und kritische Bewertung von Studien der Osteopathie im klinischen Bereich und im Bereich der Grundlagenforschung in der europäischen Literatur
(Evaluation and Critical Review of Clinical and Fundamental Research Studies on Osteopathy Published in the European Literature)
Schwerla, B., Hass-Degg, F., Schwerla, F.
Unpublished D.O. thesis, 1998/10
2939

Sinusitus Supplement missing osteopathic component
Dudley, G.
Journal of Osteopathic Medicine, 1998/10
2940

Scalene entrapment syndrome
Royder, J. O.
The AAO Journal, 1998/09
Free full text
2941

Study of attitudes and beliefs about obesity on second and third year osteopathic medical students
Bradley, C. A.
Unpublished MSc thesis, 1998/08
Free full text
2942

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06
2943

A study of referral patterns among Queensland general medical practitioners to chiropractors, osteopaths, physiotherapists and others
Simpson, J. K.
Journal of Manipulative and Physiological Therapeutics, 1998/05
2944

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05
2945

The sword and the scalpel--the osteopathic 'war' to enter the Military Medical Corps: 1916-1966
Gevitz, N.
Journal of Osteopathic Medicine, 1998/05
2946

Are D.O.s losing their unique identity?
Guglielmo, W. J.
Medical Economics, 1998/04
2947

Coming full circle: osteopathic manipulative treatment and immunity
Allen, T. W.
Journal of Osteopathic Medicine, 1998/04
2948

Partners for two decades: AOA and the National High Blood Pressure Education Program
Nickey, W. A., Lenfant, C.
Journal of Osteopathic Medicine, 1998/03
2949

Effect of lymphatic and splenic pump techniques on the antibody response to hepatitis B vaccine: a pilot study
Jackson, K. M., Steele, T. F., Dugan, E. P., Kukulka, G., Blue, W., Roberts, A.
Journal of Osteopathic Medicine, 1998/03
2950

Craniosacral rhythm: reliability and relationships with cardiac and respiratory rates
Hanten, W. P., Dawson, D. D., Iwata, M., Seiden, M., Whitten, F. G., Zink, T.
Journal of Orthopaedic & Sports Physical Therapy, 1998/03
Free full text
2951

Sinusitis and OMT
Sept, K.
The AAO Journal, 1998/03
Free full text
2952

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02
2953

Join the new national healthcare initiative against COPD
Seebass, J. S., Petty, T. L.
Journal of Osteopathic Medicine, 1998/01
2954

Cycle-to-cycle variability attributed to the primary respiratory mechanism
Lockwood, M. D., Degenhardt, B. F.
Journal of Osteopathic Medicine, 1998/01
2955

Clinical implications of a cervical myodural bridge
Hallgren, R. C., Hack, G. D., Lipton, J. A.
The AAO Journal, 1997/12
Free full text
2956

Comparing psychotic and affective disorders by musculoskeletal structural examination
Iwata, J. L., Rodos, J. J., Glonek, T., Habenicht, A. L.
Journal of Osteopathic Medicine, 1997/12
Free full text
2957

Leading the pace of change: crisis or opportunity?
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/12
Free full text
2958

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text
2959

Anatomy of an OPTI dissected: structure, function, and the impact of budget reconciliation legislation
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/11
Free full text
2960

A snapshot of osteopathic medical education in 1997
Retz, K. C.
Journal of Osteopathic Medicine, 1997/11
Free full text
2961

Anatomy of an OPTI: Part I. Form, function, and relationships
Meyer, C. T., Mann, M. P., Riley, C., Portanova, R.
Journal of Osteopathic Medicine, 1997/10
Free full text
2962

Using heart variability to measure the effects of manual medicine on autonomic activity
Zullow, M.
Unpublished MSc thesis, 1997/10
2963

Osteopathic manipulative treatment: Practice use and and opinions of the Texas College of Osteopathic Medicine alumni
Gamber, R. G., Kennedy, D. A., Erickson, R. C., Moss, J. A., McKay Hart, C., Zengerle, C., Stone, R. C., Gish, E. E.
The AAO Journal, 1997/09
Free full text
2964

The Legacy of Robert C. Fulford, DO
Koss, R. W.
The AAO Journal, 1997/09
Free full text
2965

Case history: Low back pain with a radiating 'electric shock'
McCarty, C. L.
The AAO Journal, 1997/09
Free full text
2966

A challenge to the profession: initiate evidence-based osteopathic medicine now
Goldstein, M.
Journal of Osteopathic Medicine, 1997/08
Free full text
2967

Informing public, students will make profession 'visible'
Bahrami, P.
Journal of Osteopathic Medicine, 1997/06
Free full text
2968

Efficacy of osteopathic manipulative treatment in improving clinical outcomes in patients with orthopedic diagnoses admitted to a hospital-based rehabilitation unit
Brittain, P. D.
Unpublished MSc thesis, 1997/06
2969

Will failure to use OMT be grounds for malpractice?
Allen, T. W.
Journal of Osteopathic Medicine, 1997/05
Free full text
2970

Repositioning maneuver for benign paroxysmal positional vertigo (BPPV)
Brooks, J. G., Abidin, M. R.
Journal of Osteopathic Medicine, 1997/05
Free full text
2971

Establishment of behavioral parameters for the evaluation of osteopathic treatment principles in a rat model of arthritis
Hallas, B., Lehman, S., Bosak, A., Tierney, S., Galler, R., Jacovina, P., Scandalis, T. A., Wells, M.
Journal of Osteopathic Medicine, 1997/04
Free full text
2972

Osteopathic Medical Profession: Who are we & Where are we going? A student perspective
Nemon, B. M.
The AAO Journal, 1997/03
Free full text
2973

'Visible and recognized': osteopathic invisibility syndrome and the two percent solution
Gevitz, N.
Journal of Osteopathic Medicine, 1997/03
Free full text
2974

Can DOs still 'circle the wagons'? Reflections on the use of osteopathic manipulative treatment
Fry, L. J.
Journal of Osteopathic Medicine, 1997/02
Free full text
2975

Osteopathic manipulative treatment: student attitudes before and after intensive clinical exposure
Magnus, W. W., Gamber, R. G.
Journal of Osteopathic Medicine, 1997/02
Free full text
2976

The utilization of craniosacral therapy among healthcare practitioners and its awareness among occupational therapists
Avallone, S., Belli, D.
Unpublished MSc thesis, 1997/01
2977

A challenge to the concept of craniosacral interaction
Norton, J. M.
The AAO Journal, 1996/12
Free full text
2978

AOA continuing medical education
MacPherson, S. B., Rodgers, D. J.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2979

Osteopathic medical education at the bridge to the 21st century
Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2980

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2981

Certification of osteopathic physicians
Glatz, L., Dolan, S.
The Journal of the American Osteopathic Association, 1996/11
Free full text
2982

Why is it so difficult?
Patterson, M. M.
The Journal of the American Osteopathic Association, 1996/09
Free full text
2983

Factitious disorders and the 'professional patient'
Lande, R. G.
The Journal of the American Osteopathic Association, 1996/08
Free full text
2984

Osteopathic manipulative treatment applications for the emergency department patient
Paul, F. A., Buser, B. R.
The Journal of the American Osteopathic Association, 1996/07
Free full text
2985

AAO Case Study: Recurrent Otitis Media
Gintis, B. R.
The AAO Journal, 1996/06
Free full text
2986

A functional approach to heel lift therapy
Johnson, K. H.
The AAO Journal, 1996/03
Free full text
2987

Late-life depression in primary care. How well are we doing?
Banazak, D. A.
Journal of General Internal Medicine, 1996/03
2988

When it comes to OMT, do we practice what we preach?
Kasovac, M.
The Journal of the American Osteopathic Association, 1996/02
Free full text
2989

Marketing key to increased women applicants to COMs
Payson, S. M.
The Journal of the American Osteopathic Association, 1996/01
Free full text
2990

Osteopathic medicine: an inherently natural approach to cholesterol reduction
Rogers, F. J.
The Journal of the American Osteopathic Association, 1996/01
Free full text
2991

Synergism strengthens osteopathic medical education programs
Allen, T. W.
Journal of Osteopathic Medicine, 1995/10
Free full text
2992

The Nature of Fascia and the Role of Lower Extremity Fascia in Low Back Pain
Hessler, D. D.
The AAO Journal, 1995/09
Free full text
2993

Proposed matrix could yield bountiful 'harvest'
Stiles, E. G.
The Journal of the American Osteopathic Association, 1995/09
Free full text
2994

Phenobarbital-induced fibromyalgia as the cause of bilateral shoulder pain
Goldman, S. I., Krings, M. S.
The Journal of the American Osteopathic Association, 1995/08
Free full text
2995

Three-Dimensional Counterstrain Lifts (3-DCL) Theoretical Concept and Applications
Carlson, J. A., Carlson, J. M., Earl, D. T.
The AAO Journal, 1995/06
Free full text
2996

Making sense of federal GME reforms: the impact on osteopathic medicine
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/04
Free full text
2997

AAO Case Study: Chronic Upper Extremity Pain
DeFeo, G. A.
The AAO Journal, 1995/03
Free full text
2998

Interexaminer agreement on palpatory diagnosis and patient self-assessment of disability: a pilot study
Beal, M. C., Patriquin, D. A.
The Journal of the American Osteopathic Association, 1995/02
Free full text
2999

Standardization of the hospital record for osteopathic structural examination: recording of musculoskeletal findings and somatic dysfunction diagnosis
Seffinger, M. A., Friedman, H. D., Johnston, W. L.
The Journal of the American Osteopathic Association, 1995/02
Free full text
3000

A Hypothesis for the Facilitated Segment Based Upon Biological Principles Associated with Tumorigenesis
Yonuschot, G., Mokler, J., Winterson, B. J.
The AAO Journal, 1994/12
Free full text
3001

Healthcare reform and practice choices: a survey of osteopathic medical students
Shubrook, J. H., Jr., Solomon, J. A., Ross-Lee
The Journal of the American Osteopathic Association, 1994/11
Free full text
3002

Osteopathic medical education adapts to a changing environment
Ward, W. D.
The Journal of the American Osteopathic Association, 1994/11
Free full text
3003

Membership of AOA Committees on Osteopathic Medical Education 1994-1995
The Journal of the American Osteopathic Association, 1994/11
Free full text
3004

AAO Case Study: Sinusitis
Sept, K.
The AAO Journal, 1994/09
Free full text
3005

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text
3006

A Tensegrity Model for Osteopathy in the Cranial Field
Cummings, C. H.
The AAO Journal, 1994/06
Free full text
3007

Performance-based assessment of moral reasoning and ethical judgment among medical students
Smith, S. R., Balint, J. A., Krause, K. C., Moore-West, M., Viles, P. H.
Academic Medicine, 1994/05
Free full text
3008

DOs encouraged to participate in pharmaceutical, clinical trials
Allen, T. W.
The Journal of the American Osteopathic Association, 1994/05
Free full text
3009

Healthcare policy reform comes under fire
Brooker, A. S.
The Journal of the American Osteopathic Association, 1994/05
Free full text
3010

Opportunities and Issues for Osteopathic Hospitals
The AAO Journal, 1994/03
Free full text
3011

Transfusion of blood contaminated by HIV raises consent issues. Jones v. Philadelphia College of Osteopathic Medicine
Hospital Law Newsletter, 1994/03
3012

Osteopathic Identity: Finding the Pony
Hruby, R. J.
The AAO Journal, 1993/12
Free full text
3013

Definitions of Osteopathy as a School of Medicine
McCole, G. M.
The AAO Journal, 1993/12
Free full text
3014

Focused goals of osteopathic medical education achieve results
Ward, W. D.
The Journal of the American Osteopathic Association, 1993/11
Free full text
3015

An MD's note to his osteopathic medical students
Friedlander, E. R.
The Journal of the American Osteopathic Association, 1993/10
Free full text
3016

Do medical students' knowledge and attitudes about health and exercise affect their physical fitness?
Liang, M. T., Dombrowski, H. T., Allen, T. W., Chang, C. O., Andriulli, J., Bastianelli, M., Davina, E., Norris, S. D.
The Journal of the American Osteopathic Association, 1993/10
Free full text
3017

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text
3018

Promoting the health and fitness of osteopathic medical students
Licciardone, J. C.
The Journal of the American Osteopathic Association, 1993/10
Free full text
3019

AAO Case History
Somner, L.
The AAO Journal, 1993/09
Free full text
3020

'Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/09
Free full text
3021

'Blueprint' for creating classroom facilities in teaching hospitals
Hayes, O. W.
The Journal of the American Osteopathic Association, 1993/06
Free full text
3022

The Osteopaths Bill
Maxwell, R. J.
British Medical Journal, 1993/06
Free full text
3023

Investigating the role of osteopathic manipulation in the treatment of asthma
Allen, T. W., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 1993/06
Free full text
3024

Research important to education--and society
Retz, K. C.
The Journal of the American Osteopathic Association, 1993/05
Free full text
3025

Support of collaborative practice
Kuehn, A. F.
The Missouri Nurse, 1993/04
3026

Integrating OMT Into The Hospital Setting
Jones, L. B.
The AAO Journal, 1993/03
Free full text
3027

Outcomes assessment: 'buzz words' in medical education whose time has come
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/03
Free full text
3028

Panic Attack – Another View
Wright, H. O. L.
The AAO Journal, 1993/03
Free full text
3029

Efficacy of high-velocity low-amplitude manipulative technique in subjects with low-back pain during menstrual cramping
Boesler, D., Warner, M., Alpers, A., Finnerty, E. P., Kilmore, M. A.
The Journal of the American Osteopathic Association, 1993/02
Free full text
3030

Progress in scientifically proving the benefits of OMT in treating symptoms of dysmenorrhea
Chapman, J. D.
The Journal of the American Osteopathic Association, 1993/02
Free full text
3031

Valutazione riabilitativa su 18 casi di lesione del legamento crociato anteriore trattati chirurgicamente secondo la tecnica di Kenneth-Jones
(Rehabilitative evaluation of 18 cases of anterior cruciate ligament lesions surgically treated by the Kenneth-Jones technique)
Masserano, G., Montanaro, M., Poggi, G., Rusca, L., Vignali, F.
Minerva Medica, 1992/12
3032

Primary & Secondary Respiration – Part I
Lee, R. P.
The AAO Journal, 1992/12
Free full text
3033

Short lever, specific contact articular chiropractic technique
Bergmann, T. F.
Journal of Manipulative and Physiological Therapeutics, 1992/12
3034

With a look at the past, osteopathic medical education heads into its second century
Ward, D.
The Journal of the American Osteopathic Association, 1992/11
Free full text
3035

Voices From the Future: what students, interns, and residents want from osteopathic graduate medical training
Kushner, D., Cooney, J.
The Journal of the American Osteopathic Association, 1992/10
Free full text
3036

Heed 'Voices From the Future' and reform GME training
Meyer, C. T.
The Journal of the American Osteopathic Association, 1992/10
Free full text
3037

Characterization of the Cranial Rhythmic Impulse in Healthy Human Adults
Norton, J. M., Sibley, G., Broder-Oldach, R.
The AAO Journal, 1992/09
Free full text
3038

Strategy for Addressing Third Party Payors on OMT
O'Connell, J. A.
The AAO Journal, 1992/09
Free full text
3039

Osteopathic medicine: 100 years in the making
Allen, T. W.
The Journal of the American Osteopathic Association, 1992/09
Free full text
3040

Paralymics offer athletes--and DOs--new challenges
Richter, K. J.
The Journal of the American Osteopathic Association, 1992/07
Free full text
3041

Will Your Recipe Even Be In The Cookbook?
Ammann-Hasbrouck, L.
The AAO Journal, 1992/06
Free full text
3042

Rheumatoid Arthritis: The Incurable Disease?
Wright, H. O. L.
The AAO Journal, 1992/06
Free full text
3043

Testing osteopathic medical concepts in a real-life setting
Patterson, M. M.
The Journal of the American Osteopathic Association, 1992/06
Free full text
3044

Revamped osteopathic hospital group flourishing
Burda, D.
Modern Healthcare, 1992/05
3045

'Loopholes' weaken hospital accreditation policy
Horspool, J. C.
The Journal of the American Osteopathic Association, 1992/04
Free full text
3046

The Patient Who Wouldn't Give Up
Wright, H. O. L.
The AAO Journal, 1992/03
Free full text
3047

The Osteopathic Crisis: A Call for the Reform of M.D.-D.O. Relations
Meyer, C. T.
Unpublished MSc thesis, 1992/03
3048

The physical fitness of first-year osteopathic medical students
Licciardone, J. C., Hagan, R. D.
The Journal of the American Osteopathic Association, 1992/03
Free full text
3049

New HIV series helps to define osteopathic physicians' role in AIDS epidemic
Calabrese, L. H.
The Journal of the American Osteopathic Association, 1992/01
Free full text
3050

Let's Return to the Basics
Heatherington, J. S.
The AAO Journal, 1991/12
Free full text
3051

A Disease Which No Longer Exists
Wright, H. O. L.
The AAO Journal, 1991/12
Free full text
3052

Alternative and complementary medicine for asthma
Lane, D. J., Lane, T. V.
Thorax, 1991/11
Free full text
3053

Superlatives and concerns in osteopathic medical education
Baker, H. H.
The Journal of the American Osteopathic Association, 1991/11
Free full text
3054

Traitements non prouvés en cancérologie
(Unproven treatments in cancerology)
Schraub, S., Helary, J. P.
Bulletin du cancer, 1991/10
3055

Examining the complexities of HIV testing for healthcare workers
Allen, T. W.
The Journal of the American Osteopathic Association, 1991/10
Free full text
3056

The osteopathic cranial concept: fact or fiction?
Ferré, J. C., Barbin, J. Y.
Surgical and Radiologic Anatomy, 1991/09
3057

Osteopathic vs. chiropractic education: a student perspective
McNamee, K. P., Magarian, K., Phillips, R. B., Greenman, P. E.
Journal of Manipulative and Physiological Therapeutics, 1991/09
3058

The Value of Some Clinical Tests of the Sacroiliac Joint
van Deursen, L. L. J. M., Patijn, J., Ockhuysen, A. L., Vortman, B. J.
The AAO Journal, 1991/09
Free full text
3059

Osteopathic interns' attitudes toward their education and training
Shlapentokh, V., O'Donnell, N., Grey, M. B.
The Journal of the American Osteopathic Association, 1991/08
Free full text
3060

Osteopathic medical educators should heed lesson from interns
Johnston, W. L.
The Journal of the American Osteopathic Association, 1991/08
Free full text
3061

Osteopathic Medicine: A Century Old Prophesy of Modern Health, Nutrition and Exercise Principles
Ramirez, M. A., Spillman, D. M., Lipnickey, S. C.
The AAO Journal, 1991/06
Free full text
3062

Osteopathic research: where have we been and where are we going?
Allen, T. W.
The Journal of the American Osteopathic Association, 1991/02
Free full text
3063

The sociopolitical development of British chiropractic
Baer, H. A.
Journal of Manipulative and Physiological Therapeutics, 1991/01
3064

Osteopathic medicine and primary care practice: plan or serendipity?
Melnick, A.
Academic Medicine, 1990/12
3065

A radiological technique for measurement of the height of the trapezial cavity: Applications in pre- and post-operative assessment in osteoarthritis of the base of the thumb
Goffin, D., Saffar, P.
Annales de Chirurgie de la Main et du Membre Supérieur, 1990/12
3066

Measuring our success in meeting 1990 hypertension health objectives
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/12
Free full text
3067

Practicing what we teach: integrating osteopathic principles into practice
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/10
Free full text
3068

Just what is osteopathic medicine's role in society?
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/09
Free full text
3069

Calling for theories that test the underlying osteopathic concepts
Patterson, M. M.
The Journal of the American Osteopathic Association, 1990/09
Free full text
3070

Time to reemphasize OMT as stress reliever
Northup, G. W.
The Journal of the American Osteopathic Association, 1990/08
Free full text
3071

Breastfeeding Opinions of Medical Students at the Oklahoma State University College of Osteopathic Medicine
Hoskins, J. A.
Unpublished MSc thesis, 1990/05
Free full text
3072

Quality assurance monitoring of osteopathic manipulative treatment
Koss, R. W.
The Journal of the American Osteopathic Association, 1990/05
Free full text
3073

The Century Club: a model for staff-supported medical education
Meyer, C. T.
The Journal of the American Osteopathic Association, 1990/05
Free full text
3074

Another hurrah for a 'smoke-free' environment
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/04
Free full text
3075

Correcting the misperceptions surrounding osteopathic medicine
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/02
Free full text
3076

War, politics, and osteopathic medicine
Goldstein, M.
The Journal of the American Osteopathic Association, 1990/02
Free full text
3077

Elektromyographische und Hautwiderstandsreaktionen auf die osteopathische manipulative Behandlung des Kreuzschmerzes
(Electromyographic and skin resistance responses to osteopathic manipulative treatment for low-back pain)
Ellestad, S. M., Nagle, R. V., Boesler, D. R., Kilmore, M. A.
Manuelle Medizin, 1990/01
3078

An integrated osteopathic treatment approach in acute otitis media
Pintal, W. J., Kurtz, M. E.
The Journal of the American Osteopathic Association, 1989/09
Free full text
3079

A comparative study of the quality of nursing care in an osteopathic versus an allopathic health care facility
Bond, G. E.
Unpublished MSc thesis, 1980/06
Free full text
3080

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12
3081

A study into the efficacy of osteopathic treatment of Irritable bowel syndrom
Brice, C., Mountford, R.
British Osteopathic Journal
 
 
 






  • Impressum • Legal notice • Datenschutz •


ostlib.de/advanced



Supported by

OSTLIB recommends