Advanced search



 
 79.6% of the records
 
 20.4 % of the records
 
 57.9 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial swellingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxishair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodialysishemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrialstriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

3124 results (please see below)  Sort:    
1

Reliability of spinal palpation for diagnosis of back and neck pain: a systematic review of the literature
Seffinger, M. A., Najm, W. I., Mishra, S. I., Adams, A., Dickerson, V. M., Murphy, L. S., Reinsch, S.
Spine (Phila Pa 1976), Oct 1


3

From guidelines to practice: collective learning through clinical audit of the IFOMPT cervical framework
Bailey, D., Fawkes, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2026/03

4

Barriers and facilitators to the use of Patient Reported Outcome Measures by Australian osteopaths
Eaves, S., Kalatzis, G.
International Journal of Osteopathic Medicine, 2026/03

5

Immediate Effects of Osteopathic Manipulative Therapy on Thoracoabdominal Mobility, Respiratory Muscle Strength and Pulmonary Function in Healthy Men: Preliminary Crossover Trial
Zago, J., Rondinel, T., Urueña, B., Amatuzzi, F., Queiroz, R., Nascimento, L., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2026/03

6

Journal Club 2026 – 1
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2026/03


8

Editorial
Editorial
Newiger, C.
Osteopathische Medizin, 2026/03

9

Incorporation of virtual reality into medical physiology
Benmerzouga, I., Oviawe, E.
Advances in Physiology Education, 2026/03
Free full text


11

Effects of osteopathic manipulative treatment on cardiovascular function: a systematic review and meta-analysis
Johnston, K., Chow, R., Rubinstein, M., Burtner, M., Hollander, S., Humm, A., Chen, L., DeArmond, M., Koshy-Chenthittayil, S., Hightower, C.
International Journal of Osteopathic Medicine, 2026/02

12

Challenging hierarchies and fostering collaboration: a critical discourse analysis of interprofessional education in healthcare training
Zorda, E. M., Sargent, M. A., Gose, C. E., Becker, M. T., Garber, S. S., DePrimo, A., Batteson, T.
Journal of Osteopathic Medicine, 2026/02
Free full text


14

Race, ethnicity, and gender discrepancies between allopathic and osteopathic otolaryngology trainees from 2015 to 2023
Minutello, K. M., Nicks, S. L., Gillette, B. T., Hasan, S., Shermetaro, C. B.
Journal of Osteopathic Medicine, 2026/01
Free full text

15

Allopathic resident prevalence in orthopedic residency programs formerly accredited by the American Osteopathic Association during single accreditation
Murray, J. B., Balazs, G. C., Speicher, M. R., Olsen, A. A.
Journal of Osteopathic Medicine, 2026/01
Free full text

16

Osteopathic manipulative treatment for enhanced pitch performance in collegiate baseball players: a feasibility study on shoulder and hip interventions
Rosten, C., Brown, S., Nandedkar, T., Pearson, A., Worthington, E., Fastring, D.
Journal of Osteopathic Medicine, 2026/01
Free full text


18

A.T. Stills „Finding health …“ – Ad fontes!
Dippon, M.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01

19

Im Gespräch mit … Christian Schwartzkopf
(In dialog with Christian Schwartzkopf)
Mihajlovic, Z., Schwartzkopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01

20

Editorial
Wikus, P.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01

21

Psychosoziale Aspekte chronischer Schmerzen aus interdisziplinärer Perspektive
Zöller, E., Feld, K.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01


23

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/12
Free full text

24

Analysis of hepatitis B immunity in vaccinated medical students
Gentile, N., Aghera, C., Smith, H., Mazzoleni, S., Redden, D., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2025/12
Free full text

25

Associations in fetal outcomes from cesarean sections with maternal comorbidities: a cross-sectional study of the Pregnancy Risk Assessment Monitoring System
Enmeier, M., Stephenson, E., Prince, J., Markey, C., Phung, B., Hartwell, M.
Journal of Osteopathic Medicine, 2025/12
Free full text

26

Examiner reliability of a systematic osteopathic musculoskeletal examination model in patients with stroke: results from the SOMADC-AC study
Yee, A. H., Brooks, W. J., Palchik, G. A., Akers, B., Li, Y., Dossett, M. L.
Journal of Osteopathic Medicine, 2025/12



29

Analyzing Medical Student Knowledge Regarding Nutrition
Barros, M., Weir, S.B., Bennett, A.
Journal of Osteopathic Medicine, 2025/12

30


31

Physician and Resident Physician knowledge of childhood obesity management guidelines
Chaar, S., Chaaban, A., Bitar, R., Hill Guseman, E.
Journal of Osteopathic Medicine, 2025/12


33

Erratum to: Longitudinal outcomes among patients with fibromyalgia, chronic widespread pain, or localized chronic low back pain
Licciardone, J. C., Brownell, E., Nwaichi, U., Patel, A., Do, K.
Journal of Osteopathic Medicine, 2025/12
Free full text


35

Effects of Lymphatic Pump Treatment and Methotrexate in Arthritis Development and Behavior in Rats with Adjuvant-Induced Arthritis
Kafkis, C., Tamane, S., Manuel, M. J., Zanotti, B., Del Toro, R. M., Incrocci, R., Swanson-Mungerson, M., Volin, M. V.
Journal of Osteopathic Medicine, 2025/12



38



40

D.O. Podcast Increases Pre-Medical Student Knowledge and Attitudes Toward Osteopathic Medicine
Sullivan, V. E., D'Amelio, M. P., Storch, I. M., van Rooyen, D. R., Storch, N. C., Callaway, C. A., Pierce-Talsma, S. L., Hauler, J. J.
Journal of Osteopathic Medicine, 2025/12

41

Osteopathic Medical Education and Treatment: Changes in Perspective Through the Lens of Standardized Patients
Thompson, T. R., Craun, W. D., Strickland Creech, T., Parks, J. M., Nolin, J. R.
Journal of Osteopathic Medicine, 2025/12

42

Perceptions of Campus Climate and Inclusivity Among LGBTQIA+ Osteopathic Medical Students: A Cross-Sectional Study
Varin, P., Temucin, S., Reese, A., Florescu, N., Grace, C., Bettiker, R., Sonneville, K., Fiscus, V., Tanaka, L.A.
Journal of Osteopathic Medicine, 2025/12


44

Improving the Reproducibility of the Standing Forward Flexion Test After Specific Training: A Cross-Sectional Study
Colonna, S, D'Alessandro, A., Pozzati, F., Venturi, M., Andrenacci, V., Romeo, D.
Cureus, 2025/12
Free full text



47

The effect of exercise on fatigue in rheumatoid arthritis: a systematic review and meta-analysis of randomized controlled trials
Jiang, X., Yu, L., Yan, Y., Zhou, S., Zheng, Q.
International Journal of Osteopathic Medicine, 2025/12

48

Effectiveness of manual therapy vs conventional physical therapy with neuromuscular training in the management of knee osteoarthritis: A randomized clinical controlled trial
Pakkir Mohamed, S. H., Albalawi, H. F., Nambi, G., Shalabi, K. M., Albalawi, M. O.
International Journal of Osteopathic Medicine, 2025/12
Free full text

49

Gut-Brain Axis in Inflammatory Bowel Disease: Pathogenesis and Therapeutics
Perry, S., Pillarisetti, L., Gelfman, T., Agrawal, D. K.
Archives of Internal Medicine Research, 2025/12
Free full text



52

From the Editor: To Love, Life, and Osteopathy
Ching, L. M.
AAO Journal, 2025/12

53

Autonomic Rehabilitation: Cardiovagal and Autonomic Impacts of Post Isometric Muscle Energy at the Upper Cervical Spine
Miller, A., Curran, C., Fanous, S., Nakashima, T., Yates, H., Johns, J., Fotopoulos, T., Gustin, D., Wilson, J., McAllister, J., Moon, J., Thornburgh, K., Wenner, A., Garg, R., Gharbo, R.
AAO Journal, 2025/12

54

Assessing content validity of the Osteo-TAQ(Aus) using cognitive interviews: cross-jurisdictional evidence from UK osteopathic practice​​
Thomson, O. P., Golder, E., McLeod, G. A., Draper-Rodi, J., Vogel, S., Vaughan, B.
BMC Research Notes, 2025/12
Free full text




58

Emergency department wait times in concordance with blood alcohol content and subsequent alcohol use disorder
Hayes, S., Mach, K., Briggs, J., Hartwell, M.
Journal of Osteopathic Medicine, 2025/11
Free full text

59

Osteopathic manipulative treatment in the management of headaches associated with musculoskeletal dysfunction: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Ying-Fang Wang, M., Johnston, R., Will, M., Gibson, E., Spencer, D., Garcia, C., Snider, K. T.
Journal of Osteopathic Medicine, 2025/11
Free full text


61

Use of osteopathic manipulation techniques for management of acute otitis media in pediatric patients: a scoping review
Kim, C. H.S., McCray, L. R., Nguyen, S. A., Shermetaro, C., Robbins, W. K.
European Archives of Oto-Rhino-Laryngology, 2025/11
Free full text




65

Assessing eating disorder education in U.S. medical schools: a qualitative content analysis of lecture slides
Laboe, A. A., Pictor, L. E., Gavuji, M., Temucin, S., Kreynin, A., Sheil, E., Jourdan, B., Schaumberg, K., Davis, H., Harrop, E. N.
Eating and Weight Disorders, 2025/11
Free full text

66

Evaluation of Craniosacral Therapy Effects on Brain Wave Patterns in Children with Mild Autism Spectrum Disorder Using the QEEG Method
Kopańska, M., Szczygielski, J., Batrman, P., Banaś-Ząbczyk, A.
Acta Neuropsychologica, 2025/10
Free full text

67

Affirmative Action Repeal and Racial and Ethnic Diversity in US Medical School Admissions
Florescu, N., Lin, A., Temucin, S., Rae, L.
JAMA Network Open, 2025/10
Free full text

68

Necrobiosis lipoidica arising in a port wine stain treated with topical ruxolitinib
Edupuganti, N., Nguyen, J., Siddiqui, F., Dukharan, V., Nathoo, R.
Journal of Osteopathic Medicine, 2025/10
Free full text

69

European research Priorities for Osteopathic Care (PROCare): a sequential exploratory investigation and survey
Vaucher, P., Carnes, D., Hohenschurz-Schmidt, D., Thomson, O., Vogel, S., Arienti, C., Bright, P., Alvarez Bustins, G., Esteves, J., Koch Esteves, N., Fawkes, C., Rinne, S., Roura, S., Treffel, L., Wagner, A., Draper-Rodi, J.
BMJ Open, 2025/10
Free full text

70

Do patients with renal calculi exhibit viscerosomatic reflexes as evident on CT imaging?
Haughton, D. R., Gupta, A. K., Nasir, B. R., Kania, A. M.
Journal of Osteopathic Medicine, 2025/10
Free full text

71

Enhancing Embryology Education Through Virtual Reality: A Pilot Study
Quiñones-Rodríguez, J., Rice, R., Mayer, W., Marchelli, G., Bouchoukian, M., Davis, P.
Anatomical Record, 2025/10

72

Impact of touch interventions on brain activity in moderately preterm infants: study protocol for a pilot randomised controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., Tansini, L., Pisanu, D., Di Leo, D., Vergani, E., Righini, A., Arrigoni, F., Fanos, V., Rescigno, M., Veggiotti, P., Lista, G., Gazzolo, D.
BMJ Open, 2025/10
Free full text

73

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10

74

Osteopathic manipulative treatment for refractory chronic traumatic pain and mobility restrictions at a level 1 trauma center
Baltazar, G. A., Cao, M., Van Vleet, J., Hart, S., Jakubowski, A., Suree, N., Petrone, P., Islam, S., Machado, F., Rubano, J.
Journal of Osteopathic Medicine, 2025/10
Free full text

75

Visceral Osteopathy in Treating Refractory Irritable Bowel Syndrome: Results of a French National Multicentre Randomised Controlled Trial
Wuestenberghs, F., Sabate, J. M., Jouet, P., Mion, F., Vidon, M., Piche, T., Napoléon, M., Roman, S., Soliman, H., Benallaoua, M., Bouchoucha, M., Benamouzig, R.
United European Gastroenterology Journal, 2025/10

76

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10

77

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10

78

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/10
Free full text


80

Top 100 cited articles in osteopathic medical education: A bibliometric analysis
Bright, H. S. IV., Robinson, K., Fitterling, L., Kelley, S., Wang, M. Y.F., Lipke, L.
Medical Reference Services Quarterly, 2025/10

81

The Spinal Facilitation Hypothesis and Reflex Arcs in Modern Osteopathic Medicine
Bordoni, B., Simonelli, M., Morabito, B., Escher, A. R.
Cureus, 2025/09
Free full text


83

Interrater Reliability of a Manual Diagnostic Protocol for Pancreatic Functional Visceral Dysfunction
Faria, M., Machado, N., de Sousa, M. C., Pires, P. M., Pires, T.
Journal of Integrative and Complementary Medicine, 2025/09

84

A proven template for providing streamlined, scalable, cost-effective clinical research opportunities in osteopathic medical schools
Greek, J. N., Greek, A. P., Hopper, M., Arnce, R.
Journal of Osteopathic Medicine, 2025/09
Free full text

85

Ultrasound Strain Zero-Crossing for Assessing Adult Hypertonic Muscles: A Feasibility Study
Gao, J., Rubin, J. M.
Journal of Ultrasound in Medicine, 2025/09


87

Attitudes, Beliefs, and Values of Italian Osteopaths Toward the Management of Patients With Tension-Type Headache: A Categorical Content Analysis
Iacopini, A., Esteves, J. E., Consorti, G., Lunghi, C., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2025/09

88

Osteopathic intervention for inflammatory conditions of the lactating breast: a case series
Engel, R., Willy, K., Fuller, E.
International Journal of Osteopathic Medicine, 2025/09

89

Multidisciplinary perceptions of osteopathy in the Italian hospital context
Lopane, D., Mazzoleni, B., Saetta, A., Soekeland, F., Dacomi, A., Tartaglia, F. C., Coldani, C., Tomaiuolo, G., Cattani, D., Sguanci, M., Cangelosi, G., Palomares, S. M., Mancin, S.
Advances in Integrative Medicine, 2025/09



92

Equity reporting in systematic reviews and meta-analysis for geographic atrophy: a PROGRESS-Plus assessment
Emmert, R., McKenzie, T., Smith, D., Russell, H., Schultheis, G., Hartwell, M.
Journal of Osteopathic Medicine, 2025/09
Free full text


94

TIF1-gamma associated dermatomyositis with extensive cutaneous involvement
Geric, K. M., Khan, H. S., Dazé, R.
Journal of Osteopathic Medicine, 2025/09
Free full text

95

Use of a community care coordination team to reduce emergency department utilization and hospital readmissions for the highest utilizers
Shipman, S., Painter, K., Epperson, L. C., Smith, K.
Journal of Osteopathic Medicine, 2025/09
Free full text

96

Osteopaths' attitudes, skills and use of evidence-based practice in Portugal
Nunes, A., Santo, J. E., Moita, J.
International Journal of Osteopathic Medicine, 2025/09

97

Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/09


99

Liebe Leserinnen und Leser
(Dear readers)
Newiger, C.
Osteopathische Medizin, 2025/09


101

Editorial
(Editorial)
Scheuchl, F.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09





106

OMT as an Adjunct Therapy to Clubbed Feet: A Case Study
Tucker, A., Dorsa, I., Patel, J., Seemann, J., Hicks, K., Leggoe, S.
The AAO Journal, 2025/09










116

The effect of osteopathic manipulative treatment on length of stay and pain relief in pediatric appendectomy: a pilot non-randomized time-controlled clinical trial
Lo Piccolo, R., Cantagalli, M. M., Ferroni, T., Fracchiolla, F., Morabito, A.
Frontiers in Pediatrics, 2025/08
Free full text

117

Clinical Reasoning and Practices in the Osteopathic Management of Visceral Disorders: A Grounded Theory Study in the Italian Context
Camonico, T., Lippi, F., Rizzo, N., Barusso, A., Rossettini, G., Villafañe, J. H., Cerritelli, F., Papa, L., Esteves, J. E.
Healthcare, 2025/08
Free full text

118

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text

119

Le dessin ostéopathique des atteintes corporelles: une clinique émersive
Jacquot, E., Paintendre, A., Andrieu, B.
L'Evolution Psychiatrique, 2025/08


121

Comparative cross-sectional analysis of asthma outcomes and sinus surgery utilization in Appalachian and non-Appalachian counties of Ohio
Borgemenke, S., Osap, R., Bogunovich, K., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/08
Free full text

122

The impact of adverse childhood experiences on age of diabetes diagnosis and associations with race and ethnicity
Rice, A., Taylor, M., Hendrix-Dicken, A., Elenwo, C., Croff, J., Chalmers, L. J., Coffey, S., Hartwell, M.
Journal of Osteopathic Medicine, 2025/08
Free full text

123

Longitudinal outcomes among patients with fibromyalgia, chronic widespread pain, or localized chronic low back pain
Licciardone, J. C., Brownell, E., Nwaichi, U., Patel, A., Do, K.
Journal of Osteopathic Medicine, 2025/08
Free full text

124

Impact of osteopathic tests on heart rate and heart rate variability: an observational study on osteopathic students
Gillet, F., Gault, M., Dussault, V., Cheggour, S., Grinand, M., Martinez, P.
Journal of Osteopathic Medicine, 2025/08
Free full text

125

Private equity in healthcare: implications and policy recommendations
Jestin, M.
Journal of Osteopathic Medicine, 2025/07
Free full text

126

Pityriasis lichenoides chronica presenting in skin of color
Cook, B., Bindernagel, R., Dazé, R., Miller, R.
Journal of Osteopathic Medicine, 2025/07
Free full text

127

Patience in Practice: A Nonoperative Approach to Osteochondritis Dissecans
Rodas, A. W., Gupta, P., Pan, K., Rule, R., Goddard, M.
Cureus, 2025/07
Free full text

128

Changes in Electromagnetic Activity Following Osteopathic Manipulative Treatment: A Novel Assessment Using Induction Sensors
Savla, P., Brazdzionis, J., Marino, M., Siddiqi, I., Sweiss, R., King, C., Miulli, D. E.
Cureus, 2025/07
Free full text

129

Predicting First-Semester Performance of First-Year Medical Students in a Changing Landscape
Walker, M., George, A., Mohsin, S., Nichani, R., Garg, R., Chosie, K., Kennedy, C.
Cureus, 2025/07

130

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text

131

The effectiveness of training student physicians in culturally sensitive patient care using an interprofessional culturally competent curriculum
Aminpour, A., Gelvin, M., Smurzynski, A., Gardner, F., Gardere, J.
Journal of Osteopathic Medicine, 2025/07
Free full text

132

Development of a national osteopathic Practice-Based Research Network (PBRN): the NCOR Research Network
Draper-Rodi, J., Fawkes, C., Bailey, D.
Scientific Reports, 2025/07
Free full text

133

Editorial
listed, , No authors
DO - Deutsche Zeitschrift für Osteopathie, 2025/07

134

Lessons learned from the digital transformation of physiotherapy education: A phenomenological study
Eccott, L., Moulson, A., Atkinson, K., Livatino, S., Lewis, J., Cairns, M.
International Journal of Osteopathic Medicine, 2025/06
Free full text

135

An overview of systematic reviews on the efficacy and safety of osteopathic techniques
Zipp, C. R., Semlitsch, T., Tögel, G., Krenn, C., Loder, C., Jeitler, K., Siebenhofer, A.
Journal of Bodywork and Movement Therapies, 2025/06



138

Inter-rater and intra-rater reliability of belt-stabilized hand-held dynamometer using make test in lower extremity muscle strength assessment among healthy adults
Espino, R. V. S., Gonzalez-Suarez, C., Ingram, L. A., Gomez, I. N. B., Agarao, K. A. T., Flores, J. G., Bulseco, N.
International Journal of Osteopathic Medicine, 2025/06

139

Acute changes in functional connectivity associated with first osteopathic manual treatment in chronic low back pain spatially overlap with opioid receptor expression
Tomaiuolo, F., Cerritelli, F., Sestieri, C., Keys, J., Paolucci, T., Sensi, S. L., Ferretti, A., Delli Pizzi, S.
Brain Research Bulletin, 2025/06
Free full text

140

From the Editor: Continuing the Legacy
Barnes, P. L.
The AAO Journal, 2025/06

141

Combined Myofascial Technique for a Second Posterior Sacral Segment Dysfunction
Stellon, A. G., Rudberg-Post, L. J., Gustafson, H. C., Hartwell, L. E., Matz, O. C., Woolley, A. L.
The AAO Journal, 2025/06

142

Management of endometriosis: a call to multidisciplinary approach
Duncan, J.M., Delara, R., Ranieri, G., Wasson, M.
Journal of Osteopathic Medicine, 2025/06
Free full text



145

The utility of the implantable loop recorder in patients with Ehlers-Danlos syndrome and hypermobility spectrum disorder
Tale, E., Robinson, G., Edward, J., Kaushal, R., Riley, B., Cohen, T. J.
Journal of Osteopathic Medicine, 2025/06
Free full text

146

Non-Herlitz junctional epidermolysis bullosa in a Native American newborn
Ibrahim, A. A., Yrun-Duffy, M., Almario, R. D., Mullins, J. R., Cyrus, S. S.
Journal of Osteopathic Medicine, 2025/06
Free full text

147

The use of OMT in Myalgic Encephalomyelitis/Chronic Fatigue Syndrome
Brancale, D., Cooley, D.
The AAO Journal, 2025/06

148

From Fatigue to Function: A Case Report of The Use of OMT in Chronic Fatigue Syndrome
Finkelstein, A., Petrillo, G., Keys, J.
The AAO Journal, 2025/06

149

A Novel Calibration Methodology for Osteopathic Manipulative Medicine Research: Improving Study Validity by Standardizing Intra-researcher Techniques
Hahn, D., Krakowski, M., Kadriovski, S., Pierides, M., Velasquez, L., Volokitin, M.
The AAO Journal, 2025/06

150

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06

151

Impact of Osteopathic Manipulative Treatment in Delivering Comprehensive Care in Populations with Disabilities
Villarosa, M., Bae, P., Yeam, J., Hoang, V., White, G., Blumer, J.
The AAO Journal, 2025/06


153

The effect of osteopathic manipulative treatment on chronic rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kalkat, A., Hammes, C., Kohli, E., Callahan, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2025/06
Free full text



156

Osteopathic practitioner´s considerations on infertility treatment
Triay Salamanca, S.
Unpublished MSc thesis, 2025/06
Free full text





161

Integrative medicine
(Интегративная медицина)
Shabrov, A. V., Mokhov, D. E., Tregubova, E. S., Korotkov, K. G., Moiseev, V. I., Partsernyak, S. A.
Russian Osteopathic Journal, 2025/06



164

Changes in Pain, Spasticity, and Quality of Life After Use of Counterstrain Osteopathic Manipulative Treatment in Individuals with Spinal Cord Injuries
Din, S., Grimmett, M. P., Sandoval, A. P., Clancy, S. E., Payton, S. L., Jackson, J. M., Cornelio, V. C., Warren, E., Courtner, A., Williamson, E., Sharma, A., Dolbow, D. R.
Journal of Bodywork and Movement Therapies, 2025/06

165

Pilot study MOVENDOP protocol - impact on quality of life following postoperative osteopathic abdominal mobilizations in patients operated for endometriosis
Comptour, A., Dechambenoit, C., Kwiatkowski, F., Vidal, A., Duval, M., De Antonio, M., Jacobs, A., Bourdel, N.
PLoS One, 2025/05
Free full text


167

Breath of Relief: Osteopathic Manipulative Treatment of Chronic Postoperative Pain in a Bilateral Lung Transplant Patient
Duggal, V., Finkelstein, A., Radigan, R., Bhushan, P.
Cureus, 2025/05
Free full text



170

Effects of the Strong Hearts program at two years post program completion
Murphy, B. E., Card, P. D., Ramirez-Kelly, L., Wensley, B., Heidel, R. E.
Journal of Osteopathic Medicine, 2025/05
Free full text

171

Exploring manual therapy in the management of irritable bowel syndrome in adults: A scoping review
Płóciennik-Korycka, N., Pani, S. M., Bruc, B., Contu, P., Wrzesińska, M.
Complementary Therapies in Medicine, 2025/05
Free full text

172

Osteopathic, logopedic and psychological assessment to improve outcome in patients undergoing cardiac surgery: A randomized clinical trial (TITANIC trial)
Volpato, E., Stilo, L., Tavanelli, M., Bordoni, B., Oreni, L., Toccafondi, A., Moraschi, A., Morici, N.
European Journal of Preventive Cardiology, 2025/05

173

International medical graduate orthopaedic residents show higher research productivity than United States graduate peers before and during residency
MacLeod, J. S., Jacome, F., Mansour, H., Lee, M. S., Akwuole, F., Cho, S., Lee, J., Lema, O., Chopra, A., Bakaes, Y., Painter, S., Baker, H., Mejia, A.
International Orthopaedics, 2025/05

174

Efforts in Undergraduate Medical Education to Improve Socioeconomic Status Diversity
Velasquez, D. E., Shrestha, A., Matias, W. R.
Academic Medicine, 2025/05
Free full text

175

Patient-Practitioner-Environment Synchronization: Four-Step Process for Integrating Interprofessional and Distinctive Competencies in Osteopathic Practice-A Scoping Review with Integrative Hypothesis
Lunghi, C., Baroni, F., D'Alessandro, G., Consorti, G., Tramontano, M., Stubbe, L., Conte, J., Liem, T., Zegarra-Parodi, R.
Healthcare, 2025/04
Free full text

176

A cross-sectional study of newly established medical schools in the United States: student body diversity remains an unmet challenge
Oyoun Alsoud, L., West, K., Sorrell, S., Andolsek, K. M., Al Hageh, C., Ibrahim, H.
Medical Education Online, 2025/04
Free full text

177

Modeling the importance of physician training in practice location for Ohio otolaryngologists
Borgemenke, S., Newsom, D., Scheatzle, P., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/04
Free full text

178

Tradition-Dismissive vs. Tradition Reconceptualization Approaches in Musculoskeletal Care: The Example of Osteopathic Care
D&rsquo, Alessandro, G., Lunghi, C., Consorti, G., Zanon, S., Berti, F., Turinetto, M., Di Pietrantonio, L., Longobardi, M., Zegarra-Parodi, R., Baroni, F.
Applied Sciences, 2025/03
Free full text

179

A call for improving the internal validity and the reporting of manual therapy trials self-labelled as pragmatic: A methodological review
Roura, S., Alvarez, G., Hohenschurz-Schmidt, D., Solà, I., Núñez-Cortés, R., Bracchiglione, J., Fernández-Jané, C., Phalip, J., Gich, I., Sitjà-Rabert, M., Urrútia, G.
International Journal of Osteopathic Medicine, 2025/03
Free full text

180

Effects of pain education delivered through telerehabilitation on pain and disability in patients with chronic musculoskeletal pain: A systematic review protocol
Velho, G., de Araujo, F. X., da Silva, C. V., Machado, J. C., da Silva, F. C., Hoegh, M. S., Silva, M. F.
International Journal of Osteopathic Medicine, 2025/03


182

The development of the National Council for Osteopathic Research - Research Network (NCOR-RN): A qualitative focus group study of osteopaths’ views
Bailey, D., Fawkes, C., Carnes, D., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2025/03


184

Advancing Equitable Osteopathic Practice: Integrating Person-Centredness & Addressing Racial Biases Through the Lens of Critical Theory
Mhadhbi, H., MacMillan, A., Draper-Rodi, J., Ménard, M., Sinderholm Sposato, N.
International Journal of Osteopathic Medicine, 2025/03

185

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R, 2025/03





190

The Spiritual Component Of Still's Writings
Kimberly, P. E.
The AAO Journal, 2025/03

191

An osteopathic assessment of lower extremity somatic dysfunctions in runners
Santanello, A., Volokitin, M., Matthew, P., Modica, A., McKellar, C., Thakkar, K., Schear, M., Tai, A., Nagler, J., Suarez, S.
Journal of Osteopathic Medicine, 2025/03
Free full text






197

Editorial
DO - Deutsche Zeitschrift für Osteopathie, 2025/03


199

Integration of Osteopathy in Portuguese National Health Service: Perceptions and Expectations of Citizens and Health Professionals
Maria, B., Gomes, S., Goes, A. R.
International Journal of Osteopathic Medicine, 2025/02
Free full text

200

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text

201

“There is a way to work together“: A qualitative study on complementary medicine therapists' perceptions of their role in the Swiss healthcare system
Dubois, J., Rodondi, P.Y., Akre, C.
Complementary Therapies in Clinical Practice, 2025/02
Free full text


203

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text

204

Pursuing Osteopathic Recognition: A National Survey on US Program Director Perspectives
Dong, T., Shapiro, M., Soh, M., Merkebu, J., Cervero, R., McClain, R., Durning, S. J.
Journal of Graduate Medical Education, 2025/02
Free full text


206

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text

207

Manual therapy plus sexual advice compared with manual therapy or exercise therapy alone for lumbar radiculopathy: a randomized controlled trial
Danazumi, M. S., Adamu, I. A., Usman, M. H., Yakasai, A. M.
Journal of Osteopathic Medicine, 2025/01
Free full text

208

Uncovering gaps in management of vasomotor symptoms: findings from a national need assessment
Hubka, T. A., Crim, A., Koh, J. Y., Larrison, C., McKeithen, T., Fleming, M., Caruso, J., Prud&rsquo, homme, M.
Journal of Osteopathic Medicine, 2025/01
Free full text

209

Early osteopathic manipulative treatment to prevent cranial positional deformities: A randomized controlled trial
Genelot, C., Macioce, V., Huguet, H., Harrewijn, I., Cambonie, G., Dessauge, D., Mura, T., Moulis, L., Captier, G.
Archives de Pédiatrie, 2025/01
Free full text


211

The Effect of Osteopathic Visceral Manipulation on Quality of Life and Postural Stability in Women with Endometriosis and Women with Pelvic Organ Prolapse: A Non-Controlled Before-After Clinical Study
Wójcik, M., Kampioni, M., Hudáková, Z., Siatkowski, I., Kędzia, W., Jarząbek-Bielecka, G.
Journal of Clinical Medicine, 2025/01
Free full text


213

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01


215

Editorial
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01

216

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text

217

Dynamometry for the assessment of trunk muscle strength in postpartum women with pregnancy-related posterior pelvic girdle pain: A reliability study
Jafarian, F.S., Jafari-Harandi, M., Yeowell, G., Sadeghi-Demneh, E.
International Journal of Osteopathic Medicine, 2024/12

218

Is visceral osteopathy therapy effective? A systematic review and meta-analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Esteban-Tarcaya, G., Mamud-Meroni, L., Jiménez-del-Barrio, S.
International Journal of Osteopathic Medicine, 2024/12

219

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text

220

The rise of advanced practice provider independence bills: a misguided attempt to address the physician shortage
Bohler, F., Peters, G., Aggarwal, N., Harvey, K., Bohler, J. D.
Journal of Osteopathic Medicine, 2024/12
Free full text

221

“Disproportionate Olympic Rings” – the usage of a biopsychosocial (BPS) framework of care when managing people with musculoskeletal pain by osteopaths in Aotearoa/New Zealand– A qualitative study
Kovanur Sampath, K., Darlow, B., Tumilty, S., Shillito, W., Fairs, E., Devan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/12

222

A call to include intersectionality on board examinations
Dozier, D. R., Rodríguez, J. E.
Journal of Osteopathic Medicine, 2024/12
Free full text

223

Osteopathic health care in aged care facilities: The experience of practitioners in an emerging practice setting
Amorim, M., Bennett, J., McGarry, D., Moore, B., Orrock, P., Whitton, L., Dullard, S.
Australasian Journal on Ageing, 2024/12
Free full text

224

Osteopathic Manual Treatment in Women with Endometriosis: A Scoping Review on Clinical Symptoms, Fertility and Quality of Life
De Strooper, M., De Nys, L., Theys, L., Vermeersch, A., Quaghebeur, J.
International Journal of Osteopathic Medicine, 2024/12
Free full text

225

Effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in individuals with chronic low back pain: A double-blind, randomised placebo-controlled trial
Armbrust, D., Arêas, G. P. T., Fonseca, C. L., Arêas, F. Z. S., Duarte, N. A. C., Santana, S. A. A., Dumont, A. J. L., Neto, H. P., Oliveira, C. S.
Clinical Rehabilitation, 2024/12




229

Outreach Education led by Osteopathic Medical Students on Substance Use Prevention for Sustainable Health Literacy in Underserved Youth Communities
Garg, E., Gogineni, K., Mahimkar, S., Jambunathan, V., Jamal, L., Nazaroff, C., Restini, C.
Journal of Osteopathic Medicine, 2024/12


231

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12


233

Building Disability Competency in Osteopathic Medical Students in Rural Ohio Pilot Study
Hughes, A., Barrett, J., Dillman, O.
Journal of Osteopathic Medicine, 2024/12

234

Impact of Suboccipital Release Osteopathic Manipulative Treatment on Cardiac Control in Healthy Adults
Kachelmeyer, J., Witczak, R., Cummings, K., Crasta, M.
Journal of Osteopathic Medicine, 2024/12


236

The Effect of Osteopathic Manipulative Treatment in Chronic Rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kallat, A., Callahan, M., Kohli, E., Hammes, C., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/12

237

Investigation of Suboccipital Release, Muscle Energy, and Combination Therapy, Respectively Evaluating their Effect on Carotid Artery Blood Flow: Preliminary Results
Sabbagh, M., Moriarty, S., Perera, I., Dziepak, S., Santiago, M., Peddibhotla, V., Rubis, C., Anandakrishnan, R., Rawlins, F., Brolinson, P. G.
Journal of Osteopathic Medicine, 2024/12





242

From the Editor: Dr. Still, Natural Philosopher
Ching, L. M.
The AAO Journal, 2024/12

243

Characteristics, opportunities, and challenges of osteopathy (COCO) in the perceptions of osteopaths in Germany, Austria, and Switzerland: a metasynthesis
Manschel, J., Porthun, J., Beuckels, J. M., Martin, D.
European Journal of Medical Research, 2024/12
Free full text


245

The use of respiratory patient reported outcome measures (PROMs) in the management of COPD: Perceptions of Australian osteopaths
Engel, R., Baxter, D., Muddle, L., Vaughan, B., Grace, S.
Complementary Therapies in Clinical Practice, 2024/11
Free full text




249

Feasibility of a cinematic-virtual reality training program about opioid use disorder for osteopathic medical students: a single-arm pre–post study
Rehl, D., Mangapora, M., Love, M., Love, C., Shaw, K., McCarthy, J., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/11
Free full text


251

Osteopathie in der Rehabilitation von Patienten mit rezidivierenden muskuloskeletalen Verletzungen: eine experimentelle Studie
(Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study)
Sankova, M. V., Nikolenko, V. N., Vovkogon, A. D., Oganesyan, M. V., Trishina, A., Babarzai, L., Antonyan, S. Z., Babarzai, F., Pontes-Silva, A., Zharikov, Y. O.
Manuelle Medizin, 2024/11


253

Development of an abdominal myofascial release therapy intervention for children with irritable bowel syndrome: Feasibility, acceptability, and preliminary outcomes
Benitez, A. J., Dourlain, J., Rana, A., Cohen, T. S., Miccio, R., Evans, J., Rosoff-Verbit, Z., Wang, X., Mascarenhas, M.
Neurogastroenterology and Motility, 2024/11

254

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text

255

Building an evidence base for osteopathy: Trials and tensions. A qualitative study of the experience of clinicians engaging in research
Grace, S., Engel, R., Vogel, S., Ahrens, G., Barclay, K., Guy, C., Lowe, C., McCormack, T., Paranthoiene, J., Carnes, D.
Complementary Therapies in Clinical Practice, 2024/11
Free full text

256

TikTok and frozen shoulder: a cross-sectional study of social media content quality
D'Ambrosi, R., Bellato, E., Bullitta, G., Cecere, A. B., Corona, K., De Crescenzo, A., Fogliata, V., Micheloni, G. M., Saccomanno, M. F., Vitullo, F., Celli, A.
Journal of Orthopaedics and Traumatology, 2024/11
Free full text

257

The impact of prepregnancy body mass index on pregnancy and neonatal outcomes
Mackeen, A. D., Boyd, V. E., Schuster, M., Young, A. J., Gray, C., Angras, K.
Journal of Osteopathic Medicine, 2024/10
Free full text

258

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10


260

Assessing nutrition literacy and nutrition counseling proficiency following an interdisciplinary culinary medicine elective
Kirby, A. N., DeBellis, J., Wolter, K., Mount, G., Wang, C.H., Bishop, J., Barkhouse, J., Wirth, K., Nguyen, N., Cacciatore, C., Kraus, K.
Journal of Osteopathic Medicine, 2024/10
Free full text

261

Effect of manual manipulation on mechanical gait parameters
Yanuck, S. B., Fox, S. K., Harting, B. R., Motyka, T. M.
Journal of Osteopathic Medicine, 2024/10

262

Effectiveness of Osteopathic Treatment in Adults with Short Hamstring Syndrome: A Systematic Review
Ogando-Berea, H., Leirós-Rodríguez, R., Hernandez-Lucas, P., Rodríguez-González, Ó
Journal of Clinical Medicine, 2024/10
Free full text

263

Limb spasticity and telemedicine consultation for reconstructive surgery: patient perspectives of surgical assessment
Bardwell, A., Crowe, C. S., Rhee, P. C.
Journal of Osteopathic Medicine, 2024/09
Free full text


265

Efficacy of ankle mobilization on postural control in older people: A systematic review with meta-analysis
Hernández-Guillén, D., García-Gomariz, C., Roig-Casasús, S., Díaz-Díaz, B., Domínguez-Navarro, F., Pérez-Maletzki, J., Blasco, J.M.
International Journal of Osteopathic Medicine, 2024/09
Free full text

266

Food insecurity and childhood outcomes: a cross-sectional analysis of 2016–2020 National Survey of Children’s Health data
Elenwo, C., Fisch, C., Hendrix-Dicken, A., Coffey, S., Wetherill, M. S., Hartwell, M.
Journal of Osteopathic Medicine, 2024/09
Free full text


268

Osteopathy in the Italian healthcare landscape: Perceptions and areas of competence according to healthcare professionals
Lopane, D., Mazzoleni, B., Cattani, D., Soekeland, F., Dacomi, A., Coldani, C., Tomaiuolo, G., Cangelosi, G., Mancin, S.
Advances in Integrative Medicine, 2024/09


270

Development and adaptation of the Osteopaths' Therapeutic Approaches Questionnaire (Osteo-TAQ) for the Australian osteopathic profession - A cognitive interview study
Thomson, O. P., McLeod, G. A., Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2024/09




274

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text

275

Integrating nutrition and culinary medicine into preclinical medical training
Johnston, E. A., Torres, M., Goldgraben, S., Burns, C. M.
BMC Medical Education, 2024/09
Free full text



278


279

Effects of High-Velocity Spinal Manipulation on Quality of Life, Pain and Spinal Curvature in Children with Idiopathic Scoliosis: A Systematic Review
Piqueras-Toharias, M., Ibáñez-Vera, A. J., Peinado-Rubia, A. B., Rodríguez-Almagro, D., Lomas-Vega, R., Sedeño-Vidal, A.
Children, 2024/09
Free full text

280

Effects of Osteopathic Manipulative Treatment (OMT) on Lower Extremity Muscle Characteristics in Parkinson's disease (PD) Patients
Radigan, R., Finkelstein, A., Mehra, M., Bhushan, P., Lombardo, T., Yao, S.
Movement Disorders, 2024/09

281

Professional skill priorities: Comparison views of osteopathy industry professionals and osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2024/09
Free full text


283

Association and disparities of food insecurity and exposure to violence: analysis of the National Survey of Children’s Health
Bloom, M., McCoy, C., Hendrix-Dicken, A. D., Elenwo, C., Baxter, M. A., Coffey, S., Hartwell, M.
Journal of Osteopathic Medicine, 2024/08
Free full text

284

A Test of Reliability: Cranial Rhythmic Impulse for Distant Diagnoses
Alvarez, L. A., Cook, A. C., Sweeney, C. P., Walter, M. R., South, S. C., Myers, N., Boesler, D., Ma, S., Thomas, K., Quinn, T. A.
Cureus, 2024/08
Free full text

285

Changes in the Affective Empathy of Osteopathic Students: a Longitudinal Study
Newton, B. W., Vaskalis, Z. T.
Medical Science Educator, 2024/08

286

The WELLMESS Project (Move Well, Eat Well, Sleep Well, Stress Well)
Machireddy, D. R., Reid, C. G., Hollingsworth, J. C., Redden, D.
Cureus, 2024/08
Free full text

287

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text


289

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text

290

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08


292

The effect of osteopathic manipulative treatment on quality of life in patients with cardiac implantable electronic devices
Nikakis, J., Tale, E., Malkov, D., Arora, U. S., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2024/08
Free full text

293

Medical malpractice liability in large language model artificial intelligence: legal review and policy recommendations
Shumway, D. O., Hartman, H. J.
Journal of Osteopathic Medicine, 2024/07
Free full text


295

The Neurophysiological Effects of Craniosacral Treatment on Heart Rate Variability: A Systematic Review of Literature and Meta-Analysis
Cook, A. C., Egli, A. E., Cohen, N. E., Bernardi, K., Chae, M. Y., Kapalko, B. A., Coyne, S. A., Scott, R.
Cureus, 2024/07
Free full text

296

Use of person-centered language in obesity-related publications across sports medicine journals: a systematic review of adherence to person-centered language guidelines in sports medicine
Webb, J., Mach, K., Gooch, T., Reddy, A., Anderson, M., Scott, J., Checketts, J. X., Walker, L., Hartwell, M.
Journal of Osteopathic Medicine, 2024/07
Free full text

297

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07

298

The Effects of Osteopathic Manipulative Treatment on Brain Activity: A Scoping Review of MRI and EEG Studies
Bonanno, M., Papa, G. A., Ruffoni, P., Catalioto, E., De Luca, R., Maggio, M. G., Calabrò, R. S.
Healthcare, 2024/07
Free full text

299

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text

300

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Canadian osteopaths
Pelletier, R., Morin, C., Noy, M., Thomson, O. P., Sundberg, T., Leach, M. J.
International Journal of Osteopathic Medicine, 2024/06

301

Comorbidities associated with symptoms of subjective cognitive decline in individuals aged 45–64
Monahan, Z., Heath, J., Santos, A. D., Ford, A., Hartwell, M.
Journal of Osteopathic Medicine, 2024/06
Free full text

302

Historia de la osteopatía en Colombia
(History of osteopathy in Colombia)
Granados Jiménez, J. A.
Unpublished MSc thesis, 2024/06
Free full text





307

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06






313

The Role of Osteopathic Structural Findings in Meningitis
Cecil, E., Burke, D.
The AAO Journal, 2024/06



316

Short leg syndrome in clinical practice
(Синдром короткой ноги в клинической практике)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06







323

Osteopathic Management of Chronic Pain Following Bilateral Periacetabular Osteotomy in Developmental Hip Dysplasia
Edgar, T., Heller, G. R., Hutson, M., Melin, D., Bardowell, A.
The AAO Journal, 2024/06

324

“That’s The Way We Have Always Done It”: Resetting the Hips
Tschantz, V., Fremarek, N., Hammond, E., Digambar, S., Vargas, E., Harden, D., Tobey, A. H., Kozar, A. J.
The AAO Journal, 2024/06





329

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06


331

A Qualitative and Quantitative Analysis of Suboccipital Release on Heart Rate Variability
Moon, J., Fotopoulos, T. J., Gustin, D., Thornburgh, K. R., Wenner, A. R., McAllister, J. M.
The AAO Journal, 2024/06

332

Post Isometric Muscle Energy at the Cervical Spine (OA, C1, C2) Increases Vagal Tone as Quantified by Heart Rate Variability Metrics
Nakashima, T., Curran, C., Yates, H., Fanous, S., Johns, J., Fotopoulos, T. J., Miller, A.
The AAO Journal, 2024/06

333

Effects of OMT on Blood Glucose and Insulin Sensitivity in Adult Male Rats
Petrillo, G., Staudt, M., Lobo, S., Cai, W., Keys, J.
The AAO Journal, 2024/06

334


335

An Osteopathic Approach to Eyelid Myokymia
Shih, S., Rundquist, L., Qureshi, Y.
The AAO Journal, 2024/06



338

The association of folate deficiency with clinical and radiological severity of knee osteoarthritis
Abedi, M., Mollashahi Javan, H., Khosravi, A., Rohani, R., Mohammadsharifi, G.
Journal of Osteopathic Medicine, 2024/05
Free full text

339

Associations of social determinants of health and childhood obesity: a cross-sectional analysis of the 2021 National Survey of Children’s Health
Batioja, K., Elenwo, C., Hendrix-Dicken, A., Ali, L., Wetherill, M. S., Hartwell, M.
Journal of Osteopathic Medicine, 2024/05
Free full text

340

Research integrity and academic medicine: the pressure to publish and research misconduct
Kearney, M., Downing, M., Gignac, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text




344

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text

345

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text

346

The Tensegrity Curriculum: A Comprehensive Curricular Structure Supporting Cultural Humility in Undergraduate Medical Education
Jones, A. C., Bertsch, K. N., Williams, D., Channell, M. K.
Advances in Medical Education and Practice, 2024/05
Free full text

347

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05



350

A modern way to teach and practice manual therapy
Kerry, R., Young, K. J., Evans, D. W., Lee, E., Georgopoulos, V., Meakins, A., McCarthy, C., Cook, C., Ridehalgh, C., Vogel, S., Banton, A., Bergström, C., Mazzieri, A. M., Mourad, F., Hutting, N.
Chiropractic & Manual Therapies, 2024/05
Free full text

351

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text

352

The impact of emergency medicine residents on clinical productivity
Pallaci, M., Jouriles, N., dos Santos, A., Miller, J., Gothard, M. D., Seaberg, D. C.
Journal of Osteopathic Medicine, 2024/04
Free full text

353

The effectiveness of an osteopathic manual technique compared with a breathing exercise on vagal tone as indicated by heart rate variability, a crossover study
Cavanagh, M., Cope, T., Smith, D., Tolley, I., Orrock, P., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text




357

Overcoming barriers to equality, diversity, inclusivity, and sense of belonging in healthcare education: the Underrepresented Groups' Experiences in Osteopathic Training (UrGEnT) mixed methods study
Draper-Rodi, J., Abbey, H., Hammond, J., Thomson, O. T., Brownhill, K., MacMillan, A., Fabusuyi, Y., Vogel, S.
BMC Medical Education, 2024/04
Free full text

358

Where are the Black men in osteopathic medical schools?
Megafu, M. N.
Journal of Osteopathic Medicine, 2024/04
Free full text

359

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text






365

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text

366

Australian private health insurer attitudes towards osteopathy: A qualitative study
Engel, R., Grace, S., Duncan, N., Wade, B., Paterson-Allsop, J., O'Hara, B., Vaughan, B.
International Journal of Osteopathic Medicine, 2024/03
Free full text



369

Perceptions of Australian osteopaths on the use of telehealth for patient care: Barriers and enablers for implementation
Grace, S., Engel, R., Mastronardo, C., Muddle, L., Fleischmann, M., Vaughan, B., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2024/03
Free full text

370

Inter-rater and intra-rater reliability of manual assessment of respiratory motion in patients with unilateral cervical radiculopathy: A cross-sectional study
Kordi Yoosefinejad, A., Yousefiyan, R., Nazari, R., Rezaei, I.
International Journal of Osteopathic Medicine, 2024/03

371

What is wrong with osteopathy? A response to Thomson and MacMillan
Nicholls, D. A.
International Journal of Osteopathic Medicine, 2024/03

372

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03

373

The inter- and intra-rater reliability of the manual diaphragm assessment scale in healthy participants
Viegas, I., Francisco, C., Farinha, E., Nunes, A.
International Journal of Osteopathic Medicine, 2024/03


375

From the Editor: Aspects of Complexity in Osteopathic Medicine
Ching, L. M.
The AAO Journal, 2024/03
Free full text


377

The role of aspirin, statins, colchicine, and IL-1 inhibitors in prevention of cardiovascular events: a systematic integrative review
Arboleda, V., Hackworth, A., Bonnice, S., Gonzalez, V., Cabrera, D., Colletti, C., Baxter, C., Aleman Oliva, C., Kabir, S., Huang, J., Khan, A., Filoramo, S., Ecoff, S., Demory Beckler, M., Kesselman, M. M.
Journal of Osteopathic Medicine, 2024/03
Free full text






383

Aus der digitalen Welt
(From the digital world)
Sonntag, M.
Osteopathische Medizin, 2024/03
Free full text

384

The evolution of type 2 diabetes management: glycemic control and beyond with SGLT-2 inhibitors and GLP-1 receptor agonists
Serowik, T. C., Pantalone, K. M.
Journal of Osteopathic Medicine, 2024/03
Free full text

385

Increased circulating microRNA-21 level as a potential indicator for predicting a higher risk of incident fragility fractures
Si, Z.X., Zhou, S.F., Shen, Z.L., Yan, J.L.
Journal of Osteopathic Medicine, 2024/03
Free full text

386

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03

387

Interrater agreement and reliability of a palpation method for locating C1 transverse process in the cervical spine
Ferreira, A. P. A., Maddaluno, M. L. M., Curi, A. C. C., Ferreira, A. d. S.
International Journal of Osteopathic Medicine, 2024/03

388

Cross-Sectional Analysis of the Effect of Physical Activity, Nutrition, and Lifestyle Factors on Medical Students' Academic Achievement
Neuman, J., Ina, E. A., Huq, S. O., Blanca, A., Petrosky, S. N.
Cureus, 2024/03
Free full text

389

Effect of Osteopathic Manipulation in an Autism Spectrum Child With Speech Impairment and Attention Deficit: A Case Report
Sharath, H. V., Raghuveer, R., Qureshi, M. I., Warghat, P. A., Desai, S., Brahmane, N. A.
Cureus, 2024/03
Free full text

390

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03

391

Effect of physiotherapy on infertility treatment in polycystic ovary syndrome patients
Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jędrzejczyk, S., Jerzak, M., Jerzak, M.
Przegląd Menopauzalny, 2024/03

392

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03

393

Is Craniosacral Therapy Effective? A Systematic Review and Meta-Analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Cabanillas-Barea, S., Esteban-Pérez, J., Jiménez-del-Barrio, S.
Healthcare, 2024/03
Free full text

394

The Sentient Cell: Implications for Osteopathic Medicine
Bordoni, B., Escher, A. R., Castellini, F., Vale, J.
Cureus, 2024/02
Free full text

395

Osteopathic approach as an additional therapy of infertility in women with PCOS
Jędrzejczyk, S., Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jerzak, M., Jerzak, M.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/02

396

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02

397

Social determinants of health in patients with arthritis: a cross-sectional analysis of the 2017 Behavioral Risk Factor Surveillance System
Webb, J., Emmert, R., Reddy, A., Sajjadi, N. B., Greiner, B., Bray, N., Hartwell, M.
Journal of Osteopathic Medicine, 2024/02
Free full text

398

Profession-based manual therapy nomenclature: exploring history, limitations, and opportunities
Degenhardt, B., van Dun, P. L. S., Jacobson, E., Fritz, S., Mettler, P., Kettner, N., Franklin, G., Hensel, K., Lesondak, D., Consorti, G., Frank, L., Reed, W. R., MacDonald, C., Kremen, V., Martin, C., Landels, B., Standley, P.
Journal of Manual & Manipulative Therapy, 2024/02
Free full text

399

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text

400

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text

401

Reliability and Validity of the Variability Model Testing Procedure for Somatic Dysfunction Assessment: A Comparison with Gait Analysis Parameters in Healthy Subjects
Vismara, L., Bergna, A., Tarantino, A. G., Dal Farra, F., Buffone, F., Vendramin, D., Cimolin, V., Cerfoglio, S., Pradotto, L. G., Mauro, A.
Healthcare, 2024/02
Free full text

402

Interdisciplinary Approach to Orthodontic Treatment Involving an Osteopath and a Dentist (Protocol)
Aptekar, I. A., Abramova, E. V., Postnikov, M. A., Kopetsky, I. S., Eremin, D. A., Postnikova, E. M., Poluianova, E. B., Aptekar, V. I., Muravyov, I. O.
Bulletin of Russian State Medical University, 2024/02
Free full text

403

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text

404

Delayed discovery: the COVID-19 pandemic’s influence on osteoarthritis clinical trials
Sajjadi, N. B., Anderson, J. M., Hughes, G. K., Abraham, C. E., Malik, J., Hartwell, M., Vassar, M.
Journal of Osteopathic Medicine, 2024/01
Free full text


406

The Effect of the Coronavirus (COVID-19) Pandemic on Gender and Medical School Diversity in Gastroenterology Fellowship Matching
Almujarkesh, M. K., Alsakarneh, S., Almeqdadi, M., Al Ta'ani, O., Mohamad, B., Kinnucan, J.
Gastro Hep Advances, 2024/01
Free full text

407

Mitleid und Mitgefühl
(Pity and compassion)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

408

The Future of Osteopathy
Bordoni, B., Escher, A. R.
Cureus, 2024/01
Free full text

409

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text


411

Antitumoral Agent-Induced Constipation: A Systematic Review
Calsina-Berna, A., González-Barboteo, J., Llorens-Torromé, S., Julià-Torras, J.
Cancers, 2024/01
Free full text

412

Characteristics, Opportunities, and Challenges of Osteopathy Based on the Perceptions of Osteopaths in Austria: Qualitative Interview Study
Manschel, J., Porthun, J., Winkler, U., Beuckels, J. M., Martin, D.
JMIR Human Factors, 2024/01
Free full text



415

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12



418

Power and capital: In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12

419

Views from Australian osteopaths and industry stakeholders about the profession: A qualitative study
Mastronardo, C., Muddle, L., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2023/12

420

Effects of combined taping of quadriceps and hamstring muscles on pain and disability in patients with knee osteoarthritis: Randomized assessor-blinded controlled study
Mohamed, Y. E., Abd-Alkareem, D. S., Balbaa, A.E. A.A., Samy, M. M., Ashour, R. S.
International Journal of Osteopathic Medicine, 2023/12

421

Construct validity and reliability of a test for sacroiliac dysfunction: Downing test
Ribeiro, R. P., Guerrero, F. G., Camargo, E. N., Pivotto, L. R., Aimi, M. A., Candotti, C. T., Loss, J. F.
International Journal of Osteopathic Medicine, 2023/12

422

Application of high-velocity low-amplitude technique in cervicothoracic junction produces cardiovascular responses in subjects with C7-T1 dysfunction: Randomized crossover trial
Zago, J., de Souza, B. U. L., Amatuzzi, F., Rondinel, T. Z., Queiroz, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2023/12




426

From the Editor: Interrelationship in Osteopathic Medicine
Ching, L. M.
The AAO Journal, 2023/12
Free full text

427

Simplicity of Osteopathy
Fryette, H. H.
The AAO Journal, 2023/12
Free full text



430

Power and capital; In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12

431

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text

432

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12

433

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12


435

Making sense of cranial osteopathy: An interpretative phenomenological analysis
Banton, A., Vogel, S., Lee-Treweek, G.
International Journal of Osteopathic Medicine, 2023/12
Free full text

436

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12


438

Trends in Contributions to the Osteopathic Political Action Committee: A Twenty-Two-Year Analysis
Scully, T., Loria, R., Golden, A., Martinez, V. H., Sees, J.
Journal of Osteopathic Medicine, 2023/12

439

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12

440

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
Free full text

















457




460

The osteopath-parent-child triad in osteopathic care in the first 2 years of life: a qualitative study
Accardi, C., Cerritelli, F., Bovo, L., Esteves, J. E.
Frontiers in Psychology, 2023/10
Free full text

461

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text



464




467

Dermal Reflections of Neural Disorders: An Hypothesis
Patriquin, D. A.
The AAO Journal, 2023/09
Free full text

468

Comparison of affected lumbar proprioception due to different injuries with healthy controls: An observational study
Simsek, S., Altindal, F., Kilicarslan, B.
International Journal of Osteopathic Medicine, 2023/09


470



472

Mechanische Eigenschaften der Arterien
(Mechanical characteristics of the arteries)
Wyvekens, M., Hirth, T., Wyvekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09


474

Osteopathy in the world of modern medicine
(Остеопатия в мире современной медицины)
Konopleva, E. L., Ostapenko, V. M., Tarasov, N. A.
Russian Osteopathic Journal, 2023/09
Free full text





479

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09

480

Short-term effects on heart rate variability of occipito-mastoid suture normalization in healthy subjects
Besson, C., Mur, T., Benaim, C., Schmitt, L., Gremeaux, V.
Frontiers in Neuroscience, 2023/09
Free full text

481

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text


483

„Der Placeboeffekt ist nichts Schlimmes!“
('The placebo effect isn't a bad thing!')
Stechmann, K., Cerritelli, F.
Osteopathische Medizin, 2023/09

484

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09


486

Medical Leadership in Inpatient Rehabilitation Facilities in the United States
Davis, S. M., Davis, A., Wong, T., Mekany, M., Majors, D., Perret Karimi, D.
American Journal of Physical Medicine & Rehabilitation, 2023/08
Free full text

487

The Evaluation of a Digital Health Intervention to Improve Human Papillomavirus Vaccine Recommendation Practices of Medical Students
Richman, A. R., Torres, E., Wu, Q., Eldridge, D., Lawson, L.
Journal of Cancer Education, 2023/08

488

Diversity Differences Among Cardiovascular Fellowships Across Five Geographic Regions in the United States
Dye, M., Saeed, A., Nguyen, T. Q., Yu, S., Bey, J., Hefner, D., Walk, C. T., Lantz, R.
Cureus, 2023/08
Free full text

489

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text

490

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text

491

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text

492

Peritoneal Adhesions in Osteopathic Medicine: Theory, Part 1
Bordoni, B., Escher, A. R., Girgenti, G. T.
Cureus, 2023/07
Free full text

493

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/07

494

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07

495

Effectiveness of Osteopathic Manipulative Treatment in Treating Symptoms of Irritable Bowel Syndrome: A Literature Review
Lotfi, C., Blair, J., Jumrukovska, A., Grubb, M., Glidden, E., Toldi, J.
Cureus, 2023/07
Free full text

496

An Osteopathic Approach to Dizziness Secondary to Meniere’s Disease
Grote, J., Perez, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text


498

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
Free full text

499

Resolution of a Plica Band Syndrome with Osteopathic Manipulative Treatment
Barr, J., Heller, G.
The AAO Journal, 2023/06
Free full text

500

Investigating the mechanism of dextrose prolotherapy in vitro: fibroblast proliferation and production of growth factors
Harting, B., Fox, S., Motyka, T., Hinkelman, A.
The AAO Journal, 2023/06
Free full text


502



504

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
Free full text

505

Palpatory tests in manual therapies: an international survey on osteopathic clinical practice
Novelli, E., Molinari, L., Consolo, S., Mingrone, L.
Journal of Complementary and Integrative Medicine, 2023/06
Free full text

506

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06


508

Phenotypic signs of connective tissue dysplasia in adolescents
(Фенотипические признаки дисплазии соединительной ткани у подростков)
Shashmurina, V. R., Mishutina, O. L., Postnikov, M. A., Shashmurina, A. B., Dmitrieva, E. V., Parfenov, R. V.
Russian Osteopathic Journal, 2023/06
Free full text



511

Tau mai te wairua, tau mai te hauora: Navigating hauora in osteopathy
Thomas, J. D.
Unpublished MSc thesis, 2023/06
Free full text

512

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06

513

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists: An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/06

514

Terapia manual y tratamiento osteopático en pacientes con EPOC estable
(Manual therapy and osteopathic treatment in patients with stable COPD)
Diaz Serrano, R., Souto Villar, M. A.
European Journal Osteopathy & Related Clinical Research, 2023/06
Free full text


516

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/06
Free full text




520

Osteopathy in the Early Diagnosis and Management of Degenerative Cervical Myelopathy: National Survey
Brannigan, J. F. M., Mowforth, O. D., Rogers, M., Wood, H., Karimi, Z., Kotter, M. R. N., Davies, B. M.
JMIR Formative Research, 2023/05
Free full text


522

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05

523

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05

524

Osteopathic manipulative treatment of patients with chronic low back pain in the United States: a retrospective cohort study
Licciardone, J. C., Moore, S., Fix, K., Blair, L. G., Ta, K.
Journal of Osteopathic Medicine, 2023/05
Free full text

525

Perceptions of experienced osteopaths on interprofessional communication
Grech, R.
Unpublished MSc thesis, 2023/05
Free full text


527

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists : An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/05



530

Efficacy of the Osteopathic Pedal Pump in Reducing Lower Limb Volume in Older Adults with Lymphedema
Parikh, S. H., Adams, J. S., Goodwin, B. J., McLaughlin, M. H., Noll, D. R.
Journal of the American Geriatrics Society, 2023/04

531

Comparative Effects of Positional Release Technique Versus Deep Transverse Friction Massage on Pain and Disability in patients with Acute Mechanical Low Back Pain
Ammara, U., Shahzadi, F., Nazir, S., Fatima, K., Batool, F., Gondal, K. S., Aqeel, M., Shah, S., Maqbool, S.
Pakistan Journal of Medical and Health Sciences, 2023/04



534

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text

535

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text

536

Informing the Physical Therapy Management of Congenital Muscular Torticollis Clinical Practice Guideline: A Systematic Review
Castilla, A., Gonzalez, M., Kysh, L., Sargent, B.
Pediatric Physical Therapy, 2023/04

537

Does the osteopathic pedal pump reduce lower limb volume in healthy subjects?
Adams, J. S., Parikh, S. H., Goodwin, B. J., Noll, D. R.
Journal of Osteopathic Medicine, 2023/04
Free full text


539

A Heart for Medicine: Palpitations In the Midst of Training
Coggins, J.
Osteopathic Family Physician, 2023/03


541

Covid-19 Fatigue: Diagnosis and Treatment for the Osteopathic Physician
Foss, V. B., Maddie, N., Frankini, E. L., Landman, S., Maccagnano, J., Yao, S. C.
Osteopathic Family Physician, 2023/03

542

What Makes Us Special, Different and Alike?
Gregory, P.
Osteopathic Family Physician, 2023/03

543


544

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03






550

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03

551

Inter-rater reliability between osteopaths of differing clinical experience on sagittal plane running gait analysis: A pilot study
Tripodi, N., Dagiandis, T., Hameed, A., Heilberg, L., Olbinski, E., Reid, C., White, A., McLaughlin, P.
International Journal of Osteopathic Medicine, 2023/03



554

Eficacia de las técnicas osteopáticas en el dolor de rodilla
(Effectiveness of osteopathic techniques in knee pain)
González Ruiz, P. M., Laguna Aranda, A. M., Aranda Guirado, L.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text

555

Efecto de la osteopatía en la enfermedad por reflujo gastroesofágico
(Effect of osteopathy on gastroesophageal reflux disease)
Martín Ruiz, M.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text

556

Physical and Simulated Tensegrity Models of the Skull Bones and Fascia using CT Bone-Shape Data
Looman, J., Venne, G., Blostein, D., Scarr, G.
Journal of Bodywork and Movement Therapies, 2023/03

557

Efectividad del tratamiento osteopático en el dolor pélvico crónico
(Effectiveness of osteopathic treatment for chronic pelvic pain)
Rivero Rodríguez, S.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text







564

Connecting the dots: alterations in bioelectric activity at acupuncture Ting (Jing-Well) points following CV4 cranial manipulation
Hendryx, J. T., Kannan, A., Prashad, J., Falk, K.
Journal of Osteopathic Medicine, 2023/03
Free full text




568

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text


570

Weibliche Genitalverstümmelung und Osteopathie
(Female genital mutilation and osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

571

Characteristics of patients presenting at a university outpatient department for com-plementary and integrative medicine
Rotter, G., Binting, S., Teut, M., Ortiz, M., Willich, S. N., Brinkhaus, B.
Complementary Medicine Research, 2023/02



574

Perceived Value of Osteopathic Recognition
Maier, R., Weaver, J., Ginoza, J. A., Meyer, D., Gothard, D.
Family Medicine, 2023/02
Free full text

575

The Impact of Complementary and Integrative Medicine Following Traumatic Brain Injury: A Scoping Review
Kim, S., Mortera, M. H., Wen, P. S., Thompson, K. L., Lundgren, K., Reed, W. R., Sasson, N., Towner Wright, S., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
The Journal of Head Trauma Rehabilitation, 2023/02
Free full text



578



580

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01


582

An exploration of the experience of osteopaths managing individuals with endometriosis
Zeigler, Z. L.
Unpublished MSc thesis, 2023/01
Free full text


584

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text


586

Dynamic touch induces autonomic changes in preterm infants as measured by changes in heart rate variability
Manzotti, A., Cerritelli, F., Monzani, E., Savioli, L., Esteves, J. E., Lista, G., Lombardi, E., Rocca, S. L., Biasi, P., Galli, M., Chiera, M., McGlone, F. P.
Brain Research, 2023/01

587

Successful buprenorphine transition while overlapping with a full opioid agonist to treat chronic pain: a case report
Patel, K. V., Sahni, S., Taylor, L. F.
Journal of Osteopathic Medicine, 2023/01
Free full text


589

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12







596

Epiploic Appendagitis Mimicking Acute Appendicitis: An Osteopathic Case Report
Chin, J., Oseguera, B., Hon, K., Lomiguen, C. M., McBride, T.
Cureus, 2022/12
Free full text

597

The effect of the COVID-19 pandemic on osteopathic education in ACGME-OR residencies from February 2020 to February 2021
Bingham, S., Bray, N. N., Eddy, A. J.
Journal of Osteopathic Medicine, 2022/12
Free full text

598

The role of 3D digital applications in manual therapy education – A scoping review
Kovanur Sampath, K., Arumugam, A., Jull, G.
International Journal of Osteopathic Medicine, 2022/12

599

Evocations of Osteopathy's founder and questions for contemporary osteopathic professional identity: A thematic analysis
Skinner, D., Esber, T., Walkowski, S.
International Journal of Osteopathic Medicine, 2022/12


601

A web-based review of global health programs in U.S. allopathic and osteopathic medical schools
Edwards, M. K., An, C., Rohrbaugh, R., Peluso, M. J., Lam, S. K.
Medical Teacher, 2022/12

602

Acupuncture and Osteopathic Medicine for Atopic Dermatitis – a Three-armed Randomized Controlled Explorative Clinical Trial
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Clinical and Experimental Dermatology, 2022/12
Free full text

603

A Peer-led Program to Increase Diversity in Osteopathic Medical Schools: Three Year Update
Hu, J., Smart, H., Garo, J. A., Rachdi, O., Fernandes Paul, M.
Journal of Osteopathic Medicine, 2022/12

604

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12

605

Student Developed Didactic Series Rooted in Osteopathic Philosophy
Newman, N., Ahmed, S., Shiffler, V., Sinitsa, I., Harold, Z., Naeem, A., Lovett, G., Nazar, A.
Journal of Osteopathic Medicine, 2022/12

606

Beliefs and Attitudes About Opioid Prescribing in Patients With Low Back Pain: A Survey of Osteopathic Physicians
Pham, B., Tzau, A., Lee, A. S., DeStefano, L. A., Popovich, J. M.
Journal of Osteopathic Medicine, 2022/12


608

Diagnosis and management of headache disorders in osteopathic practice: A qualitative study
Tripodi, N., Cordina, J., Jaffre, D., Mason, K., McMahon, G., Xeureb-Graham, B., Yanovsky, R., Wospil, R.
International Journal of Osteopathic Medicine, 2022/12

609

Optimizing chronic pain management through patient engagement with quality of life measures: a randomized controlled trial
Licciardone, J. C., McDonald, H., Yablon, M., Ngo, W., Cunanan Garza, K. A., Aryal, S.
Journal of Osteopathic Medicine, 2022/11
Free full text

610

Osteopathic Manipulative Medicine for Chronic Pain in the Setting of Cerebral Palsy
Dixon, D. S., Elwert, N. C., McDermott, G. A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/11

611

Student performance in medical biochemistry and genetics: comparing campus-based versus zoom-based lecture delivery
Faner, M. A., Ritchie, R. P., Ruger, K. M., Waarala, K. L., Wilkins, C. A.
BMC Medical Education, 2022/11
Free full text


613

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/11
Free full text

614

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11

615

Model-Base Estimation of Non-Invasive Ventilation Weaning of Preterm Infants Exposed to Osteopathic Manipulative Treatment: A Propensity-Score-Matched Cohort Study
Tarantino, A. G., Vismara, L., Buffone, F., Bianchi, G., Bergna, A., Vanoni, M., Tabbi, C., Bresesti, I., Agosti, M.
Healthcare, 2022/11
Free full text

616

The Profile of Belgian Osteopaths: A Cross-Sectional Survey
van Dun, P. L. S., Verbeeck, J., Arcuri, L., Esteves, J. E., Cerritelli, F.
Healthcare, 2022/10
Free full text

617

At-home ECG monitoring with a real-time outpatient cardiac telemetry system during the COVID-19 pandemic
Jaramillo, N., Malkov, D., Nikakis, J., Arora, U. S., Cohen, T. J.
Journal of Osteopathic Medicine, 2022/10
Free full text


619

Effect of Visceral Mobilization on Abdomino-Phrenic Dyssynergia in Irritable Bowel Syndrome Patients
Hammam, E. E. E.D., Sayed, A. A., Abdelkader, F., El-Moatasem, A. M.
The Egyptian Journal of Hospital Medicine, 2022/10
Free full text

620

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09


622

Effectiveness of Mulligan's Two-Leg Rotation Versus Muscle Energy Technique in Subjects With Hamstring Tightness
Jaiswal, P. R., Qureshi, I., Phansopkar, P. A.
Cureus, 2022/09
Free full text


624

A Thematic Analysis of Osteopathic Physicians' Identities and Experiences in North American Professional Sports
Blacha, K., Cade, A., Russell, T., Skinner, D.
Open Access Journal of Sports Medicine, 2022/09
Free full text


626

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text

627

Effectiveness of routine physical therapy with and without muscle energy technique in patients with upper crossed syndrome
Shahzad, H., Fatima, A., Ahmad, A., Khan, Z. A., Gilani, S. A.
Rawal Medical Journal, 2022/09
Free full text




631

The effectiveness of a multimodal approach in the treatment of patients with upper crossed syndrome: A randomized controlled trial
Aneis, Y. M., El-Badrawy, N. M., El-Ganainy, A.E. A., Atta, H. K.
Journal of Bodywork and Movement Therapies, 2022/09


633

Osteopathic Medical Students’ Subjective Preparedness for LGBTQ+ Patient Care and Influencing Factors: A Multi-Institutional Survey Study
Morimoto, K., Uy, J. C., Blair, L., Barab, H., Wu, W., Oosterbaan, C., Ozdowski, L., Guenther, E.
The AAO Journal, 2022/09
Free full text

634

The Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ) - A content validity study
Thomson, O. P., Vaughan, B., Sampath, K., Draper-Rodi, J., Fleischmann, M., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/09


636

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09


638

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09




642

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text

643

Exploring lumbo-pelvic functional behaviour patterns during osteopathic motion tests: A biomechanical (en)active inference approach to movement analysis
Ménard, M., Couvertier, M., Awai, L., Esteves, J. E., Bideau, B., Vaucher, P.
International Journal of Osteopathic Medicine, 2022/09

644

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text

645

Student Attitudes About Osteopathic Medical Schools: Increasing Student Willingness to Apply
Mattiace, S. M.
Unpublished Dissertation, 2022/08
Free full text

646

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text

647

“What you feel under your hands“: exploring professionals' perspective of somatic dysfunction in osteopathic clinical practice-a qualitative study
Arcuri, L., Consorti, G., Tramontano, M., Petracca, M., Esteves, J. E., Lunghi, C.
Chiropractic & Manual Therapies, 2022/08
Free full text

648

Thoracic Manual Therapy Improves Pain and Disability in Individuals With Shoulder Impingement Syndrome Compared With Placebo: A Randomized Controlled Trial With 1-Year Follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/08

649

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text


651

Thoracic manual therapy improves pain and disability in individuals with shoulder impingement syndrome compared to placebo: a randomised controlled trial with one year follow-up
Hunter, D. J., Rivett, D. A., McKiernan, S., Luton, R., Snodgrass, S. J.
Archives of Physical Medicine and Rehabilitation, 2022/08


653

The association between operating margin and surgical diversity at Critical Access Hospitals
Hopper, W., Zeller, R., Burke, R., Lindsey, T.
Journal of Osteopathic Medicine, 2022/07
Free full text


655

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07

656

Grisel-Syndrom bei einem Vorschulkind
(Grisel's syndrome in a preschool child)
Boltz, A.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07

657

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07

658

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07

659

Cervical cancer screening among women with comorbidities: a cross-sectional examination of disparities from the behavioral risk factor surveillance system
Austin, J., Delgado, P., Gatewood, A., Enmeier, M., Frantz, B., Greiner, B., Hartwell, M.
Journal of Osteopathic Medicine, 2022/07
Free full text

660

Im Gespräch mit … Christian Hartmann
(In dialog with ... Christian Hartmann)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07




664

Pediatric unilateral knee swelling: a case report of a complicated differential diagnosis and often overlooked cause
Guardado, K. E., Sergent, S.
Journal of Osteopathic Medicine, 2022/06
Free full text

665

Liebe Leser*innen
(Dear readers)
Kramme, P.
Osteopathische Medizin, 2022/06

666

Chronic cough as seen by allergy specialists: An internet survey of providers in a large nation-wide practice
Prenner, Bruce M., Topp, Robert, McCan, William A.
Allergy and Asthma Proceedings, 2022/06




670

Osteopathy and physiotherapy compared to physiotherapy alone on fatigue in long COVID: Study protocol for a pragmatic randomized controlled superiority trial
Certain Curi, A. C., Antunes Ferreira, A. P., Calazans Nogueira, L. A., Mello Meziat Filho, N. A., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2022/06
Free full text

671

David S. Festinger (1962-2021)
Dugosh, J. W., Dugosh, K. L., Lent, M. R.
American Psychologist, 2022/06



674

An Enactive-Ecological Model to Guide Patient-Centered Osteopathic Care
Cerritelli, F., Esteves, J. E.
Healthcare, 2022/06
Free full text



677

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text





682

4 M's to make sense of evidence – Avoiding the propagation of mistakes, misinterpretation, misrepresentation and misinformation
Draper-Rodi, J., Vaucher, P., Hohenschurz-Schmidt, D., Morin, C., Thomson, O. P.
International Journal of Osteopathic Medicine, 2022/06


684

Does the inter-osseous membrane fascial dysfunction exist ? An observational study comparing palpation to ultrasound measurements
Lecardonnel, T., Salmon, M., Merdy, O., Sarzeaud, R., Matthew, T.
International Journal of Osteopathic Medicine, 2022/06

685

Abnormal Foot Progression Angle Kinematics in Cervical Dystonia Improved After Osteopathic Manipulative Medicine: A Prospective Case Series
Mancini, J., Oliff, Z., Abu-Sbaih, R., Simone, J., LaRosa, A., Mody, S., Li, T. S., Leder, A.
Cureus, 2022/06
Free full text

686

Factors affecting utilization of CT scan following ultrasound evaluation of suspected appendicitis
Zisman, A., Novi, B., Gaughan, J., Carr, L.
Journal of Osteopathic Medicine, 2022/06
Free full text

687

Professional identity in osteopathy: A scoping review of peer-reviewed primary osteopathic research
Phillips, A. R.
International Journal of Osteopathic Medicine, 2022/06
Free full text



690

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

691

SCIWORA: A Pediatric Case
Masterson, C., Byrd, A., Gebhardt, G.
The AAO Journal, 2022/06
Free full text

692

The Effects of a Novel Virtual Reality Osteopathic Manipulative Medicine Program on First Year Practical Exam Scores
Ahmed, E., Jose, J., Stout, R., Yao, S. C.
The AAO Journal, 2022/06
Free full text

693

Sacroiliac joint dysfunction: hypomobility and hypermobility
Bordoni, B.
Journal of Osteopathic Medicine, 2022/06
Free full text

694

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

695

Native American Student Perspectives on Culturally Integrated Education at a Tribal College of Osteopathic Medicine
Gatewood, A., Terry, R., Bray, N., Hartwell, M.
The AAO Journal, 2022/06
Free full text


697

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text

698

Osteopathic Manipulative Treatment may be a Cost-Effective Approach to Reducing Pain Associated with Acute Flare of Interstitial Cystitis
Hermann, S. J., Barnett, M. E., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text

699

Managing Muscle Rigidity: An Osteopathic Approach to the Treatment of Stiff Person Syndrome
Mainville, M., Cameron, D. L., Barry, P.
The AAO Journal, 2022/06
Free full text

700

An Osteopathic Approach to Childhood Scoliosis and Leg Length Inequality in a Pediatric Patient with Chiari I Malformation
Schultz, R., Baig, Y., Henderson, K. K., Heinking, K. P.
The AAO Journal, 2022/06
Free full text

701

Effects of Muscle Energy Technique versus Bruegger's Relief Exercise on the Forward Head Posture among electronic gadget users - A Pilot study
Dalawar, A., Afzal, H., Dalawar, I., Murtaza, A., Ghafoor, A., Fiaz, S.
Pakistan Journal of Medical and Health Sciences, 2022/05
Free full text

702

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text

703

Cross-Sectional Study of Osteopathic General Surgeons in University-Based General Surgery Departments
Khan, M. T., Patnaik, R., Wheeler, C., Ibrahim, M., Wolf, H., Baumgardner, K. C., Lovely, R. S.
Cureus, 2022/05
Free full text

704

Advocacy for Change: An Osteopathic Review of Traumatic Brain Injury Among Combat Veterans
Pendlebury, G. A., Oro, P., Haynes, W., Byrnes, T. R., Keane, J., Goldstein, L.
Cureus, 2022/05
Free full text

705

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text


707

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05

708


709

Parental leave in medical school: supporting students as parents
Ortega, S. R., Barnes, J. M., Waller, J. D.
Journal of Osteopathic Medicine, 2022/05
Free full text




713

An updated brief overview on post-traumatic headache and a systematic review of the non-pharmacological interventions for its management
Argyriou, A. A., Mitsikostas, D. D., Mantovani, E., Litsardopoulos, P., Panagiotopoulos, V., Tamburin, S.
Expert Review of Neurotherapeutics, 2022/04
Free full text

714

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text

715

Manual Therapy Intervention in Men With Chronic Pelvic Pain Syndrome or Chronic Prostatitis: An Exploratory Prospective Case-Series
Rabal Conesa, C., Cao Avellaneda, E., López Cubillana, P., Prieto Merino, D., Khalus Plish, A., Martínez Franco, A., López Abad, A.
Cureus, 2022/04
Free full text

716

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text



719

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text

720

Improving practice patterns in patients with newly diagnosed bladder masses treated with transurethral resection
Wilson, J., Drach, D., Zanghi, J., Siegert, J.
Journal of Osteopathic Medicine, 2022/04
Free full text


722

Clinical evaluation and management of calcific tendinopathy: an evidence-based review
Catapano, M., Robinson, D. M., Schowalter, S., McInnis, K. C.
Journal of Osteopathic Medicine, 2022/04
Free full text

723

A Content Analysis of Osteopaths' Attitudes for a More Inclusive Clinical Practice towards Transgender People
Baldin, I., Esteves, J. E., Tramontano, M., Macdonald, M., Baroni, F., Lunghi, C.
Healthcare, 2022/03
Free full text

724

Efectos de la osteopatía en pacientes con fibromialgia
(Effects of osteopathy on patients with fibromyalgia)
Hormigo Navarro, R.
European Journal Osteopathy & Related Clinical Research, 2022/03
Free full text






730

Effectiveness of manual therapy in the treatment of cervicogenic headache: A systematic review
Núñez-Cabaleiro, P., Leirós-Rodríguez, R.
Headache, 2022/03
Free full text


732

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text

733

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text

734

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

735

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text

736

Efficacy and Feasibility of an Osteopathic Intervention for Neurocognitive and Behavioral Symptoms Usually Associated With Fetal Alcohol Spectrum Disorder
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., García-Algar, Ó.
Frontiers in Behavioral Neuroscience, 2022/03
Free full text

737

A Concordance Study of COMLEX-USA and USMLE Scores
Barnum, S., Craig, B., Wang, X., Sandella, J., Tsai, T.H., Boulet, J., Wang, Y.
Journal of Graduate Medical Education, 2022/03
Free full text


739

In bestimmter Weise auf jemanden wirken …
(To affect someone in a certain way...)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03


741

Weibliche Anatomie: Die Harnblase
Female Anatomy: The Urinary Bladder
Bazin, O., Naudin, M.
Osteopathische Medizin, 2022/03



744



746

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text

747

The rationale for including osteopathic manipulative treatment in the management of infections: a hermeneutic review
Lesho, E., McKeown, A., Laguio-Vila, M.
Expert Review of Anti-Infective Therapy, 2022/01
Free full text

748

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text



751

A novel movement system screen for primary care providers: a multisite, observational study
Kettle, C., McKay, L., Cianciolo, A. M., Kareha, S. M., Ruggeri, C. E.
Journal of Osteopathic Medicine, 2022/01
Free full text

752

Teilleistungsstörung bei visueller Wahrnehmungsstörung
(Partial performance disorder in visual perception disorder)
Engemann, K., Preiss-Leger, B.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01

753

Significant cognitive impairment likely associated with COVID-19 infection with relatively nonsevere symptoms
Reeves, R. R., Willoughby, S. G.
Journal of Osteopathic Medicine, 2022/01
Free full text

754

Comparing the effects of muscle energy technique and mulligan mobilization with movements on pain, range of motion, and disability in adhesive capsulitis
Razzaq, A., Nadeem, R. D., Akhtar, M., Ghazanfar, M., Aslam, N., Nawaz, S.
Journal of the Pakistan Medical Association, 2022/01
Free full text


756

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05


758

Erratum to “The legacy and implications of the body-mind-spirit osteopathic tenet: A discussion paper evaluating its clinical relevance in contemporary osteopathic care” [Int J Osteopath Med 41 (2021) 57–65]
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/12
Free full text











769

Perceptions of COVID-19 vaccines among osteopathic medical students (OMS)
Al Janabi, T., Chinsky, R., Pino, M. A.
International Journal of Osteopathic Medicine, 2021/12
Free full text

770

Osteopathic ableism: A critical disability view of traditional osteopathic theory in modern practice
MacMillan, A.
International Journal of Osteopathic Medicine, 2021/12


772

Therapeutic Effects of Lymphatic Pump Treatment on Lymphangiogenesis and Inflammatory Cytokines in Lymph Nodes of Rats with Adjuvant-Induced Arthritis
Blucher, K. M., Jain, S., Weber, D., Gober, C., Zanotti, B., Incrocci, R., Del Toro, R., Swanson-Mungerson, M., Volin, V. V.
Journal of Osteopathic Medicine, 2021/12

773

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

774

Effect of Self-Performed Osteopathic Manipulative Treatment (suboccipital release) on Heart Rate Recovery: A Pilot Study
Loquist, D. C., Wong, T., Warner, M., Cannumay, S., Singh, G., Nazarian, D., Saukhla, N., Hovsepian, T.
Journal of Osteopathic Medicine, 2021/12

775

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text


777

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text


779

Construct validity and reliability of tests for sacroiliac dysfunction: standing flexion test (STFT) and sitting flexion test (SIFT)
Ribeiro, R. P., Guerrero, F. G., Camargo, E. N., Pivotto, L. R., Aimi, M. A., Loss, J. F., Candotti, C. T.
Journal of Osteopathic Medicine, 2021/11
Free full text

780

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text

781

AOA ophthalmology and otolaryngology program closures as a model to highlight challenges of maintaining GME in high need areas
Ahmed, H., Vo, K., Robbins, W.
Journal of Osteopathic Medicine, 2021/11
Free full text



784

An osteopathic approach to occipital neuralgia and tinnitus
Aiman, A., Skaug, J., Fleming, R. K.
Osteopathic Family Physician, 2021/11






790

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text

791

Evaluating for a correlation between osteopathic examination and ultrasonography on thoracic spine asymmetry
Chang, S., Maddox, J., Berg, E., Kim, K., Messier, S., Swanson, L., Dobrusin, R., Stein, A. B., Nakken, G. N., Noble, J., Nydam, R.
Journal of Osteopathic Medicine, 2021/10
Free full text








799

Osteopathy in Germany: attitudes, beliefs and handling among general practitioners - results of a nationwide cross-sectional questionnaire survey
Schmid, G. L., Kluge, J., Deutsch, T., Geier, A. K., Bleckwenn, M., Unverzagt, S., Frese, T.
BMC Family Practice, 2021/10
Free full text


801

W(h)ither osteopathy: A call for reflection; a call for submissions for a special issue
Vogel, S.
International Journal of Osteopathic Medicine, 2021/09



804

Exploring Race and Ethnicity Representational Inequities in Illinois Medical Schools
Francone, N. O., Simon, M. A., Ortega, P.
Health Equity, 2021/09
Free full text

805

Osteopaths’ Perspectives on Patient Adherence to Self-Management Strategies: A Qualitative Content Analysis
Tripodi, N., Krajina, T., Lea, N., Giudice, H., Eskaf, S., Ojea, M., D&rsquo, Souza, T., McLeod, G., Feehan, J.
International Journal of Osteopathic Medicine, 2021/09

806

The Challenges of Implementing a Joint Interprofessional Education Program Between a Pharmacy College and an Osteopathic Medical College: A Case Study
Huggins, C., Basu, P., Senhaji-Tomza, B., Warwick, S., Anthony, M. E.
International Journal of Osteopathic Medicine, 2021/09

807

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09

808

Digital health technologies for osteopaths and allied healthcare service providers: A scoping review
Mastronardo, C., Muddle, L. S., Grace, S., Engel, R. M., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2021/09

809

The legacy and implications of the body-mind-spirit osteopathic tenet: a discussion paper evaluating its clinical relevance in contemporary osteopathic care
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/09


811

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text


813

Embracing industry sponsored research to expand osteopathic medical student research experiences
Morehouse, Z. P., Nash, R. J.
Journal of Osteopathic Medicine, 2021/09
Free full text



816

Meaning Construction for Biodynamic Osteopathy Terms in Translation Practice
Kalinina, I.
Taikomoji Kalbotyra, 2021/09
Free full text






822

Resident opinions of diabetes management in training: a survey
Healy, A. M., Uhrig, J. L., Shubrook, J. H., Aung, N. L., Sadhu, A. R.
Journal of Osteopathic Medicine, 2021/09
Free full text



825




828

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text




832

Nachruf auf James Jealous
(James Jealous obituary)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07

833

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07

834

Muscle Energy Technique in the Rehabilitative Treatment for Acute and Chronic Non-Specific Neck Pain: A Systematic Review
Sbardella, S., La Russa, C., Bernetti, A., Mangone, M., Guarnera, A., Pezzi, L., Paoloni, M., Agostini, F., Santilli, V., Saggini, R., Paolucci, T.
Healthcare, 2021/07
Free full text


836

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text






842

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text

843

Effect of mulligan’s mobilization with movement and post isometric relaxation technique on pain, range of motion and functional outcome in subjects with adhesive capsulitis
Nithya, N., Sathish Prabu, S. R., Arun, B., Abraham, M. M.
Indian Journal of Public Health Research and Development, 2021/06
Free full text


845

Non-surgical management and return to play of an anterior cruciate ligament rupture: A case report
Bibby, L., Tripodi, N.
International Journal of Osteopathic Medicine, 2021/06

846

‘Don’t focus on the finger, look at the moon’ - The importance of contextual factors for clinical practice and research
Thomson, O. P., Rossettini, G.
International Journal of Osteopathic Medicine, 2021/06
Free full text

847

Osteopathy: Italian professional profile. A professional commentary by a group of experts of the European community of practice
Cerritelli, F., Lunghi, C., Esteves, J. E., Vaucher, P., van Dun, P. L. S., Alvarez, G., Biberschick, M., Wagner, A., Merdy, O., Menard, M., Tavernier, P., Clouzeau, C., Risch, A., Ruffini, Nuria, Nunes, A., Santiago, R., Marett, P., Grech, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06

848

Inclusivity and accessibility in undergraduate osteopathic education for students with disability: A scoping review
MacMillan, A., Corser, A., Clark, Z.
International Journal of Osteopathic Medicine, 2021/06



851

Establishing osteopathic assessments to fulfill osteopathic recognition standards: a model for dermatology and other subspecialties
Mahlberg, S. J., Liou, Y. L., Lloyd, J.
Journal of Osteopathic Medicine, 2021/06
Free full text



854

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06

855

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text

856

Current state of nutrition and nutritional supplement training in medical schools
Lowther, D. P.
Unpublished PhD thesis, 2021/05
Free full text

857

Effects of CranioSacral Therapy upon Symptoms of Post-Acute Concussion and Post-Concussion Syndrome: A Pilot Study
Kratz, S. V., Kratz, D. J.
Journal of Bodywork and Movement Therapies, 2021/05

858

Examining concurrent validity between COMLEX-USA Level 2-Cognitive Evaluation and COMLEX-USA Level 2-Performance Evaluation
Craig, B., Wang, X., Sandella, J., Tsai, T. H., Kuo, D., Finch, C.
Journal of Osteopathic Medicine, 2021/05
Free full text

859

Effect of integrated neuromuscular inhibition technique compared with positional release technique in the management of piriformis syndrome
Danazumi, M. S., Yakasai, A. M., Ibrahim, A. A., Shehu, U. T., Ibrahim, S. U.
Journal of Osteopathic Medicine, 2021/05
Free full text

860

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

861

Gnathological and osteopathic treatments with digital evaluations before and after therapies: a case report of a patient with ehlers-danlos syndrome
Di Giacomo, P., Cerignoli, E., D'Ermes, V., Ferrato, G., Polimeni, A., Di Paolo, C.
La Clinica Terapeutica, 2021/05
Free full text


863

Direct and mediated effects of treatment context on low back pain outcome: a prospective cohort study
Bishop, F., Al-Abbadey, M., Roberts, L., MacPherson, H., Stuart, B., Carnes, D., Fawkes, C., Yardley, L., Bradbury, K.
BMJ Open, 2021/05
Free full text


865

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text



868

Effects of Osteopathic T9-T10 Vertebral Manipulation in Tonsillitis: A Randomized Clinical Trial
Luceño-Mardones, A., Luceño-Rodríguez, I., Rodríguez-López, E. S., Oliva-Pascual-Vaca, J., Rosety, I., Oliva-Pascual-Vaca, Á
Healthcare, 2021/04
Free full text

869

The effect of visceral manipulation on Diastasis Recti Abdominis (DRA): A case series
Kirk, B., Elliott-Burke, T.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text


871

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text

872

Osteopathic manipulative medicine in the management of headaches associated with postconcussion syndrome
Esterov, D., Thomas, A., Weiss, K.
Journal of Osteopathic Medicine, 2021/04
Free full text



875

The role of extracurricular activities and lectures in mitigating medical student burnout
Sepede, J. C., Petrides, J., Collins, P. B., Jones, M. C., Cantor, N., Boyd, L.
Journal of Osteopathic Medicine, 2021/04
Free full text


877

Osteopathic medicine for fibromyalgia: a sham-controlled randomized clinical trial
Coste, J., Medkour, T., Maigne, J., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/04
Free full text


879

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04



882

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text


884

Opposing vaccine hesitancy during the COVID-19 pandemic - A critical commentary and united statement of an international osteopathic research community
Thomson, O. P., MacMillan, A., Draper-Rodi, J., Vaucher, P., Ménard, M., Vaughan, B., Morin, C., Alvarez, G., Sampath, K. K., Cerritelli, F., Shaw, R., Cymet, T. C., Bright, P., Hohenschurz-Schmidt, D., Vogel, S.
International Journal of Osteopathic Medicine, 2021/03
Free full text




888

Actions Speak Louder Than Words: Exploring Pragmatism in Osteopathy
Macfarlane, C.
Unpublished PhD thesis, 2021/03
Free full text

889



891

Moderate to Substantial Inter-Rater Reliability in the Assessment of Cranial Bone Mobility Restrictions
Demers, K., Morin, C., Collette, L., DeMont, R.
The Journal of Alternative and Complementary Medicine, 2021/03

892

The validity of lumbo-pelvic landmark palpation by manual practitioners: a systematic review
Alexander, N., Rastelli, A., Webb, T., Rajendran, D.
International Journal of Osteopathic Medicine, 2021/03

893

Healthier together: a pilot study on the implementation of a novel family centered pediatric obesity prevention program
Bach, M., Shenoi, S., Winger, K., Hendriksz, T.
Journal of Osteopathic Medicine, 2021/03
Free full text

894

Teaching and use of cervical high-velocity, low-amplitude manipulation at colleges of osteopathic medicine
Hu, A., Motyka, T., Gish, E., Dogbey, G.
Journal of Osteopathic Medicine, 2021/03
Free full text

895

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03

896

Manual treatment for kidney mobility and symptoms in women with nonspecific low back pain and urinary infections
Lo Basso, F., Pilzer, A., Ferrero, G., Fiz, F., Fabbro, E., Oliva, D., Cazzarolli, C., Turrina, A.
Journal of Osteopathic Medicine, 2021/03
Free full text

897

The use of 3D printing for osteopathic medical education of rib disorders
Moriles, K., Ramnot, A., Lai, M., Jacobs, R. J., Qureshi, Y.
Journal of Osteopathic Medicine, 2021/03
Free full text

898

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03

899

Predictors of research self efficacy in first-year osteopathic medical students
Jacobs, R. J., Kane, M. N.
International Journal of Osteopathic Medicine, 2021/03


901

Radiation oncology education and experience in the undergraduate medical setting
Odiase, O. M., Huang, D., Sura, K. T.
Medical Education Online, 2021/03
Free full text

902

Objectivation of an Educational Model in Cranial Osteopathy Based on Experience
Requena-García, J., García-Nieto, E., Varillas-Delgado, D.
Medicina (Kaunas), 2021/03

903

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text



906

Thomas L. Northup Lecture: Accepting the Death of Osteopathy: A New Beginning
Jealous, J. S.
The AAO Journal, 2021/03
Free full text


908

Diversity in osteopathic medical school admissions and the COMPASS program
Dady, N., Mungroo, K. A., Young, T., Akinsanya, J., Forstein, D.
Journal of Osteopathic Medicine, 2021/02
Free full text

909

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text

910

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text

911

Effect of occipitoatlantal decompression on cerebral blood flow dynamics as evaluated by Doppler ultrasonography
Roberts, B., Makar, A. E., Canaan, R., Pazdernik, V., Kondrashova, T.
Journal of Osteopathic Medicine, 2021/02
Free full text

912

Supportive care and osteopathic medicine in pediatric oncology: perspectives of current oncology clinicians, caregivers, and patients
Belsky, J. A., Stanek, J., Skeens, M. A., Gerhardt, C. A., Rose, M. J.
Supportive Care in Cancer, 2021/02
Free full text

913

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text








921


922

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01

923

Impact of an osteopathic presence in a large categorical pediatric residency training program
Barnhardt, E. W., Comer, F., Zmuda, E., Rakowsky, A.
Journal of Osteopathic Medicine, 2021/01
Free full text

924

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text


926

Perceptions of the Osteopathic Profession in New York City's Korean Communities
Justin Chin, D. O., Haeinn Woo, Oms-Iv, Diane Choi, O. M. S., III, Emily Dube, M. S., Mikhail Volokitin, Md Do, Christine Lomiguen
Osteopathic Family Physician, 2021/01
Free full text

927



929

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text

930

Knowledge of Nutritional Issues among Osteopaths in Austria: A Cross-Sectional Study
Putschögl, J., Woisetschläger, G.
European Journal of Osteopathic Research, 2020/12
Free full text

931

The Use of Osteopathic Manipulative Medicine in the Management of Recurrent Mastitis
Jackson, C., Loveless, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

932

Mobitz Type II Atrioventricular Heart Block After Candlenut Ingestion
Koons, A. L., Laubach, L. T., Katz, K. D., Beauchamp, G. A.
The Journal of the American Osteopathic Association, 2020/12
Free full text

933

Brain Connectivity Changes after Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tramontano, M., Cerritelli, F., Piras, F., Spanò, B., Tamburella, F., Piras, F., Caltagirone, C., Gili, T.
Brain Sciences, 2020/12
Free full text

934

Remdesivir for the Treatment of Severe COVID-19: A Community Hospital's Experience
Lee, S., Santarelli, A., Caine, K., Schritter, S., Dietrich, T., Ashurst, J.
The Journal of the American Osteopathic Association, 2020/12
Free full text

935

A piece of the puzzle: Response to Esteves et al
Kovanur Sampath, K., Fairs, E.
International Journal of Osteopathic Medicine, 2020/12


937

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12

938

The Effect of Facial Effleurage on Serum Complement C3 During Acute Rhinosinusitis: A Randomized, Controlled Study
Burke, K. S., Weidman, C., Bradley, J. H.
The Journal of the American Osteopathic Association, 2020/12

939

Burn-out in Osteopathic Medical Students: The Effects of Meditation Before and After the Arrival of the COVID-19 Pandemic
Krishnamachari, B., Morris, A., Chinsky, R., Pendyala, R., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2020/12

940

The Efficacy of Facial Effleurage, a Lymphatic Pump Technique, on Immune Response and Symptoms in Acute Rhinosinusitis: A Randomized, Controlled Study
Weidman, C., Boyd, M., Pepper, E., Hsieh, K., Kunda, D. T., Burke, K. S., Carrasco, M., Escamilla, O., Cheng, N., Bradley, J. H.
The Journal of the American Osteopathic Association, 2020/12



943

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12

944

The Effect of Osteopathic Manipulative Treatment on Lower Limb Muscle Rigidity in a Parkinson's Patient
Vemuri, A., Xu, E., Downing, M., Widboom, N.
Southern Medical Journal, 2020/12


946

Kikuchi-Fujimoto Disease Heralding Systemic Lupus Erythematosus
Aun, J. A., Hubbard, M. J.
The Journal of the American Osteopathic Association, 2020/12
Free full text




950

Acute Suppurative Thyroiditis
Desai, P., Mbachi, C., Singh, A.
The Journal of the American Osteopathic Association, 2020/11
Free full text

951

[PREPRINT] “Somebody Who Does Something Other Than Osteopathy“
Sajjadi, N. B., Shepard, S.
The Journal of the American Osteopathic Association, 2020/11
Free full text

952

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text

953

The Battle Between Politics and Science Is Costing Us a Timely Victory Over the COVID-19 Pandemic
Hahn, M. B.
The Journal of the American Osteopathic Association, 2020/11
Free full text

954

Associations Between Social Support and Diabetes-Related Distress in People With Type 2 Diabetes Mellitus
Young, C. F., Shubrook, J. H., Valencerina, E., Wong, S., Henry Lo, S. N., Dugan, J. A.
The Journal of the American Osteopathic Association, 2020/11
Free full text

955

Status of Entrustable Professional Activities (EPA) Implementation at Colleges of Osteopathic Medicine in the United States and Future Considerations
Linsenmeyer, M., Wimsatt, L., Speicher, M., Basehore, P., Sexton, P. S.
The Journal of the American Osteopathic Association, 2020/11



958

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text

959


960




963

Postoperative peritoneale Adhäsionen
(Postoperative peritoneal adhäsionen)
Liedler, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10

964

QTc Interval Prolongation Associated With Inpatient Azithromycin Therapy for Pneumonia
Cruz, M. D., Ershad, M., Mostafa, A.
The Journal of the American Osteopathic Association, 2020/10
Free full text


966

“I do it my way” - Italian osteopaths’ beliefs and attitudes about five osteopathic models: A qualitative study
Bettelli, L., Pisa, V., Formica, A.
International Journal of Osteopathic Medicine, 2020/10

967

Musculoskeletal Conditions in Patients With Diabetes: A Narrative Review
Shafer, D., Gooing, J., Lee, V., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text

968

Osteopathic Manipulative Treatment in Individuals With Vertigo and Somatic Dysfunction: A Randomized, Controlled, Comparative Feasibility Study
Fraix, M., Badran, S., Graham, V., Redman-Bentley, D., Hurwitz, E. L., Quan, V. L., Yim, M., Hudson-McKinney, M., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text


970

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text

971

New investigator editorial: the osteopathic medical student perspective on research
Persand, D., Maddie, N.
American Journal of Physiology. Heart and Circulatory Physiology, 2020/10
Free full text


973

Sample size, study length and inadequate controls were the most common self-acknowledged limitations in manual therapy trials: A methodological review
Alvarez, G., Núñez-Cortés, R., Solà, I., Sitjà-Rabert, M., Fort-Vanmeerhaeghe, A., Fernández, C., Bonfill, X., Urrutia, G.
Journal of Clinical Epidemiology, 2020/10

974

Attitudes, skills, and use of evidence-based practice: a cross-sectional survey of Swedish osteopaths
Leach, M. J., Shaw, R., Austin, P., Fryer, G., Thomson, O. P., Adams, J., Skillgate, E., Sundberg, T.
International Journal of Osteopathic Medicine, 2020/10


976

Dysphagia Lusoria
Andersen, K., Hoff, R., Silas, D.
The Journal of the American Osteopathic Association, 2020/10
Free full text

977

The Role of Musculoskeletal Disorders in Chronic Disease: A Narrative Review
Asahi, M. G., Briganti, D., Cam, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text

978

Osteopathic Manipulative Treatments for Pediatric Conditions
Raines, S. G. M., Ramey, A. L.
Osteopathic Family Physician, 2020/10
Free full text

979

Gonococcal Arthritis
Mills, K., Jadav, P.
The Journal of the American Osteopathic Association, 2020/10
Free full text




983

A guide to writing a case report of an osteopathic patient
Vaughan, B., Fleischmann, M.
International Journal of Osteopathic Medicine, 2020/09

984

Continuing debates about models of practice
Vogel, S.
International Journal of Osteopathic Medicine, 2020/09

985

Biomedical origins of the term 'osteopathic lesion' and its impact on people in pain
Noy, M., Macedo, L., Carlesso, L.
International Journal of Osteopathic Medicine, 2020/09


987

What Makes an Osteopathic Treatment Effective From a Patient's Perspective: A Descriptive Phenomenological Study
Consorti, G., Marchetti, A., De Marinis, M. G.
Journal of Manipulative and Physiological Therapeutics, 2020/09



990




993

Finding a way between osteopathic principles and evidence-based practices: Response to Esteves et al
Ménard, M., Draper-Rodi, J., Merdy, O., Wagner, A., Tavernier, P., Jacquot, E., Mhadhbi, H.
International Journal of Osteopathic Medicine, 2020/09



996

Osteopathie für Neugeborene in der Klinik?: Eine qualitative Studie
Osteopathy for newborns in hospitals?: A qualitative study
Brintrup, V., Hartmann, M., Herrmann, H., Belz, S., Esch, S.
Osteopathische Medizin, 2020/09

997

Response to: Models and theoretical frameworks for osteopathic care - A critical view and call for updates and research
Santiago, R., Campos, B., Moita, J., Nunes, A. C. L.
International Journal of Osteopathic Medicine, 2020/09

998



1000

Recognizing Postoperative Nutritional Complications of Bariatric Surgery in the Primary Care Patient: A Narrative Review
Chamberlain, C., Terry, R., Shtayyeh, T., Martinez, C.
The Journal of the American Osteopathic Association, 2020/09
Free full text


1002

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1003

Trichoepithelioma
Skorin, L., Bauer, S. A.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1004

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1005

Treatment Modalities for Notalgia Paresthetica Including OMT
Cooley, D., McAree, M., Joshi, N., Peerzada, W.
Osteopathic Family Physician, 2020/08
Free full text

1006

Time-Restricted Feeding and Potential for Type 2 Diabetes Mellitus: A Narrative Review
Lustig, E., Shubrook, J. H., Pfotenhauer, K. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

1007

Clinical Efficacy of Mesenteric Lift to Relieve Constipation in Traumatic Brain Injury Patients
Berry, J. A. D., Ogunlade, J., Kashyap, S., Berry, D. K., Wacker, M., Miulli, D. E., Saini, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text


1009

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07

1010

Evaluating Financial Conflicts of Interest Among Contributors to Clinical Practice Guidelines of the American College of Obstetricians and Gynecologists
Wright, M. R., Frye, L., Vo Solis, L., Checketts, J. X., Guevara, C., Smith, L., Vassar, M.
The Journal of the American Osteopathic Association, 2020/07
Free full text


1012

Novel Dual-Fluorescent Mitophagy Reporter Reveals a Reduced Mitophagy Flux in Type 1 Diabetic Mouse Heart
Kobayashi, S., Patel, J., Zhao, F., Huang, Y., Kobayashi, T., Liang, Q.
The Journal of the American Osteopathic Association, 2020/07
Free full text

1013

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06

1014

(Corporeality of the heart)
Kozljanič, R. J., Scheuchl, F., Rösing, S.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06

1015

Challenging times
Vogel, S., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2020/06



1018

Empathy in Medicine Self and Other in Medical Education: Initial Emotional Intelligence Trend Analysis Widens the Lens Around Empathy and Burnout
Singer-Chang, G., Dong, F., Seffinger, M., Nevins, N., Blumer, J., Musharbash, H., Helf, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

1019

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06

1020

Implied Evidence of the Functional Role of the Rectus Capitis Posterior Muscles
Hallgren, R. C., Rowan, J. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text

1021

Pain knowledge, attitudes and beliefs of Australian osteopaths drawn from a nationally representative sample of the profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Austin, P.
Journal of Bodywork and Movement Therapies, 2020/06

1022

Professional identity in the evolution of osteopathic models: Response to Esteves et al
Alvarez, G., Van Biesen, T., Roura, S.
International Journal of Osteopathic Medicine, 2020/06



1025

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text

1026

Inter-examiner agreement of musculoskeletal and visceral tests to assess the pelvic region in women with stress urinary incontinence
Arcanjo, G. N., Mendes, M. R., Cavalcante, A., Lima, . O., Vilaça-Alves, J., Rocha, M.
Motricidade, 2020/06
Free full text

1027

The Role of Sphenobasilar Synchondrosis in Disease and Health
Liem, T.
The Journal of the American Osteopathic Association, 2020/06
Free full text

1028

PROMIS® General Life Satisfaction scale: construct validity in musculoskeletal pain patients
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/06
Free full text





1033

Graves Orbitopathy
Natali, S., Shogan, P.
The Journal of the American Osteopathic Association, 2020/06
Free full text



1036



1038

Beliefs about chronic low back pain amongst osteopaths registered in Spain: A cross-sectional survey
Van Biesen, T., Alvarez, G.
International Journal of Osteopathic Medicine, 2020/06


1040

Antithrombotic Therapy for Patients With Atrial Fibrillation and Acute Coronary Syndrome or Percutaneous Coronary Intervention
Tseng, A. S., Shamoun, F. E., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/05
Free full text

1041

Does the Halo Effect for Level 1 Trauma Centers Apply to High-Acuity Nonsurgical Admissions?
Hwalek, A. E., Kothari, A. N., Wood, E. H., Blanco, B. A., Brown, M., Plackett, T. P., Kuo, P. C., Posluszny, J.
The Journal of the American Osteopathic Association, 2020/05
Free full text


1043

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text



1046

Medizinischer Notfall in der Praxis: Ich packe meinen Koffer …
(Medical emergency in the practice: I pack my suitcase ...)
Merkt, P., Grasmück, J., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04



1049

Perceptions of the nurse practitioner in the hosptial setting
Cunningham, M. R.
Unpublished Dissertation, 2020/04
Free full text




1053

Helping Students Navigate the Single Graduate Medical Education Accreditation System
Díaz, S. R., Baker, S. D., Medio, F. J.
The Journal of the American Osteopathic Association, 2020/04
Free full text

1054

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text

1055

More Information on Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/04
Free full text

1056

Osteopathic Primary Care Treatment Options for Ulcerative Colitis
Fernandez, A., Januchowski, R.
Osteopathic Family Physician, 2020/04
Free full text

1057

Urticaria: Diagnosis and Treatment with Osteopathic Considerations
Stacey, S.., Burke, D., Brininger, T.
Osteopathic Family Physician, 2020/04
Free full text

1058

Inhibitory Tests as Assessment Tools for Somatic Dysfunctions: Mechanisms and Practical Applications
Bicalho, E., Vieira, L., Makita, D. K., Rivas, L.
Cureus, 2020/04
Free full text

1059




1062

Chronically Exposed Knee Hardware
Dobracki, A.
The Journal of the American Osteopathic Association, 2020/03
Free full text

1063

‘Tell me your story’ - How osteopaths apply the BPS model when managing low back pain - A qualitative study
Abrosimoff, M., Rajendran, D.
International Journal of Osteopathic Medicine, 2020/03

1064

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text

1065

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text

1066

CATALYST: Piloting a Longitudinal Assessment and Learning Program for Board Recertification and Continuous Professional Development
Horber, D. T., Flamini, J., Gimpel, J. R., Tsai, T. E., Shrum, K., Hudson, K.
The Journal of the American Osteopathic Association, 2020/03
Free full text

1067

Characteristics and Treatment of Pediatric Patients in an Osteopathic Manipulative Medicine Clinic
Kaiser, G., Degenhardt, B. F., Michael Menke, J., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/03
Free full text

1068

Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research
Esteves, J. E., Zegarra-Parodi, R., van Dun, P., Cerritelli, F., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/03
Free full text

1069

Life satisfaction and musculoskeletal complaints in a population seeking osteopathy care: consecutive sample of 611 patients
Vaughan, B., Mulcahy, J., Allen, T., Coupe, E., Gobbo, D., Nasser, L., Pain, K., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/03

1070

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text

1071

Combining psychotherapy with craniosacral therapy for severe traumatized patients: A qualitative study from an outpatient clinic in Norway
Stub, T., Kiil, M., Lie, B., Kristoffersen, A., Weiss, T., Hervik, J., Musial, F.
Complementary Therapies in Medicine, 2020/03






1077

Effect of manual approaches with osteopathic modality on brain correlates of interoception: an fMRI study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Perrucci, M. G., Barassi, G., Visciano, C., Bellomo, R. G., Saggini, R., Ferretti, A.
Scientific Reports, 2020/02
Free full text

1078

Osteopathic Medical Care With and Without Osteopathic Manipulative Treatment in Patients With Chronic Low Back Pain: A Pain Registry-Based Study
Licciardone, J. C., Gatchel, R. J.
The Journal of the American Osteopathic Association, 2020/02
Free full text

1079

Evidence and recommendations for the use of segmental motion testing for patients with LBP – A systematic review
Stolz, M., von Piekartz, H., Hall, T., Schindler, A., Ballenberger, N.
Musculoskeletal Science and Practice, 2020/02
Free full text

1080

Stretching exercises combined with ischemic compression in pectoralis minor muscle with latent trigger points: A single-blind, randomized, controlled pilot trial
Birinci, T., Mustafaoglu, R., Kaya Mutlu, E., Razak Ozdincler, A.
Complementary Therapies in Clinical Practice, 2020/02
Free full text


1082

The Many Facets of Hypermobile Ehlers-Danlos Syndrome
Riley, B.
The Journal of the American Osteopathic Association, 2020/01
Free full text

1083

Perceptions of the osteopathic profession in New York City’s Chinese Communities
Chin, J., Li, S., Yim, G., Zhou, Y. Q., Wan, P., Dube, E., Volokitin, M., Sahni, S., Terrell, M., Lomiguen, C.
Family Medicine and Community Health, 2020/01
Free full text

1084

Food Sensitivity Testing and Elimination Diets in the Management of Irritable Bowel Syndrome
Smith, E., Foxx-Orenstein, A., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/01
Free full text

1085

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text


1087

The labor study: Labor length and birth outcomes osteopathic research
Martingano, D., Mitrofanova, A., Kim, A. F., Ulfers, A., Mersch, M., Stevenson, R., Singh, S.
American Journal of Obstetrics & Gynecology, 2020/01

1088

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01

1089

A methodological review revealed that reporting of trials in manual therapy has not improved over time
Alvarez, G., Sola, I., Sitja-Rabert, M., Fort-Vanmeerhaeghe, A., Gich, I., Fernandez, C., Bonfill, X., Urrutia, G.
Journal of Clinical Epidemiology, 2020/01

1090

Tratamento manipulativo osteopático em Unidade de Terapia Intensiva Neonatal / Osteopathic manipulative treatment in a neonatal intensive care unit
(Osteopathic manipulative treatment in a neonatal intensive care unit)
dos Santos Varela, A. P. A., Yasojima, E. Y., Gonçalves, H. M. T., Silvestre, L. C., Tannus, L. O.
Brazilian Journals Publicações de Periódicos e Editora Ltda, 2020/01

1091

It is time to move beyond ‘body region silos’ to manage musculoskeletal pain: five actions to change clinical practice
Caneiro, J. P., Roos, E. M., Barton, C. J., Sullivan, K., Kent, P., Lin, I., Choong, P., Crossley, K. M., Hartvigsen, J., Smith, A. J., Sullivan, P.
British Journal of Sports Medicine, 2020/01


1093

Determinants of health, health behaviours and demographic profile of patients attending an Australian university student-led osteopathy clinic
Vaughan, B., Fitzgerald, K., Fleischmann, M., Mulcahy, J.
Chiropractic & Manual Therapies, 2020/01
Free full text

1094

Isometric osteopathic manipulation influences on cervical ranges of motion and correlation with osteopathic palpatory diagnosis: A randomized trial
Niewiadomski, C., Bianco, R. J., Arnoux, P. J., Evin, M.
Complementary Therapies in Medicine, 2020/01

1095

Fitz-Hugh-Curtis Syndrome
Mersch, M., Martingano, D.
The Journal of the American Osteopathic Association, 2020/01
Free full text

1096

Lateral Strain Patterns at the Sphenobasilar Synchondrosis
Burruano, M. P.
The Journal of the American Osteopathic Association, 2020/01
Free full text

1097

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020


1099

Efficacy of Muscle Energy Technique as an adjunct with Mulligans Mobilization in adhesive Capsulitis of Shoulder
Jaiswal, N., Saketa, J., Rajsekhar, H.
International Journal of Physiotherapy, 2019/2
Free full text

1100

Efficacy of spinal extension exercise program versus muscle energy technique in treatment of chronic mechanical low back pain
Fahmy, E., Shaker, H., Ragab, W., Helmy, H., Gaber, M.
Egyptian Journal of Neurology, Psychiatry and Neurosurgery, 2019/12
Free full text

1101

Influence of Future Prescribers’ Personal and Clinical Experiences With Opioids on Plans to Treat Patients With Opioid Use Disorder
Mort, S. C., Díaz, S. R., Miller, C., Bowlby, M., Henderson, D., Beverly, E. A.
The Journal of the American Osteopathic Association, 2019/12
Free full text

1102



1104

Forschungsinstitute
(Research institutes in Germany)
Newiger, C., Eichhorn, V.
Osteopathische Medizin, 2019/12


1106

Self-directed learning and practice of Italian osteopathic students during summer break: a cross-sectional survey
D'Alessandro, G., Consorti, G., Cerritelli, F.
BMC Complementary and Alternative Medicine, 2019/12
Free full text


1108

Craniosacral therapy for chronic pain: a systematic review and meta-analysis of randomized controlled trials
Haller, H., Lauche, R., Sundberg, T., Dobos, G., Cramer, H.
BMC Musculoskeletal Disorders, 2019/12
Free full text









1117

The Effect of Facial Effleurage on Acute Rhinosinusitis
Bradley, J. H., Weidman, C.
The Journal of the American Osteopathic Association, 2019/12



1120

Meditation and Empathy in Osteopathic Medical Students: A Longitudinal Randomized Controlled Trial
Krishnamachari, B., Ramya, P., Shermon, S., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2019/12

1121

Facial Effleurage Treatment Increases Serum TNFα Levels in Patients with Acute Rhinosinusitis
White, A., Weidman, C., Bradley, J. H.
The Journal of the American Osteopathic Association, 2019/12


1123

The Role of Mental Imagery in Osteopathic Palpation: a qualitative study
Kraml, M. M., Besse, J.P.
European Journal of Osteopathic Research, 2019/11
Free full text

1124

Effectiveness of the muscle energy technique on respiratory muscle strength and endurance in patients with fibromyalgia
Uysal, S. C., Tuzun, E. H., Eker, L., Angin, E.
Journal of Back and Musculoskeletal Rehabilitation, 2019/11
Free full text

1125

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11




1129

Visceral osteopathic manipulative treatment reduces patient reported digestive toxicities induced by adjuvant chemotherapy in breast cancer: A randomized controlled clinical study
Lagrange, A., Decoux, D., Briot, N., Hennequin, A., Coudert, B., Desmoulins, I., Bertaut, A.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2019/10


1131

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10

1132

A comprehensive physical therapy evaluation for Male Chronic Pelvic Pain Syndrome: A case series exploring common findings
Archambault-Ezenwa, L., Markowski, A., Barral, J-P.
Journal of Bodywork and Movement Therapies, 2019/10

1133

Medical Students' Knowledge About Children With Disabilities, Special Education Laws, and Social Services: A Preliminary Scale Development and Pilot Study
Vitalone-Raccaro, N., Sheppard, M. E., Kaari, J. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text


1135

Awareness of axial spondyloarthritis among chiropractors and osteopaths: findings from a UK Web-based survey
Yong, C. Y., Hamilton, J., Benepal, J., Griffiths, K., Clark, Z. E., Rush, A., Sengupta, R., Martindale, J., Gaffney, K.
Rheumatology Advances in Practice, 2019/10
Free full text


1137

Toward a Theory of the Mechanism of High-Velocity, Low-Amplitude Technique: A Literature Review
Hennenhoefer, K., Schmidt, D.
The Journal of the American Osteopathic Association, 2019/10
Free full text


1139

Developing teamwork skills in pre-registration osteopathy education: A qualitative pilot investigation
Vaughan, B., Grace, S., Yoxall, J.
International Journal of Osteopathic Medicine, 2019/09

1140

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09

1141

Osteopathic Approach for Lateral Knee Pain Caused by Iliotibial Band Friction Syndrome: A Case Report
Kostanjevec, J., Fleming, R. K.
The AAO Journal, 2019/09
Free full text


1143

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09

1144

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text

1145

Expanding options: Supporting skills transfer from a post-graduate osteopathy program to clinical practice
Macfarlane, C., Cornall, D.
International Journal of Osteopathic Medicine, 2019/09


1147

Using the Multitheory Model to Predict Initiation and Sustenance of Physical Activity Behavior Among Osteopathic Medical Students
Nahar, V. K., Wilkerson, A. H., Stephens, P. M., Kim, R. W., Sharma, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

1148

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

1149

Influence of Osteopathic Medical Students’ Personal Health on Attitudes Toward Counseling Obese Pediatric Patients
Whipps, J., Mort, S. C., Beverly, E. A., Guseman, E. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text

1150

Efficacy of osteopathic treatment in patients with stable moderate-to-severe chronic obstructive pulmonary disease: a randomized controlled pilot study
Buscemi, A., Pennisi, V., Rapisarda, A., Pennisi, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2019/08

1151

Understanding Myalgic Encephalomyelitis/Chronic Fatigue Syndrome and the Emerging Osteopathic Approach: A Narrative Review
Larrimore, C., Ramnot, A., Jaghab, A., Sarduy, S., Guerrero, G., Troccoli, P., Hilton, K., Bested, A.
The Journal of the American Osteopathic Association, 2019/07
Free full text

1152

Effect of muscle energy technique on pain pressure threshold in sacroiliac joint dysfunction
Srivastava, S., U., Dhanesh K. K., Mittal, H.
International Journal of Research in Pharmaceutical Sciences, 2019/07
Free full text




1156

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text


1158

Reflective practice enhances osteopathic clinical reasoning
McIntyre, C., Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2019/07








1166

Specific Adjusting Technique
(Specific Adjusting Technique)
Lamb, Gez, Schabel, Kai
Osteopathische Medizin, 2019/06

1167

Refining the biopsychosocial model for musculoskeletal practice by introducing religion and spirituality dimensions into the clinical scenario
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/06

1168

Correlation between otitis media with effusion and cranial deformation in children
Orlando, M. P., Bonanno, M. A., Russo, F. Y., Ralli, M., Turchetta, R., Passali, F. M., Minni, A., Greco, A., De Vincentiis, M., Tattoli, M.
European Review for Medical and Pharmacological Sciences, 2019/06
Free full text

1169

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06


1171

The inter-rater reliability of the mobility tests of the cranial bones as assessed through manual therapy
Demers, K., Morin, C., Collette, L., DeMont, M. R.
Advances in Integrative Medicine, 2019/06





1176

Effects of diaphragmatic myofascial release on gastroesophageal reflux disease: a preliminary randomized controlled trial
Martínez-Hurtado, I., Arguisuelas, M. D., Almela-Notari, P., Cortés, X., Barrasa-Shaw, A., Campos-González, J. C., Lisón, J. F.
Scientific Reports, 2019/05
Free full text




1180

The Impact of Spinal Manipulation on Migraine Pain and Disability: A Systematic Review and Meta-Analysis
Rist, P. M., Hernandez, A., Bernstein, C., Kowalski, M., Osypiuk, K., Vining, R., Long, C. R., Goertz, C., Song, R., Wayne, P. M.
Headache, 2019/04
Free full text

1181

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text


1183

Allopathic supervision of osteopathic education: What support is needed?
James, S. J., Zakletskaia, L:
Osteopathic Family Physician, 2019/04

1184

Timing of oral feeding changes in premature infants who underwent osteopathic manipulative treatment
Vismara, L., Manzotti, A., Tarantino, A. G., Bianchi, G., Nonis, A., La Rocca, S., Lombardi, E., Lista, G., Agosti, M.
Complementary Therapies in Medicine, 2019/04

1185

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04

1186

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text








1194

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text

1195

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text

1196

Mechanischer Risikofaktor für Otitis media?
(Mechanical risk factor in otitis media?)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
Free full text

1197

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03

1198

Magnetic Resonance Imaging Parameters Selected for Optimal Visualization of the Occipitoatlantal Interspace
Hallgren, R. C., Rowan, J. J.
The Journal of the American Osteopathic Association, 2019/03
Free full text


1200

Ist Asymmetrie Dysfunktion?
(Is asymmetry dysfunction?)
Robert, V.
Osteopathische Medizin, 2019/03



1203

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text

1204

Effects of myofascial release in erector spinae myoelectric activity and lumbar spine kinematics in non-specific chronic low back pain: Randomized controlled trial
Arguisuelas, M. D., Lison, J. F., Domenech-Fernandez, J., Martinez-Hurtado, I., Salvador Coloma, P., Sanchez-Zuriaga, D.
Clinical Biomechanics, 2019/03

1205

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text

1206

Effects of Practicing Osteopathic Manipulative Treatment (OMT) on Hand Function
Barnum, I. F. O., Chang, M. E., Patterson, R. M., Surve, S.
UNTHSC Scholarly Repository, 2019/03




1210

Im Gespräch mit … Noori Mitha
(In dialog with ... Noori Mitha)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

1211

Fascial manipulation vs. standard physical therapy practice for low back pain diagnoses: A pragmatic study
Harper, B., Steinbeck, L., Aron, A.
Journal of Bodywork and Movement Therapies, 2019/01

1212

The Italian Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross sectional survey
Cerritelli, F., van Dun, P. L. S., Esteves, J. E., Consorti, G., Sciomachen, P., Lacorte, E., Vanacore, N.
PLoS One, 2019/01
Free full text

1213

Women’s experiences of osteopathic care whilst living with endometriosis
Waugh, M. D.
Unpublished MSc thesis, 2019/01
Free full text

1214

Osteopathic Physical Exam Findings in Chronic Hepatitis C: A Case Study
Chin, J., Francis, M., Lavalliere, J. M., Lomiguen, C. M.
Cureus, 2019/01
Free full text

1215

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text


1217

Professor Stephen Tyreman 1952 – 2018
Vogel, S.
International Journal of Osteopathic Medicine, 2018/12
Free full text


1219

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12

1220

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text

1221

Challenges and opportunities for Australian osteopathy: A qualitative study of the perceptions of registered osteopaths
Blaich, R., Steel, A., Clark, D., Adams, J.
International Journal of Osteopathic Medicine, 2018/12


1223

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text

1224

An overview of osteopathy graduates' perceived preparedness at transition from educational environment to clinic environment one year after graduation: a cross sectional study
Luciani, E., Consorti, G., van Dun, P. L. S., Merdy, O., Lunghi, C., Petracca, M., Esteves, J. E., Cerritelli, F.
BMC Medical Education, 2018/12
Free full text

1225

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1226

Can lateral epicondylitis be relief by osteopathic treatments targeting tensions from the thoracic region? Results of a case study
Brisson-Larouche, A., Kassab, G., Wehbe, W.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1227

The inter-rater reliability of the frontal, temporal, parietal bones, and the spheno-occipital synchrondrosis mobility test as assessed through manual therapy
Demers, K., Morin, C., Collette, L., DeMont, R.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1228

Effect of global osteopathic treatment on functional mobility in the parkinsonian patient: A quasi-experimental study
Devantéry, K., Bouchard, J.C.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1229

Fundamental study of a visceral pericardial osteopathic protocol on heart physiology
Fatisson, J., Mullie, Y., Oswald, V., Gauthier, M., Lalonde, F., Comtois, A. S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1230

Quality of randomized control trials and pilot trials in osteopathy according to the CONSORT checklist
Morin, C., Maclure, M., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

1231

The beliefs and attitudes of UK registered osteopaths towards chronic pain and the management of chronic pain sufferers - A cross-sectional questionnaire based survey
Macdonald, R. J. D., Vaucher, P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/12
Free full text

1232

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text

1233

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text



1236

Moving Down the Road Less Traveled: The GROUPIE Program at Touro California
Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

1237

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text

1238

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text

1239

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
The Journal of the American Osteopathic Association, 2018/11

1240


1241

The Influence of Medical School Debt on Specialty Choice: An Analysis of Colleges of Osteopathic Medicine
Dyches, R. P., Speicher, M. R.
The Journal of the American Osteopathic Association, 2018/11


1243

Structure and Function in Medical Education: Trend Analysis of Osteopathic Medical Student Emotional Intelligence (EI) Suggests Curricular Modifications May Improve Functional Traits
Singer-Chang, G., Dong, F., Nevins, N., Seffinger, M., Blumer, J., Darmani, N., Helf, S.
The Journal of the American Osteopathic Association, 2018/11

1244

An Osteopathic Approach to Leveraging Community Support for Prevention and Management of Chronic Disease in Rural and Appalachian Virginia
Slaymaker, K. A., Meacham, S., Horn, R., Goessl, C., Meisha, D., Mahaney, J.
The Journal of the American Osteopathic Association, 2018/11

1245

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text

1246

Professional trust in osteopathy: a theory for educational practice
Mackay Tumber, L.
Unpublished Dissertation, 2018/10
Free full text

1247

Outpatient satisfaction with osteopathic manipulative treatment in a hospital center: A survey
Tramontano, M., Cinnera, A. M., Petracca, M., Gaeta, A., Tamburella, F., Audouard, M., Caltagirone, C.
Alternative Therapies in Health and Medicine, 2018/10

1248

Is mulligan’s sustained natural apophyseal glides (Snags) or muscle energy technique is effective in the non-surgical management of cervicogenic headache? a two-group pretest-posttest randomized controlled trial
Veena Kirthika, S., Padmanabhan, K., Sudhakar, Selvaraj, Vijaya Kumar, M.
Asian Journal of Pharmaceutical and Clinical Research, 2018/10
Free full text


1250

Changes on cervical range of motion in migraine patients after a strain counterstrain treatment
Giustino, V., Contrò, V., Brusa, J., Proia, P., Messina, G., Brighina, F.
The Journal of Headache and Pain, 2018/10


1252

Health literacy across all year levels of a cohort of Australian osteopathy students
Mulcahy, J., Vaughan, B.
Quality of Life Research, 2018/10

1253

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10


1255

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text

1256

The One Health Initiative as a Basis for Research Development in the Department of Pharmacology at Midwestern University
Prozialeck, W. C., Edwards, J. R.
The Journal of the American Osteopathic Association, 2018/09
Free full text

1257

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text

1258

It depends on how things are to you
Vogel, S.
International Journal of Osteopathic Medicine, 2018/09
Free full text



1261

Effect of gong’s mobilisation versus muscle energy technique on pain and functional ability of shoulder in phase II adhesive capsulitis
Gopinath, Y., Seenivasan, S. K., Veeraraghavan, S. N. C., Viswanathan, R., Govindaraj, M. K.
Journal of Clinical and Diagnostic Research, 2018/09

1262

Primary care physicians' attitude and reported prescribing behavior for chronic low back pain: An exploratory cross-sectional study
Rodondi, P. Y., Dubois, J., Bill, A. S., Koutaissoff, D., Ros, J., Aveni, E., Pasquier, J., Herzig, L., Decosterd, I., Burnand, B.
PLoS One, 2018/09
Free full text

1263

The role of osteopathy in the Swiss primary health care system: a practice review
Vaucher, P., Macdonald, R. J. D., Carnes, D.
BMJ Open, 2018/09
Free full text

1264

Effects of manual therapy on the diaphragm in asthmatic patients: A randomized pilot study
Leonés-Macías, E., Torres-Sánchez, I., Cabrera-Martos, I., Ortiz-Rubio, A., López-López, L., Valenza, Marie C.
International Journal of Osteopathic Medicine, 2018/09

1265


1266

Is digital image correlation able to detect any mechanical effect of cranial osteopathic manipulation? – A preliminary study
Pellet, M., Chenel, A., Behr, M., Thollon, L.
International Journal of Osteopathic Medicine, 2018/09

1267

History of Research at Midwestern University/Chicago College of Osteopathic Medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2018/09
Free full text





1272

Diabetes Fellowship in Primary Care: A Survey of Graduates
Healy, A. M., Tanenberg, R. J., Schwartz, F. L., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2018/08
Free full text

1273

Comparative Efficiency of Muscle Energy Technique and Static Stretching in Enhancing Triceps Surae Flexibility
Kumar, G. M., Rajalaxmi, V., Nathan, C. V. S., Ramachandran, S., Kirthika, V., Sudhakar, S., Padmanabhan, K., Yuvarani, G.
Journal of Clinical and Diagnostic Research, 2018/08
Free full text

1274

Evaluating the effectiveness of teaching osteopathy in a combined didactics setting
Eilerman, A., Keller, M. E., Hixson, D., II, Gupta
Osteopathic Family Physician, 2018/08

1275

Resident Duty Hour Restrictions: The Implications Behind the New Data Ahead of the Single Accreditation System
Berry, A. C., McClain, E. K.
The Journal of the American Osteopathic Association, 2018/08
Free full text

1276


1277

Treatment of bilateral dyshidrotic eczema with drugs versus nutritional and osteopathic treatment
Aceranti, A., Vernocchi, S.
Italian Journal of Medicine, 2018/07
Free full text

1278

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07

1279

Use of complementary health approaches at military treatment facilities, active component, U.S. Armed Forces, 2010-2015
Williams, V. F., Clark, L. L., McNellis, M. G.
Medical Surveillance Monthly Report, 2018/07


1281

Osteopathic Manipulative Therapy Potentiates Motor Cortical Plasticity
Ponzo, V., Cinnera, A. M., Mommo, F., Caltagirone, C., Koch, G., Tramontano, M.
The Journal of the American Osteopathic Association, 2018/06
Free full text

1282


1283

The attitudes and beliefs of UK osteopaths towards the management of low back pain: A cross-sectional study
Bar-Zaccay, A., Bailey, D.
International Journal of Osteopathic Medicine, 2018/06


1285

Clinical reasoning in osteopathy: Experiences of novice and experienced practitioners
King, L., Kremser, S., Deam, P., Henry, J., Reid, D., Orrock, P., Grace, S.
International Journal of Osteopathic Medicine, 2018/06

1286

Osteopathic clinical reasoning: An ethnographic study of perceptual diagnostic judgments, and metacognition
McIntyre, C, Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/06

1287

Reducing Health Disparities: Understanding the Unintended Effects of Health Care Professional and Patient Characteristics on Treatment
Nazione, S., Nazione, A.
The Journal of the American Osteopathic Association, 2018/06
Free full text




1291

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05


1293

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05

1294


1295

Cervical HVLA Used as Single Intervention Improves Motion and Strength
Zamora, S., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/05
Free full text

1296


1297

The perceptions and experiences of osteopathic treatment among cancer patients in palliative care: a qualitative study
Steel, A., Tricou, C., Monsarrat, T., Ruer, M., Deslandes, C., Sisoix, C., Filbet, M.
Supportive Care in Cancer, 2018/05



1300

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text

1301

How type and number of training sessions influence the reliability of palpation
Lavazza, C., Milano, V., Abenavoli, A., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2018/04

1302

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04

1303

The immediate effect of osteopathic cervical spine mobilization on median nerve mechanosensitivity: A triple-blind, randomized, placebo-controlled trial
Whelan, G., Johnston, R., Millward, C., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2018/04

1304

IGeL-Monitor. Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text

1305

Complaints about chiropractors, osteopaths, and physiotherapists: A retrospective cohort study of health, performance, and conduct concerns
Ryan, A. T., Too, L. S., Bismark, M. M.
Chiropractic & Manual Therapies, 2018/04
Free full text


1307

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text

1308

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text

1309

Shaping conservative spinal services with the Spine Tango Registry
Morris, S., Booth, J.
European spine journal, 2018/03


1311

The Safety of Osteopathic Manipulative Treatment (OMT)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/03
Free full text

1312

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text

1313

Der achtsame A.T. Still
(The mindful A.T. Still)
Schötta, M.
Unpublished MSc thesis, 2018/03
Free full text

1314

‘I just don't have the tools’ - Italian osteopaths' attitudes and beliefs about the management of patients with chronic pain: A qualitative study
Formica, A., Thomson, O. P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/03
Free full text


1316

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text

1317

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text

1318

Pre-entry qualifications as predictors of success in first year osteopathic education
Palfreyman, S., Mercier, J., Friedlander, T.
International Journal of Osteopathic Medicine, 2018/03

1319

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03


1321

Core competencies in osteopathy: Italian register of osteopaths proposal
Sciomachen, P., Arienti, C., Bergna, A., Castagna, C., Consorti, G., Lotti, A., Lunghi, C., Tramontano, M., Longobardi, M.
International Journal of Osteopathic Medicine, 2018/03
Free full text

1322

Physician-Mentored Patient Rounds to Observe and Assess Entrustable Professional Activities 1 and 2 in Preclinical Medical Students
Chamberlain, N. R., Sexton, P. S., Hardee, M. R., Baer, R. W.
The Journal of the American Osteopathic Association, 2018/03
Free full text

1323

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text




1327

OMT May Be Helpful in the Management of Benign Paroxysmal Positional Vertigo
Tegeler, L., Blumer, J.
The Journal of the American Osteopathic Association, 2018/01
Free full text


1329

The Validity and Reliability of Provocation Tests in the Diagnosis of Sacroiliac Joint Dysfunction
Telli, H., Telli, S., Topal, M.
Pain Physician, 2018/01
Free full text

1330

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01

1331


1332

Medical Student Decision-Making: Standard Surgical Excision or Mohs Micrographic Surgery to Manage Basal Cell Carcinoma
Mancuso, C., Morris, J. B., Hernandez, N., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2018/01
Free full text

1333

Osteopathic Medical Education: Answering the Call
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text

1334

Osteopathy as an Aid to Treatment
Riedel, M.
Deutsches Ärzteblatt International, 2018/01
Free full text

1335

Level of evidence and quality of reports of cranial and visceral osteopathic treatment trials
Morin, C., Gaboury, I.
Global Advances in Health and Medicine, 2018


1337

Palpatory and Ultrasound Assessment of Cervical Dysfunctions and the Effect of Cervical High-Velocity, Low-Amplitude (HVLA) Technique
Flaum, T. B., Mirza, A., Rusnack, F. M-A., Apoznanski, T. E., Munarova, A., Mazzie, J., Terzella, M. J., Yao, S. C.
The AAO Journal, 2017/12
Free full text




1341

A Mokken analysis of the literacy in musculoskeletal problems questionnaire
Vaughan, B., Mulcahy, J., Coffey, A., Addinsall, L., Ryan, S., Fitzgerald, K.
Health and Quality of Life Outcomes, 2017/12
Free full text

1342

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12

1343

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text



1346


1347

Challenging Case of Parotitis: A Comprehensive Approach
Patel, P., Scott, S., Cunningham, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text

1348

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text

1349

Effects of Group Fitness Classes on Stress and Quality of Life of Medical Students
Yorks, D. M., Frothingham, C. A., Schuenke, M. D.
The Journal of the American Osteopathic Association, 2017/11
Free full text


1351

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2017/11

1352

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
The Journal of the American Osteopathic Association, 2017/11

1353

Osteopathic Manipulative Treatment Reduces Oxidative Stress Levels and Improves Relative Stiffness and Quality of Life in Parkinson Disease
Moriarty, S. A., Lu, V., Oommen, C., Bellavia, L. M., Lee, J. M., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11

1354

Lymphatic Pump Treatment of Inflammation in Rat Adjuvant-Induced Arthritis
Volin, M., McAuliffe, R., Zanotti, B.
The Journal of the American Osteopathic Association, 2017/11

1355

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text


1357

Assessment of Nutrition Knowledge and Attitudes in Preclinical Osteopathic Medical Students
Hargrove, E. J., Berryman, D. E., Yoder, J. M., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/10
Free full text

1358

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

1359

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text

1360

Work related musculoskeletal injuries sustained by Australian osteopaths: qualitative analysis of effects on practitioner health, clinical practice, and patient care
McLeod, G. A., Annels, K., Cohen, J., Edwards, S., Hodgins, D., Vaughan, B.
Chiropractic & Manual Therapies, 2017/10
Free full text







1367

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

1368

Effects of Cervical High-Velocity Low-Amplitude Techniques on Range of Motion, Strength Performance, and Cardiovascular Outcomes: A Review
Galindez-Ibarbengoetxea, X., Setuain, I., Andersen, L. L., Ramírez-Velez, R., González-Izal, M., Jauregi, A., Izquierdo, M.
The Journal of Alternative and Complementary Medicine, 2017/09

1369

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09





1374

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text



1377

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

1378

Sensitivity for palpating lumbopelvic soft- tissues and bony landmarks and its associated factors: A single-blinded diagnostic accuracy study
Ferreira, A. P. A., Póvoa, L. C., Zanier, J. F. C., Machado, D. C., Ferreira, A. S.
Journal of Back and Musculoskeletal Rehabilitation, 2017/08

1379

Fundamentals for an Osteopathic Obesity Designed Study: The Effects of Education on Osteopathic Medical Students' Attitudes Regarding Obesity
Gayer, G. G., Weiss, J., Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

1380

In Reply to Buser and to Shannon
Cummings, M.
Academic Medicine, 2017/08
Free full text

1381

Diagnostic reliability of osteopathic tests: A systematic review
Basile, F., Scionti, R., Petracca, M.
International Journal of Osteopathic Medicine, 2017/08

1382

Corrigendum to “Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research“ [Musculoskelet. Sci. Pract. 27 165-175]
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/08

1383

Effect of Continuous Touch on Brain Functional Connectivity Is Modified by the Operator's Tactile Attention
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Frontiers in Human Neuroscience, 2017/07
Free full text


1385

Interexaminer reliability study of a standardized myofascial diagnostic technique of the superior thoracic inlet
Hutchinson, D., Hines, S., Vijayaraghavan, N., Sammond, A., Metzler-Wilson, K., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2017/07

1386

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text


1388

(Osteopathic approaches for endometriosis)
Ott, S.
Osteopathische Medizin, 2017/06

1389

Efficacy of an eccentric osteopathic manipulation treatment in somatic tinnitus
Goyal, M., Sharma, S., Baisakhiya, N., Goyal, K.
Indian Journal of Otology, 2017/06


1391

Schwindel bei Tubenkatarrh nach Otitis media
(Vertigo in tubal catarrh after otitis media)
Schneider, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06


1393

Reply to the letter to the editor: 'Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment'
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/06

1394

Factors influencing osteopathic medical students' intent to work with underserved populations: Implications for curriculum enhancement
Jacobs, R. J., Kane, M. N., Wallace, E. M., Rana, A.f M., Iqbal, H., Rana, Z.
International Journal of Osteopathic Medicine, 2017/06

1395

A pilot study to develop a tool for the assessment of students' clinical record keeping
Moore, K., Vaughan, B., Cox, A.
International Journal of Osteopathic Medicine, 2017/06




1399

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text


1401

Osteopathic manipulation of the ankle improves spinal flexibility in elite alpine skiers: a pilot study
Parisio, C., Vismara, L., Micotti, V., Cimolin, V., Aprile, D., Cavigioli, M., Panzeri, A., Manzotti, A., Galli, M., Capodaglio, P.
Gazzetta Medica Italiana Archivio Per Le Scienze Mediche, 2017/05

1402

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text

1403

An Osteopathic Approach to Chronic Pain Management
Jerome, J. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text

1404

Addition of Osteopathic Visceral Manipulation to OMT for Low Back Pain Decreases Pain and Increases Quality of Life
King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text

1405

Residency Program Directors' Interview Methods and Satisfaction With Resident Selection Across Multiple Specialties
VanOrder, T., Robbins, W., Zemper, E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1406

Attitudes of Family Medicine Program Directors Toward Osteopathic Residents Under the Single Accreditation System
Hempstead, L. K., Shaffer, T. D., Williams, K. B., Arnold, L. C.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1407



1409

Non-pharmacological therapies for primary open angle glaucoma: A quasi-experimental pilot study
Pandey, R., Samuel, A. J., Aranha, V. P., Pandey, A., Narkeesh, K.
Saudi Journal of Ophthalmology, 2017/04
Free full text

1410


1411


1412

Can the Humanities Humanize Health Care?
Baltonado, J., Cymet, T.
The Journal of the American Osteopathic Association, 2017/04
Free full text

1413

Changes in Osteopathic Medical Education: The Journey Continues
McClain, E. K.
The Journal of the American Osteopathic Association, 2017/04
Free full text





1418

A Qualitative, Interview-Based Study of the Health Policy Fellowship's Osteopathic Identity
Skinner, D., Franz, B.
The Journal of the American Osteopathic Association, 2017/03
Free full text

1419

Impact of osteopathic therapy on proprioceptive balance and quality of life in patients with dizziness
Papa, L., Amodio, A., Biffi, F., Mandara, A.
Journal of Bodywork and Movement Therapies, 2017/03

1420

Osteopathy for primary headache patients: a systematic review
Cerritelli, F., Lacorte, E., Ruffini, N., Vanacore, N.
Journal of Pain Research, 2017/03
Free full text

1421

Australian osteopathic students' perceptions of interprofessional relationships
Vaughan, B., Moore, K., Macfarlane, C., Grace, S.
International Journal of Osteopathic Medicine, 2017/03

1422

History of Osteopathic Medicine: Still Relevant?
Orenstein, R.
The Journal of the American Osteopathic Association, 2017/03
Free full text


1424

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text





1429

Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/02

1430

The strain - Counter strain technique in the management of anterior interosseous nerve syndrome: A case report
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S.
Journal of Taibah University Medical Sciences, 2017/02
Free full text

1431


1432

GPs and the unexplored world of osteopathy: a descriptive study
Currie, K. G.
Unpublished MSc thesis, 2017/02
Free full text


1434

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/


1436

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text

1437

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text

1438

Osteopathic Manipulative Treatment Limits Chronic Constipation in a Child with Pitt-Hopkins Syndrome
Aquino, A., Perini, M., Cosmai, S., Zanon, S., Pisa, V., Castagna, C., Uberti, S.
Case Reports in Pediatrics, 2017/01
Free full text

1439

Osteopathie und Psyche
(Osteopathy and Psyche)
Tschinkel, M.
Unpublished MSc thesis, 2017/01
Free full text

1440

Knee Pain in Adults with an Osteopathic Component
Datta, R., Burina, L., Romanelli, F., Flaum, T. B.
Osteopathic Family Physician, 2017/01
Free full text




1444

How Osteopathy Could Help Obstetrics in Diagnosis and Therapy. Preliminary Report About Safety and Efficacy of Osteopathy in an Obstetrics Department in Italy
Siccardi, M., Valle, C., Di Matteo, F., Perlo, B., Pratticò, M., Angius, V., Bianco, G., Damonte, V., Giusto, S., Palezzato, E., Tabò, M., Brichetto, C., Valle, P., Zolezzi, A., Parodi, G., Airaudi, G.
Journal of Perinatal Medicine, 2017/01

1445

John Martin Littlejohn: Leben und Werk
(John Martin Littlejohn: life and work)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

1446

Osteopathic Manipulative Treatment of Primary Dysmenorrhea and Related Factors: A Randomized Controlled Trial
Zecchillo, D., Acquati, A., Aquino, A., Pisa, V., Uberti, S., Ratti, S.
International Journal of Medical Research & Health Sciences, 2017
Free full text


1448

Relationship Between Falls and Complementary and Alternative Medicine Use Among Community-Dwelling Older Adults
Caron, A., Gallo, W. T., Durbin, L. L., Mielenz, T. J.
The Journal of Alternative and Complementary Medicine, 2016/12

1449

Assessment of Hospital Staff's Knowledge of Osteopathic Manipulative Medicine: A Survey-Based Study
Smith-Kelly, J. B., Cardenas, A.
The Journal of the American Osteopathic Association, 2016/12
Free full text

1450

Reliability of Diagnosis and Clinical Efficacy of Cranial Osteopathy: A Systematic Review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
PLoS One, 2016/12
Free full text


1452

Holism in Osteopathy – Bridging the gap between concept and practice: A grounded theory study
Turner, P. W. D., Holroyd, E.
International Journal of Osteopathic Medicine, 2016/12


1454

Does replacing live demonstration with instructional videos improve student satisfaction and osteopathic manipulative treatment examination performance?
Seals, R., Gustowski, S. M., Kominski, C., Li, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text

1455

Manual therapy and OMT may be of benefit in the management of somatosensory tinnitus
King, H. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text


1457

Can manual osteopathic techniques performed on the small and large intestines reduce the symptoms associated with irritable bowel syndrome?
Choquette, J., Plante, S., Sabourin, D.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text


1459

Inter-examiner reliability of osteopathic cranial palpatory diagnostic test
Morin, C., Collette, L., Aubin, A.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text

1460

Development of trust between conventional and CAM practitioners: Insights from physicians and osteopaths in Quebec
Morin, C., Gaboury, I., Desrosiers, J.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text




1464

The use of critical reflection to foster reflective practice in student osteopaths
McLeod, G. A.
Unpublished PhD thesis, 2016/09
Free full text

1465

The enigmatic case of cranial osteopathy: Evidence versus clinical practice
Zegarra-Parodi, R., Cerritelli, F.
International Journal of Osteopathic Medicine, 2016/09
Free full text

1466

Nachruf auf Roger Seider
(Obituary for Roger Seider)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2016/09

1467

The Attitudes of Physicians, Nurses, Physical Therapists, and Midwives Toward Complementary Medicine for Chronic Pain: A Survey at an Academic Hospital
Aveni, E., Bauer, B., Ramelet, A. S., Kottelat, Y., Decosterd, I., Finti, G., Ballabeni, P., Bonvin, E., Rodondi, P. Y.
Explore (NY), 2016/09

1468

Does Using a Shim Improve the Diagnostic Reliability of the Standing Flexion Test? A Pilot Study
Marquez, A. P., Yim, M., Zelimkhanian, B., Quiamas, J., Davidge, R. E., Siri, M., Hruby, R. J.
The AAO Journal, 2016/09



1471

Osteopathic Manipulative Treatment in Pediatric and Neonatal Patients and Disorders: Clinical Considerations and Updated Review of the Existing Literature
Bagagiolo, D., Didio, A., Sbarbaro, M., Priolo, C. G., Borro, T., Farina, D.
American Journal of Perinatology, 2016/09


1473

Haftungsfälle in der osteopathischen Praxis
(Cases of liability in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09

1474

Tensegrity and manual therapy practice: a qualitative study
Hohenschurz-Schmidt, D. J., Esteves, J. E., Thomson, O. P.
International Journal of Osteopathic Medicine, 2016/09

1475

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text

1476

Benefits of Craniosacral Therapy in Patients with Chronic Low Back Pain: A Randomized Controlled Trial
Castro-Sánchez, A. M., Lara-Palomo, I. C., Matarán-Peñarrocha, G. A., Saavedra-Hernández, M., Pérez-Mármol, J. M., Aguilar-Ferrándiz, M. E.
The Journal of Alternative and Complementary Medicine, 2016/08

1477

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text

1478

Osteopathic Manual Treatment for Amyotrophic Lateral Sclerosis: A Feasibility Pilot Study
Maggiani, A., Tremolizzo, L., Della Valentina, A., Mapelli, L., Sosio, S., Milano, V., Bianchi, M., Badi, F., Lavazza, C., Grandini, M., Corna, G., Prometti, P., Lunetta, C., Riva, N., Ferri, A., Lanfranconi, F., Me, Study
The Open Neurology Journal, 2016/08
Free full text

1479


1480

Health literacy screening of patients attending a student-led osteopathy clinic: A pilot investigation
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Complementary Therapies in Clinical Practice, 2016/08





1485

Targeted Pressure on Abductor Hallucis and Flexor Hallucis Brevis Muscles to Manage Moderate to Severe Primary Restless Legs Syndrome
Kuhn, P. J., Olson, D. J., Sullivan, J. P.
The Journal of the American Osteopathic Association, 2016/07
Free full text

1486

In memoriam Viola Frymann (1921–2016)
(In memoriam of Viola Frymann (1921–2016))
Dove, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07


1488

Response of Tinnitus to Osteopathic Manipulation
Kurisu, M., Alexander, J., Fleming, J., King, H.
Journal of Integrative and Complementary Medicine, 2016/06


1490

Beliefs about back pain: The confluence of client, clinician and community
Darlow, B.
International Journal of Osteopathic Medicine, 2016/06

1491

Time, space and form: Necessary for causation in health, disease and intervention?
Evans, D. W., Lucas, N., Kerry, R.
Medicine, Health Care and Philosophy, 2016/06

1492

Osteopathic manipulative treatment in gynecology and obstetrics: A systematic review
Ruffini, N., D'Alessandro, G., Cardinali, L., Frondaroli, F., Cerritelli, F.
Complementary Therapies in Clinical Practice, 2016/06




1496

Masterclasses – integrating research evidence with expertise into clinical practice
Thomson, O. P., Evans, D. W.
International Journal of Osteopathic Medicine, 2016/06



1499

Eye contact, appetite, and vomiting improved in children with autism spectrum disorder after visceral osteopathic technique
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text

1500

Postural Balance and Gait Improved With an Osteopathic Intervention in a Special Needs Population
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text

1501

Premedical Students’ Attitudes Toward Primary Care Medicine
Beverly, E. A., Wietecha, D. A., Nottingham, K., Rush, L. J., Law, T. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

1502

ENGAGE Initiative: Showcasing Osteopathic Scholarly Activity
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/05
Free full text

1503

Program Characteristics Influencing Allopathic Students' Residency Selection
Stillman, M. D., Miller, K. H., Ziegler, C. H., Upadhyay, A., Mitchell, C. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1504


1505

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1506

Osteopathic Manipulative Treatment improves gait pattern and posture in adult patients with Prader–Willi syndrome
Vismara, L., Cimolin, V., Galli, M., Grugni, G., Ancillao, A., Capodaglio, P.
International Journal of Osteopathic Medicine, 2016/03

1507

Osteopathy – a complex business
Vogel, S.
International Journal of Osteopathic Medicine, 2016/03

1508

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03




1512

Knowing hands converse with an expressive body - An experience of osteopathic touch
Consedine, S., Standen, C., Niven, E.
International Journal of Osteopathic Medicine, 2016/03

1513

Understanding clinical reasoning in osteopathy: a qualitative research approach
Grace, S., Orrock, P., Vaughan, B., Blaich, R., Coutts, R.
Chiropractic & Manual Therapies, 2016/03
Free full text


1515

Osteopathie bei Infantiler Cerebralparese
(Osteopathy for Infant Cerebral Palsy)
Budroni, J.
Unpublished MSc thesis, 2016/03
Free full text


1517

Osteopaths' clinical reasoning during consultation with patients experiencing acute low back pain: A qualitative case study approach
Roots, S. A., Niven, E., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/03

1518

Klinische Effektivität einer osteopathischen Behandlung bei Migräne
(Clinical effectiveness of osteopathic treatment for migraines)
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Osteopathische Medizin, 2016/03

1519

Patients' experiences of living with persistent back pain
van Griensven, Hubert
International Journal of Osteopathic Medicine, 2016/03



1522

Osteopathic Physicians on the Editorial Boards of Major Medical Journals Over the Past 30 Years
Ashurst, J. V., Galuska, M.
The Journal of the American Osteopathic Association, 2016/02
Free full text

1523







1529

Prevalence and characteristics of women who consult with osteopathic practitioners during pregnancy; a report from the Australian Longitudinal Study on Women's Health (ALSWH)
Frawley, J., Sundberg, T., Steel, A., Sibbritt, D., Broom, A., Adams, J.
Journal of Bodywork and Movement Therapies, 2016/01


1531

General Movements in preterm infants undergoing craniosacral therapy: a randomised controlled pilot-trial
Raith, W., Marschik, P. B., Sommer, C., Maurer-Fellbaum, U., Amhofer, C., Avian, A., Lowenstein, E., Soral, S., Muller, W., Einspieler, C., Urlesberger, B.
BMC Complementary and Alternative Medicine, 2016/01
Free full text


1533

Muscle energy technique improves chronic lateral epicondylitis
Koh, C., III, Seffinger
The Journal of the American Osteopathic Association, 2016/01
Free full text


1535

An indication of current views of Australian general practitioners towards chiropractic and osteopathy: a cross-sectional study
Engel, R. M., Beirman, R., Grace, S.
Chiropractic & Manual Therapies, 2016/01
Free full text

1536

Arguments for and against movement at the spheno-occipital synostosis: Furthering the debate
Starkey, R.
International Journal of Osteopathic Medicine, 2015/6

1537

The Osteopathic Clinical Practice Assessment – a pilot study to develop a new workplace-based assessment tool
Vaughan, B., Moore, K.
International Journal of Osteopathic Medicine, 2015/12


1539

Effect of Select Osteopathic Manipulative Treatment Techniques on Patients With Acute Rhinosinusitis
Nishida, Y., Sopchak, M. M., Jackson, M. R., Andersonning, T. R., Leikert, E. P., Goldman, S. I., Jarski, R. W.
The AAO Journal, 2015/12





1544

Reassessing the accuracy and reproducibility of Diers formetric measurements in healthy volunteers
Lason, G., Peeters, L., Vandenberghe, K., Byttebier, G., Comhaire, F.
International Journal of Osteopathic Medicine, 2015/12

1545

Scimitar syndrome: A rare explanation for a common symptom with an osteopathic approach
Rivera, N. T., Martin, R. B., Gordon, M.l B., Rajter, J.-J., Bray, N.
International Journal of Osteopathic Medicine, 2015/12




1549

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11

1550

Serious Adverse Events and Spinal Manipulative Therapy of the Low Back Region: A Systematic Review of Cases
Hebert, J. J., Stomski, N. J., French, S. D., Rubinstein, S. M.
Journal of Manipulative and Physiological Therapeutics, 2015/11



1553

Patients' expectations of osteopathic care: a qualitative study
Cross, V., Leach, C. M., Fawkes, C. A., Moore, A. P.
Health Expectations, 2015/10
Free full text

1554


1555

Look but ... please don't touch!
De-Giorgio, F., Panarella, L., Miscusi, M., d', Aloja, E., Spagnolo, A. G., Pascali, V. L., Vetrugno, G.
Medicine, Science and the Law, 2015/10
Free full text







1562

Impact of forefoot varus on standing and gait kinematics in children
Villarroya-Aparicio, A., Franco-Sierra, M. A., García-Muñoz, I., Marcén-Román, Y., Alonso-Vázquez, A., Rodriguez-Blanco, C.
International Journal of Osteopathic Medicine, 2015/09





1567

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09

1568

Approaching the Single Accreditation System: Curricular Variation in Allopathic, Osteopathic, and Dually Accredited Family Medicine Residency Programs
Mims, L. D., Wannamaker, L. R., Bressler, L. C.
Journal of Graduate Medical Education, 2015/09
Free full text


1570

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09

1571

Improving our impact and developing high-level clinical expertise
Moran, R.
International Journal of Osteopathic Medicine, 2015/09
Free full text



1574

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text

1575

Accuracy of Anterior Superior Iliac Spine Symmetry Assessment by Routine Structural Examination
Lee, A. S., Pyle, C. W., Redding, D.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1576

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1577

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text


1579

Effects of Osteopathic Manipulative Treatment on Diabetic Gastroparesis
Van Ravenswaay, V. J., Hain, S. J., Grasso, S., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2015/07
Free full text

1580

Lass die Natur ihre Arbeit machen
(Let nature do its job)
Deslee, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07






1586

Relationship between somatic dysfunction of the lumbosacral joint and changes in the gait pattern
Croonenborghs, H., Peeters, L., De Schepper, J.
International Journal of Osteopathic Medicine, 2015/06

1587

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06

1588

Proposed Amendments to the AOA Constitution
listed, No authors
The Journal of the American Osteopathic Association, 2015/06
Free full text




1592

The value of looking within, and without
Lucas, N.
International Journal of Osteopathic Medicine, 2015/06
Free full text


1594

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1595

High-Velocity Thrust to the Atlantoaxial Joint Does Not Increase Mechanical Stress on the Vertebral Artery
Guevarra, C. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1596

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05

1597

A multicenter, randomized, controlled trial of osteopathic manipulative treatment on preterms
Cerritelli, F., Pizzolorusso, G., Renzetti, C., Cozzolino, V., D'Orazio, M., Lupacchini, M., Marinelli, B., Accorsi, A., Lucci, C., Lancellotti, J., Ballabio, S., Castelli, C., Molteni, D., Besana, R., Tubaldi, L., Perri, F. P., Fusilli, P., D'Incecco, C., Barlafante, G.
PLoS One, 2015/05
Free full text


1599

The meaning of fascia in a changing society
Adstrum, N. S.
Unpublished PhD thesis, 2015/04

1600

Transitions in osteopathic medical education
Cymet, T. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1601

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1602

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text


1604

„Meine Mitte ist verschoben!“
(“My center is shifted!“)
Weese, P.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1605

Osteopathic manipulative treatment and pain in preterms: study protocol for a randomised controlled trial
Cerritelli, F., Cicchitti, L., Martelli, M., Barlafante, G., Renzetti, C., Pizzolorusso, G., Lupacchini, M., D'Orazio, M., Marinelli, B., Cozzolino, V., Fusilli, P., D'Incecco, C.
Trials, 2015/04
Free full text

1606

Clinical effectiveness of osteopathic treatment in chronic migraine: 3-Armed randomized controlled trial
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Complementary Therapies in Medicine, 2015/04

1607

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1608

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1609

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1610

Sensory characteristics of chronic non-specific low back pain
Orchard, D.
International Journal of Osteopathic Medicine, 2015/03

1611

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text



1614

Adapting and feasibility testing pre-registration e-learning resources for Professionalism in Osteopathy in the UK
Browne, F., Rolfe, K., Currie, A., Walker, T., Roff, S.
International Journal of Osteopathic Medicine, 2015/03

1615

Chronic inflammatory disease and osteopathy: a systematic review
Cicchitti, L., Martelli, M., Cerritelli, F.
PLoS One, 2015/03
Free full text

1616




1619

Osteopathic graduates perceptions of stress and competence – A longitudinal study
Subramaniam, P., Eaton, S.A., Cranfield, J., Mulcahy, J., McLaughlin, P., Morrison, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2015/03



1622


1623

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text

1624


1625

Promoting optimal breastfeeding through the osteopathic therapeutic cycle
Cornall, D.
Unpublished PhD thesis, 2015/02
Free full text

1626

Impact of the Single Accreditation Agreement on GME Governance and the Physician Workforce
Buser, B. R.
The Journal of the American Osteopathic Association, 2015/02
Free full text

1627

Patienteninfo: Gute Ernährung für gesundes Altern
(Patient information: Good nutrition for healthy aging)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

1628

Aufrecht im Alter
(Upright in old age)
Eix, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01




1632

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text

1633

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12


1635

“Making Strange”: A role for the humanities in medical education
Vincent, F.
International Journal of Osteopathic Medicine, 2014/12

1636

The role of clinicians in osteopathic research
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/12





1641

Credibility of a comparative sham control intervention for craniosacral therapy in patients with chronic neck pain
Haller, H., Ostermann, T., Lauche, R., Cramer, H., Dobos, G.
Complementary Therapies in Medicine, 2014/12

1642

A prodromal, musculoskeletal presentation of Parkinson's disease: A case report
Simpson, P. A.
International Journal of Osteopathic Medicine, 2014/12


1644

Safeguarding children in osteopathic practice: Part 1: Identifying children at risk
Maddick, A. F., Feld, A., Laurent, S.
International Journal of Osteopathic Medicine, 2014/12

1645






1650

The Effect of Optimally Timed Osteopathic Manipulative Treatment on Length of Hospital Stay in Moderate and Late Preterm Infants: Results from a RCT
Pizzolorusso, G., Cerritelli, F., Accorsi, A., Lucci, C., Tubaldi, L., Lancellotti, J., Barlafante, G., Renzetti, C., D', Incecco, C., Perri, F. P.
Evidence-based Complementary and Alternative Medicine, 2014/11
Free full text


1652

A modified Delphi consensus study to identify UK osteopathic profession research priorities
Rushton, A. B., Fawkes, C. A., Carnes, D., Moore, A. P.
Manual Therapy, 2014/10

1653

Dose-Response Research in Chiropractic Care and Possible Comparisons With OMT
King, H. H.
The Journal of the American Osteopathic Association, 2014/10
Free full text


1655

How to Win the Match Against Tennis Elbow: A Comparison of Different Techniques
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1656

Effekt von Lebermobilisation
(Effects of liver mobilization)
March, S.
Unpublished MSc thesis, 2014/10
Free full text

1657

Deformations experienced in the human skin, adipose tissue, and fascia in osteopathic manipulative medicine
Chaudhry, H., Bukiet, B., Ji, Z., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1658

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1659

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1660

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1661

Osteopaths' professional views, identities and conceptions – A qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/09

1662

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09

1663

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09

1664

Results, solutions, and learning: The continuing maturation of osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2014/09






1670

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text


1672

Osteopathic Primary Care of Patients With Inflammatory Bowel Disease: A Review
Bragg, J. D.
The Journal of the American Osteopathic Association, 2014/09
Free full text



1675

Male spine motion during coitus: implications for the low back pain patient
Sidorkewicz, N., McGill, S. M.
Spine (Phila Pa 1976), 2014/09

1676

Multitasking behaviors of osteopathic medical students
Shah, A. V., Mullens, D. J., Van Duyn, L. J., Januchowski, R. P.
The Journal of the American Osteopathic Association, 2014/08
Free full text

1677

Quality of life in patients referring to private osteopathic clinical practice: A prospective observational study
Cerritelli, F., Verzella, M., Barlafante, G.
Complementary Therapies in Medicine, 2014/08

1678

Cost-effectiveness of manual therapy for the management of musculoskeletal conditions: a systematic review and narrative synthesis of evidence from randomized controlled trials
Tsertsvadze, A., Clar, C., Court, R., Clarke, A., Mistry, H., Sutcliffe, P.
Journal of Manipulative and Physiological Therapeutics, 2014/07
Free full text

1679

Impact of osteopathic treatment on pain in adult patients with cystic fibrosis--a pilot randomized controlled study
Hubert, D., Soubeiran, L., Gourmelon, F., Grenet, D., Serreau, R., Perrodeau, E., Zegarra-Parodi, R., Boutron, I.
PLoS One, 2014/07
Free full text

1680

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text

1681

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text

1682

Osteopathic Manipulative Treatment in Vestibular Neuritis: A Case Report
Ross, B. S., Johnson, V. M.
The AAO Journal, 2014/06
Free full text

1683

Treatment of Common Fibular (Peroneal) Nerve Palsy With Osteopathic Manipulative Medicine: A Case Study
Jahnke, B. M., Hopson, P., Worden, K.
The AAO Journal, 2014/06
Free full text

1684

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06


1686






1691

Reprint of: Elevating the quality of disability and rehabilitation research: Mandatory use of the reporting guidelines
collective, Authors
International Journal of Osteopathic Medicine, 2014/06
Free full text

1692

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06


1694

Effectiveness of osteopathic manipulative therapy for managing symptoms of irritable bowel syndrome: a systematic review
Muller, A., Franke, H., Resch, K.L., Fryer, G.
The Journal of the American Osteopathic Association, 2014/06

1695

Effect of osteopathic manipulative treatment on middle ear effusion following acute otitis media in young children: a pilot study
Steele, K. M., Carreiro, J. E., Viola, J. H., Conte, J. A., Ridpath, L. C.
The Journal of the American Osteopathic Association, 2014/06
Free full text

1696

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text


1698

Robin Kirk DO ND MSc 1939-2014
Collins, M., O'Brien, J., McCoy, R., Hamiliton, F.
Manual Therapy, 2014/06
Free full text


1700

The Journal of the American Osteopathic Association: the next generation
Orenstein, R.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1701

G.I. Joe: Could Visceral Osteopathy Help Fight the War against IBS?
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1702

Association of Low Back Pain, Somatic Dysfunction, and Lumbar Bone Mineral Density: Reproducibility of Findings
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J., Burton, D. C.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1703

Introducing an osteopathic approach into neonatology ward: the NE-O model
Cerritelli, F., Martelli, M., Renzetti, C., Pizzolorusso, G., Cozzolino, V., Barlafante, G.
Chiropractic & Manual Therapies, 2014/05
Free full text

1704

Investigation into factors influencing roles, relationships, and referrals in integrative medicine
Gray, B., Orrock, P.
The Journal of Alternative and Complementary Medicine, 2014/05
Free full text

1705

Effect of osteopathic manipulative therapy in the attentive performance of children with attention-deficit/hyperactivity disorder
Accorsi, A., Lucci, C., Di Mattia, L., Granchelli, C., Barlafante, G., Fini, F., Pizzolorusso, G., Cerritelli, F., Pincherle, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1706

Does fascia hold memories?
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2014/04
Free full text

1707

Strain counterstrain technique to decrease tender point palpation pain compared to control conditions: a systematic review with meta-analysis
Wong, C. K., Abraham, T., Karimi, P., Ow-Wing, C.
Journal of Bodywork and Movement Therapies, 2014/04


1709

The use of technology and perceptions of its effectiveness in training physicians
Mason, P. B., Turgeon, B. M., Cossman, J. S., Lay, D. M.
Medical Teacher, 2014/04

1710

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text



1713

Unified graduate medical education accreditation: a better plow
Bulger, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text

1714

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text


1716

Not Every Hero Wears a Cape. In Memoriam: Melicien Tettambel, DO, FAAO
Hruby, R. J.
The AAO Journal, 2014/03
Free full text

1717

Osteopathic student satisfaction and preparedness to practice: A comparative study
Luciani, E., Cerritelli, F., Waters, M., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/03


1719

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03


1721

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03

1722

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03

1723

Osteopathic manipulative therapy induces early plasma cytokine release and mobilization of a population of blood dendritic cells
Walkowski, S., Singh, M., Puertas, J., Pate, M., Goodrum, K., Benencia, F.
PLoS One, 2014/03
Free full text

1724

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly
Juhl, J. H.
The Journal of the American Osteopathic Association, 2014/02
Free full text

1725


1726

Response to Letter Regarding “Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly“
Noll, D. R.
The Journal of the American Osteopathic Association, 2014/02
Free full text

1727

Should osteopathic students applying to allopathic emergency medicine programs take the USMLE Exam?
Weizberg, M., Kass, D., Husain, A., Cohen, J., Hahn, B.
Western Journal of Emergency Medicine, 2014/02
Free full text



1730

Somatic dysfunction and fascia's gliding-potential
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text

1731

Spatial medicine--a call to 'arms'
Myers, T.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text

1732

Manual Therapy or Exercise Effective for Hip or Knee Osteoarthritis
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text




1736

Contacting with clarity: the communicative purposes of osteopathic touch
Barrington, A.
Unpublished MSc thesis, 2014/01
Free full text

1737

Osteopathic manipulative treatment of congenital talipes equinovarus: a case report
Andreoli, E., Troiani, A., Tucci, V., Barlafante, G., Cerritelli, F., Pizzolorusso, G., Renzetti, C., Vanni, D., Pantalone, A., Salini, V.
Journal of Bodywork and Movement Therapies, 2014/01

1738

Should we start carrying out HVT on disc herniations?
Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2013/12

1739

The OSCE in a pre-registration osteopathy program: Introduction and psychometric properties
Vaughan, B., Florentine, P.
International Journal of Osteopathic Medicine, 2013/12

1740

On the oft-debated question of what it means to be an osteopathic physician
Benzoni, T.
The Journal of the American Osteopathic Association, 2013/12
Free full text

1741

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text

1742

Osteopathic graduate medical education: a way forward
Terry, R.
The Journal of the American Osteopathic Association, 2013/12
Free full text

1743

Assessing undergraduate osteopaths in the identification of patients' excess body weight
Bright, P., Wasik, C.
International Journal of Osteopathic Medicine, 2013/12

1744




1747

Plagiozephalie – Ursachen und Hintergründe
(Plagiocephaly - Causes and background)
Künzel, K.H., Hoermann, R.
Osteopathische Medizin, 2013/11


1749

Muscle energy technique versus corticosteroid injection for management of chronic lateral epicondylitis: randomized controlled trial with 1-year follow-up
Kucuksen, S., Yilmaz, H., Salli, A., Ugurlu, H.
Archives of Physical Medicine and Rehabilitation, 2013/11
Free full text

1750

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text

1751

In vitro biomechanical strain regulation of fibroblast wound healing
Cao, T. V., Hicks, M. R., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/11
Free full text

1752

Role of osteopathic structural diagnosis and osteopathic manipulative treatment for diabetes mellitus and its complications
Johnson, A. W., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2013/11
Free full text



1755

Systematic Review of CAM Approaches to Otitis Media: The Otolaryngology Perspective
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1756

Quantifying Lack of Interexaminer Reliability
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1757

Influence of Manual Therapy on Functional Mobility After Joint Injury in a Rat Model
Ruhlen, R. L., Snider, E. J., Sargentini, N. J., Worthington, B. D., Singh, V. K., Pazdernik, V. K., Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/10
Free full text


1759


1760

Retrospective medical record review of an osteopathic manipulative medicine hospital consultation service
Snider, K. T., Snider, E. J., DeGooyer, B. R., Bukowski, A. M., Fleming, R. K., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/10
Free full text


1762

Patients' appraisals of public and private healthcare: a qualitative study of physiotherapy and osteopathy
Bradbury, K. J., Bishop, F. L., Yardley, L., Lewith, G.
Journal of Health Psychology, 2013/10

1763


1764

Theory, mechanisms and methods – What's missing?
Vogel, S.
International Journal of Osteopathic Medicine, 2013/09
Free full text

1765

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly: An Observational Study
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text

1766

High-velocity low-amplitude thrust manipulation of the lumbar spine immediately modifies soleus T reflex in asymptomatic adults
Boët, C., Fugier, S., Marsault, J., Toublan, D., Valot, M.E., Cheval, A., Amyot d'Inville, G., Niel, S., Guihéneuc, P., Guihard, G.
International Journal of Osteopathic Medicine, 2013/09

1767

The repeatability of pressure algometry in asymptomatic individuals over consecutive days
Frank, L, McLaughlin, P, Vaughan, B
International Journal of Osteopathic Medicine, 2013/09

1768

A Prognostic approach to defining chronic pain across a range of musculoskeletal pain sites
Mason, J.
International Journal of Osteopathic Medicine, 2013/09


1770






1775

Offer and use of complementary and alternative medicine in hospitals of the French-speaking part of Switzerland
Carruzzo, P., Graz, B., Rodondi, P. Y., Michaud, P. A.
Swiss Medical Weekly, 2013/09
Free full text

1776

Evaluation of the acceptability of Peer Physical Examination (PPE) in medical and osteopathic students: a cross sectional survey
Consorti, F., Mancuso, R., Piccolo, A., Consorti, G., Zurlo, J.
BMC Medical Education, 2013/08
Free full text

1777

One of ours
Burhop, J.
The Journal of the American Osteopathic Association, 2013/08
Free full text

1778

Portfolios in Osteopathic Medical Education: A Qualitative Pilot Study
Miner, A., Pierce, L. J., Sidhu, K., Menini, T.
The Journal of the American Osteopathic Association, 2013/08

1779

Osteopathic Manipulative Therapy Affects the Position of Internal Organs in Humans
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1780

Wer waren eigentlich …
(Who actually were ...)
Lewis, J. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07


1782

Effects of craniosacral therapy as adjunct to standard treatment for pelvic girdle pain in pregnant women: a multicenter, single blind, randomized controlled trial
Elden, H., Ostgaard, H. C., Glantz, A., Marciniak, P., Linner, A. C., Olsen, M. F.
ACTA Obstetricia et Gynecologica Scandinavica, 2013/07
Free full text

1783

Osteopathic manipulative treatment for facial numbness and pain after whiplash injury
Genese, J. S.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1784

Die frühkindliche Bewegungsentwicklung
(Early childhood movement development)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1785

Oxytocingabe während der Geburt und ADHS
(Oxytocin during birth and ADHD)
Fleischer, F.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1786

Osteopathic manipulative treatment for pediatric conditions: a systematic review
Posadzki, P., Lee, M. S., Ernst, E.
Pediatrics, 2013/07

1787

Recognising patient-centred care in clinical trials of osteopathy – towards a more pragmatic approach
Moran, R.
International Journal of Osteopathic Medicine, 2013/06
Free full text

1788

Efficacy of osteopathy and other manual treatment approaches for malocclusion – A systematic review of evidence
Andresen, T., Bahr, C., Ciranna-Raab, C.
International Journal of Osteopathic Medicine, 2013/06






1794

Osteopathie und Unfruchtbarkeit
(Osteopathy and infertility)
Kermorgant, G.
Osteopathische Medizin, 2013/06


1796

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1797

Osteopathic manual treatment in patients with diabetes mellitus and comorbid chronic low back pain: subgroup results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1798

Distance learning and osteopathic manipulative medicine
Blumer, J. U.
The AAO Journal, 2013/06
Free full text

1799

Osteopathic evaluation of somatic dysfunction and craniosacral strain pattern among preterm and term newborns
Pizzolorusso, G., Cerritelli, F., D', Orazio, M., Cozzolino, V., Turi, P., Renzetti, C., Barlafante, G., D', Incecco, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1800

Complementary and alternative medicine for pediatric otitis media
Levi, J. R., Brody, R. M., McKee-Cole, K., Pribitkin, E., O'Reilly, R.
International Journal of Pediatric Otorhinolaryngology, 2013/06

1801

He walked with confidence into the wilderness of life: a tribute to Philip E. Greenman, DO (1928-2013)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text


1803

Sham manual medicine protocol for cervical strain-counterstrain research
Brose, S. W., Jennings, D. C., Kwok, J., Stuart, C. L., O', Connell, S. M., Pauli, H. A., Liu, B.
PM&R: The Journal of Injury, Function and Rehabilitation, 2013/05

1804

Severity of Irritable Bowel Syndrome Symptoms Is Reduced by Osteopathy
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1805

Manual Therapy May Benefit Women With Interstitial Cystitis and Pelvic Floor Pain
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1806

Response
Suminski, R. R., Wasserman, J. A., Guillory, V. J., Hendrix, D., May, L. E.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1807

Effect of osteopathic manipulative treatment on length of stay in a population of preterm infants: a randomized controlled trial
Cerritelli, F., Pizzolorusso, G., Ciardelli, F., La Mola, E., Cozzolino, V., Renzetti, C., D'Incecco, C., Fusilli, P., Sabatino, G., Barlafante, G.
BMC Pediatrics, 2013/04
Free full text

1808

Trial designs and exploration of the placebo response
Dieppe, P.
Complementary Therapies in Medicine, 2013/04
Free full text

1809

Osteopathic postdoctoral training institutions and academic sponsorship
Biszewski, M.
The Journal of the American Osteopathic Association, 2013/04
Free full text


1811

Bibliometric measures and National Institutes of Health funding at COMs, 2006-2010
Gugliucci, A.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1812

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1813

Impact indices shed false light
McDonald, R. G.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1814

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1815

The effects of experience on the inter-reliability of osteopaths to detect changes in posterior superior iliac spine levels using a hidden heel wedge
Sutton, C., Nono, L., Johnston, R. G., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2013/04

1816

Clinical decision making and therapeutic approaches of experienced osteopaths
Thomson, O.
Unpublished PhD thesis, 2013/04
Free full text



1819

Clinical reasoning and therapeutic approaches of experienced osteopaths
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

1820

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03




1824

Special issue: Osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2013/03

1825

Electromyographic responses of deep thoracic transversospinalis muscles to osteopathic manipulative interventions
Fryer, G., Bird, M., Robbins, B., Johnson, J. C.
International Journal of Osteopathic Medicine, 2013/03



1828

Osteopathic manipulative treatment of pes anserine bursitis using the triple technique: A case report
Chmielewski, R., Peña, N., Capalbo, G.
The AAO Journal, 2013/03
Free full text


1830

Achieving Effective and Efficient Musculoskeletal Pain Relief Through TCM and OMM
Moy, C., Yu, J., Chiu, R., Hwang, Y. C., Lin, W., Lin, S.L., Burns, J., Lin, A.
The Journal of the American Osteopathic Association, 2013/03


1832

Is craniosacral therapy effective for migraine? Tested with HIT-6 Questionnaire
Arnadottir, T. S., Sigurdardottir, A. K.
Complementary Therapies in Clinical Practice, 2013/02

1833

How patients choose osteopaths: a mixed methods study
Bishop, F. L., Bradbury, K., Hj Jeludin, N. N., Massey, Y., Lewith, G. T.
Complementary Therapies in Medicine, 2013/02

1834

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text

1835

Fracture healing with osteopathy in traditional Mongolian medicine
Zhao, N., Wang, M., Li, X.
Journal of Traditional Chinese Medicine, 2013/02
Free full text


1837

Abdominal Visceral Manipulation Prevents and Reduces Peritoneal Adhesions
Seffinger, M. A., Martin, A. J.
The Journal of the American Osteopathic Association, 2013/01
Free full text





1842

Response to “Geographic patterns in primary care visits provided by osteopathic physicians“
Fordyce, M. A., Chen, F. M., Doescher, M. P., Hart, L. G.
Family Medicine, 2013/01
Free full text

1843

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text


1845

A comparative study of cervical hysteresis characteristics after various osteopathic manipulative treatment (OMT) modalities
Barnes, P. L., Laboy, F., Noto-Bell, L., Ferencz, V., Nelson, J., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2013/01

1846

Visceral massage reduces postoperative ileus in a rat model
Chapelle, S. L., Bove, G. M.
Journal of Bodywork and Movement Therapies, 2013/01




1850

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12

1851

Methods of assessment used by osteopathic educational institutions
Vaughan, B., Sullivan, V., Gosling, C., McLaughlin, P., Fryer, G., Wolff, M., Gabb, R.
International Journal of Osteopathic Medicine, 2012/12

1852

A systematic review to evaluate the clinical benefits of craniosacral therapy
Jäkel, A., von Hauenschild, P.
Complementary Therapies in Medicine, 2012/12

1853

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text


1855

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1856

Establishing the content validity of palpatory examination for the assessment of the lumbar spine using ultrasonography: a pilot study
Shaw, K. A., Dougherty, J. J., Treffer, K. D., Glaros, A. G.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1857

Depression, somatization, and somatic dysfunction in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Gatchel, R. J., Kearns, C. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1858



1860

Suture restriction of the temporal bone as a risk factor for acute otitis media in children: cohort study
Morin, C., Dorion, D., Moutquin, J.M., Levasseur, M.
BMC Pediatrics, 2012/11
Free full text

1861

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1862

Bibliometric measures and National Institutes of Health funding at colleges of osteopathic medicine, 2006-2010
Suminski, R. R., Hendrix, D., May, L. E., Wasserman, J. A., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/11
Free full text



1865

What is 'fascia'? A review of different nomenclatures
Schleip, R., Jager, H., Klingler, W.
Journal of Bodywork and Movement Therapies, 2012/10
Free full text





1870

Osteopathic manipulative treatment in obese patients with chronic low back pain: a pilot study
Vismara, L., Cimolin, V., Menegoni, F., Zaina, F., Galli, M., Negrini, S., Villa, V., Capodaglio, P.
Manual Therapy, 2012/10
Free full text


1872

Heterotaxien in der menschlichen Entwicklung
(Heterotaxies in human development)
Doll, S.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10

1873

Combined manual therapy techniques for the treatment of women with infertility: a case series
Kramp, M. E.
The Journal of the American Osteopathic Association, 2012/10
Free full text

1874


1875

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text


1877

Osteopathic education: Editorial call for papers
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2012/09

1878

Consent and information exchange – A burden or opportunity?
Vogel, S.
International Journal of Osteopathic Medicine, 2012/09



1881

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving the quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Gulisano, V., Orfei, S.
Clinical Cases in Mineral and Bone Metabolism, 2012/09
Free full text

1882

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text

1883

Advancing osteopathic medicine through research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2012/09
Free full text

1884

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text

1885

Consent, competence and confidentiality for children and young people: Case problems from osteopathic practice
Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2012/09


1887

Osteopathy improves the severity of irritable bowel syndrome: a pilot randomized sham-controlled study
Florance, B. M., Frin, G., Dainese, R., Nebot-Vivinus, M. H., Marine Barjoan, E., Marjoux, S., Laurens, J. P., Payrouse, J. L., Hebuterne, X., Piche, T.
European Journal of Gastroenterology & Hepatology, 2012/08
Free full text

1888

Preventative Osteopathic Manipulative Treatment and the Elderly Nursing Home Resident: A Pilot Study
Snider, K. T., Snider, E. J., Johnson, J. C., Hagan, C., Schoenwald, C.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1889

Touch: vital to patient-physician relationships
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/08
Free full text


1891

Packende Fachartikel – So geht es
(Writing gripping professional articles - Here's how)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1892

Spiritualität in der Osteopathie
(Spirituality in osteopathy)
Schantl, G.
Unpublished MSc thesis, 2012/07
Free full text

1893

From clinical experience to a model for the human fascial system
Day, J. A., Copetti, L., Rucli, G.
Journal of Bodywork and Movement Therapies, 2012/07

1894

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1895

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1896

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1897

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1898

Is the methodological quality of trials on spinal manipulative therapy for low-back pain improving?
Rubinstein, S. M., Terwee, C. B., de Boer, M. R., van Tulder, M. W.
International Journal of Osteopathic Medicine, 2012/06

1899

A consideration of the elbow as a tensegrity structure
Scarr, G.
International Journal of Osteopathic Medicine, 2012/06

1900

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06




1904

Rigor in medical writing: quoting accurately
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text

1905

Osteopathic manipulative treatment in pregnant women
Lavelle, J. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text


1907


1908

Thanks but no thanks: how denial of osteopathic service in the world wars shaped the profession
Schriner, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text

1909

The ART of palpation?
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2012/04
Free full text

1910

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text

1911

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text

1912

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text



1915

Osteopathie und Wissenschaft
(Osteopathy and science)
Liem, T., Hilbrecht, H., Schmidt, T.
Osteopathische Medizin, 2012/03

1916

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03

1917

Reflex Relationships of Paravertebral Muscles
Elbe, J. N.
The AAO Journal, 2012/03
Free full text

1918

Spontaneous Release by Positioning
Jones, L. H.
The AAO Journal, 2012/03
Free full text

1919

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text

1920

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03

1921

Reporting new developments in sacroiliac imaging and lymphatic pump techniques
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2012/03


1923

Osteopathic manipulative treatment effectiveness in severe chronic obstructive pulmonary disease: a pilot study
Zanotti, E., Berardinelli, P., Bizzarri, C., Civardi, A., Manstretta, A., Rossetti, S., Fracchia, C.
Complementary Therapies in Medicine, 2012/02-04
Free full text





1928

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text

1929

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02

1930

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02



1933

Visceral mobilization can lyse and prevent peritoneal adhesions in a rat model
Bove, G. M., Chapelle, S. L.
Journal of Bodywork and Movement Therapies, 2012/01


1935

Use of therapies other than disease-modifying agents, including complementary and alternative medicine, by patients with multiple sclerosis: a survey study
Stoll, S. S., Nieves, C., Tabby, D. S., Schwartzman, R.
The Journal of the American Osteopathic Association, 2012/01
Free full text

1936

Cranial osteopathic manipulative medicine's growing evidence base
King, H. H.
The Journal of the American Osteopathic Association, 2012/01
Free full text




1940

Towards a more international community in osteopathy
Moran, R. W.
International Journal of Osteopathic Medicine, 2011/12

1941

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12

1942

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text

1943

Background and methodology of the Osteopathic Survey of Health Care in America 2010 (OSTEOSURV 2010)
Licciardone, J. C., Kearns, C. M., Ruggiere, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text

1944



1946

What is health? What is disease? Thoughts on a complex issue
Flatscher, M., Liem, T.
The AAO Journal, 2011/12
Free full text

1947

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text



1950

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text

1951

Innenstrukturen des Thorax
(Internal structures of the thorax)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10


1953

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09

1954

The effect of strain counterstrain (SCS) on forearm strength compared to sham positioning
Wong, C. K., Moskovitz, N., Fabillar, R.
International Journal of Osteopathic Medicine, 2011/09

1955

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text


1957

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text




1961

Call for papers: An invitation to contribute to a special issue on osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2011/09



1964

Eating our seed corn, again!
Berkowitz, M. R.
The AAO Journal, 2011/09
Free full text


1966

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09

1967

Criterios de calidad en investigación osteopática (III)
(Quality criteria for osteopathic research (III))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/09

1968

What Drew You to Osteopathic Medicine? A Survey of Osteopathic Medical Students From 10 Schools
Draper, B. B., Johnson, J. C., Chamberlain, N.
The Journal of the American Osteopathic Association, 2011/08

1969

Using Palpation Technology Feedback to Improve Interexaminer Reliability
Ferencz, V., Klucka, G. M., Myers, N., Nelson, J., Vardy, T., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2011/08

1970

Lymphatic Pump Treatment of Rats With Adjuvant-Induced Arthritis
Shah, P., Zanotti, B., Woods, J. M., Volin, M.
The Journal of the American Osteopathic Association, 2011/08

1971

Osteopathic Medical Students' Attitude Toward Complementary and Alternative Medicine
Shubrook, J. H., Kanadiya, M. K.
The Journal of the American Osteopathic Association, 2011/08



1974

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06

1975

Research: A way of helping us be less wrong
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2011/06

1976

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06

1977

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text


1979

Influence of craniosacral therapy on anxiety, depression and quality of life in patients with fibromyalgia
Mataran-Penarrocha, G. A., Castro-Sanchez, A. M., Garcia, G. C., Moreno-Lorenzo, C., Carreno, T. P., Zafra, M. D.
Evidence-Based Complementary and Alternative Medicine, 2011/06
Free full text

1980





1984

The effectiveness of osteopathic treatment in women with endometriosis-related pain
Schneider-Milo, U.
Unpublished MSc thesis, 2011/06
Free full text

1985

Palpatory accuracy of lumbar spinous processes using multiple bony landmarks
Snider, K. T., Snider, E. J., Degenhardt, B. F., Johnson, J. C., Kribs, J. W.
Journal of Manipulative and Physiological Therapeutics, 2011/06
Free full text


1987

Diagnostic Palpation in Osteopathic Medicine: A Putative Neurocognitive Model of Expertise
Esteves, J. E. d. J.
Unpublished PhD thesis, 2011/06
Free full text


1989

Patients’ perceptions of post-treatment experiences in osteopathy: A qualitative study using focus groups
Bright, P., Rajendran, D., Bettles, S., Carnes, D., Mullinger, B.
European Journal of Integrative Medicine, 2011/06
Free full text

1990

The immediate effects of muscle energy technique on posterior shoulder tightness: a randomized controlled trial
Moore, S. D., Laudner, K. G., McLoda, T. A., Shaffer, M. A.
Journal of Orthopaedic & Sports Physical Therapy, 2011/06
Free full text

1991

Flawed science is not evidence-based osteopathic medicine
Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text







1998

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1999

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?: a pilot study
Newberry, M. A., Bowen, G. S., Trubey, K., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2011/05
Free full text




2003

One osteopathic physician's path through an ACGME-Accredited Residency
Patchett, D. C.
The Journal of the American Osteopathic Association, 2011/05
Free full text


2005

Criterios de calidad en investigación osteopática (II)
(Quality criteria in osteopathic research (II))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/05

2006

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text

2007

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text

2008

Osteopathic Issues Raised by the September 2010 JAOA
Patriquin, D. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

2009

Understanding osteopathic medical school applicants and the class of 2014
Ramos, R. L., Zhou, C., Hasan, M., Herrera, S. J., Bono, N. A., Hallas, B. H.
The Journal of the American Osteopathic Association, 2011/04
Free full text

2010

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text

2011

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

2012

Evaluation of colleges of osteopathic medicine: training for the evaluators
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text

2013

A rich seam
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04


2015

An Osteopathic Approach to Chronic Sinusitis
Lee-Wong, M., Karagic, M., Doshi, A., Gomez, S., Resnick, D.
Journal of Allergy & Therapy, 2011/04
Free full text


2017

Bringing fresh perspective to muscle energy technique
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2011/03

2018

Helical tensegrity as a structural mechanism in human anatomy
Scarr, G.
International Journal of Osteopathic Medicine, 2011/03

2019

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text

2020

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text


2022

Osteopathie an Kliniken (Interviews)
(Osteopathy in hospitals)
Hogrefe, H.C., Graf, A., Bockius, D.
Osteopathische Medizin, 2011/03




2026

Osteopathic Scholarship, Research and Publication
Berkowitz, M. R.
The AAO Journal, 2011/03
Free full text




2030



2032

Low back pain, somatic dysfunction, and segmental bone mineral density T-score variation in the lumbar spine
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J.
The Journal of the American Osteopathic Association, 2011/02
Free full text

2033

Management of suppurative cervical lymphadenitis in a healthy 24-year-old man
Hernandez, M., Chowdhury, R., Woods, J., Cabrera, J., Hardigan, P. C.
The Journal of the American Osteopathic Association, 2011/01
Free full text

2034

Student abstracts and poster competitions: encouraging research
Prinsen, J. K.
The Journal of the American Osteopathic Association, 2011/01
Free full text

2035

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text

2036

A randomized controlled trial investigating the effects of craniosacral therapy on pain and heart rate variability in fibromyalgia patients
Castro-Sánchez, A. M., Matarán-Peñarrocha, G. A., Sánchez-Labraca, N., Quesada-Rubio, J. M., Granero-Molina, J., Moreno-Lorenzo, C.
Clinical Rehabilitation, 2011/01

2037

Osteopathy and (hatha) yoga
Liem, T.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text



2040

“D.O. or die“: identity negotiation among osteopathic medical students
Norander, S., Mazer, J. P., Bates, B. R.
Health Communication, 2011/01
Free full text

2041

Effect of Spinal Manipulation on Corticospinal and Stretch Reflex Excitability in Patients With Chronic Low Back Pain
Goss, D. A., Walkowski, S. A., Ross, A. J., Thomas, J. S., Hoffman, R. L., Clark, B. C.
The Journal of the American Osteopathic Association, 2011/01

2042

Osteopathic Manipulative Medicine in the Andes Mountains of Peru
Harding, S. E., Morse, J. S., Berkowitz, M. R., Tidwell, C., Bishop, K., Tidewell, B., Cruz, M. L., Morris-Mitchell, M.
The Journal of the American Osteopathic Association, 2011/01

2043

OMM and TCM: Comparisons of Manipulative Treatment
Zhang, A., Chen, S., Yen, H.R.
The Journal of the American Osteopathic Association, 2011/01


2045

Structural or cranial osteopathy: Factors influencing practitioner preference
Norrie, J.
Unpublished MSc thesis, 2011/01
Free full text

2046

Women’s attitudes to and experiences of osteopathic care during pregnancy
Kurth, A.
Unpublished MSc thesis, 2011/01
Free full text

2047


2048

What are the factors that guide an osteopath during the process of technique choice?
Albertson, P.
Unpublished MSc thesis, 2011/01
Free full text

2049

Criterios de calidad en investigación osteopática (I)
(Quality criteria for osteopathic research (I))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/01

2050

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011

2051

Osteopathic Treatment for Irritable Bowel Syndrome. A Systematic Review.
Müller, A.
Unpublished MSc thesis, 2011
Free full text


2053


2054

On the Role of the Glossary
Berkowitz, M. R.
The AAO Journal, 2010/12
Free full text


2056

Osteopathic Medicine's Holistic Approach Is More Important Than Ever
Goldberg, P. M.
The Journal of the American Osteopathic Association, 2010/12
Free full text

2057

Progression through osteopathic training in Australia: The student experience
Hartup, J. K., Murphy, R. A., Plowman, L. M., Myers, R.
International Journal of Osteopathic Medicine, 2010/12


2059

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 2: Treatment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12

2060

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 1: Assessment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12

2061

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text

2062

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text

2063

Integrating Osteopathic Principle into Daily Practice
Hruby, R. J.
The AAO Journal, 2010/12
Free full text

2064

How the AOA established the first national guidelines for OMT
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2010/11
Free full text

2065

Reliability of bony anatomic landmark asymmetry assessment in the lumbopelvic region: application to osteopathic medical education
Stovall, B. A., Kumar, S.
The Journal of the American Osteopathic Association, 2010/11
Free full text

2066

Das Schädeldach als Tensegrity-Struktur
(The cranial roof as a tensegrity structure)
Scarr, G., Hinz, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10


2068

Management of benign paroxysmal positional vertigo with the canalith repositioning maneuver in the emergency department setting
Burmeister, D. B., Sacco, R., Rupp, V.
The Journal of the American Osteopathic Association, 2010/10
Free full text

2069

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests over a 4-month period
Degenhardt, B. F., Johnson, J. C., Snider, K. T., Snider, E. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text

2070

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text


2072

Test-dependent osteopathic treatment of patients with tinnitus and craniomandibular dysfunctions (CMD): A pre-post pilot trial
Salomon, J., Kronau, S., Moshövel, N., Niggemeier, H., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09/

2073






2078

Tensegrity in der Osteopathie
(Tensegrity in osteopathy)
Pflüger, C.
Osteopathische Medizin, 2010/09

2079

The use of spinal and sacroiliac joint assessment and treatment procedures within the British osteopathic profession
Fryer, G., Johnson, J. C.
International Journal of Osteopathic Medicine, 2010/09


2081

Hamo-Study 3, Phase 1: Effects of sternotomy on the mobility of the heart under influence of respiration at 3-months postoperative
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2010/09

2082

Adverse events and treatment reactions in osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2010/09

2083

Exploring European osteopathic identity: An analysis of the professional websites of European osteopathic organizations
Wagner, C., van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2010/09



2086

Investigación en osteopatía en el ámbito internacional
(Research in osteopathy at the international level)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/09

2087

Differential Effects of Suboccipital Inhibition and Fourth Ventricle Compression On Heart Rate Variability: Evidence For Bi-Directional Modulation Of Autonomic Tone
Snider, E. J., Snider, K. T., Halma, K. D., Fossum, C., Fryer, G., Yang, Q., Mueller, G., Bluml, E. M., Purcell, E.
The Journal of the American Osteopathic Association, 2010/08

2088

Assessment of Anterior Superior Iliac Spine Asymmetry by Osteopathic Predoctoral Fellows and Osteopathic Physicians
Stovall, B. A., Bae, S., Kumar, S.
The Journal of the American Osteopathic Association, 2010/08

2089

Osteopathic manipulative treatment and vertigo: a pilot study
Fraix, M.
PM&R: The Journal of Injury, Function and Rehabilitation, 2010/07

2090

Characteristics of pediatric patients seen in medical school-based osteopathic manipulative medicine clinics
Lund, G., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/07
Free full text

2091

Defining osteopathic medicine: can you put your finger on it?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2010/07
Free full text

2092


2093

What is 'manipulation'? A reappraisal
Evans, D. W., Lucas, N.
Manual Therapy, 2010/06
Free full text

2094

Comparison of muscle energy technique and positional release therapy in acute low back pain – RCT
Naik, P. P., Heggannavar, A., Khatri, S. M.
Indian Journal of Physiotherapy & Occupational Therapy, 2010/06
Free full text

2095

Evidence Does Not Grow Stale with Age
Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text




2099

A delayed and innocuous presentation of odontoid peg fracture – Implications for osteopaths
Chakraverty, J. K., Snelling, N. J., Thomas, G., Uzoigwe, C.
International Journal of Osteopathic Medicine, 2010/06

2100

Mindfulness meditation practise as a healthcare intervention: A systematic review
Mars, T. S., Abbey, H.
International Journal of Osteopathic Medicine, 2010/06



2103

The challenges of primary care and innovative responses in osteopathic education
Shannon, S. C., Ferretti, S. M., Wood, D., Levitan, T.
Health Affairs, 2010/05



2106

Brief report of a clinical trial on the duration of middle ear effusion in young children using a standardized osteopathic manipulative medicine protocol
Steele, K. M., Viola, J., Burns, E., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text

2107



2109

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text


2111

Call to action: aggressively managing lipid levels
Carr, L. L.
The Journal of the American Osteopathic Association, 2010/04
Free full text

2112

Effect of osteopathy in the cranial field on visual function--a pilot study
Sandhouse, M. E., Shechtman, D., Sorkin, R., Drowos, J. L., Caban-Martinez III., A. J., Patterson, M. M., Shallo-Hoffmann, J., Hardigan, P., Snyder, A.
The Journal of the American Osteopathic Association, 2010/04
Free full text

2113

Musculoskeletal dysfunction and drop foot: diagnosis and management using OMM
Sucher, B. M.
The Journal of the American Osteopathic Association, 2010/04
Free full text


2115

Kontraktilität von Faszien
(Contractility of Fascias – How is This Behavior Possible?)
Brand, E.M.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04




2119

Osteopathic neuromuscular re-abilitation
Lederman, E.
International Journal of Osteopathic Medicine, 2010/03

2120

Osteopathy 2.0: Osteopathy and the new web
Lucas, N. P.
International Journal of Osteopathic Medicine, 2010/03

2121

Composite sacroiliac joint pain provocation tests: A question of clinical significance
McGrath, M. C.
International Journal of Osteopathic Medicine, 2010/03

2122

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text

2123

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text


2125

Osteopathic medical education in 2010: another decade of growth
Shannon, S. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

2126

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

2127

Use of osteopathic manipulative treatment to manage compensated trendelenburg gait caused by sacroiliac somatic dysfunction
Gilliss, A. C., Swanson II., R. L., Janora, D., Venkataraman, V.
The Journal of the American Osteopathic Association, 2010/02
Free full text

2128

The myth of core stability
Lederman, E.
Journal of Bodywork and Movement Therapies, 2010/01

2129

Fascia: A missing link in our understanding of the pathology of fibromyalgia
Liptan, G. L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text


2131

Accreditation standards of DO- and MD-granting medical schools: an incomplete comparison
Hunt, D., Barzansky, B., Sabalis, R.
Academic Medicine, 2010/01
Free full text

2132

Relationship between COMLEX and USMLE scores among osteopathic medical students who take both examinations
Chick, D. A., Friedman, H. P., Young, V. B., Solomon, D.
Teaching and Learning in Medicine, 2010/01



2135

Osteopathic Medicine and Primary Care: one journal, two audiences
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2010/01
Free full text









2144

Perception of osteopathic medicine among allopathic physicians in the deep central southern United States
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text

2145

Musculoskeletal dysfunction and drop foot: diagnosis and management using osteopathic manipulative medicine
Lavelle, J. M., McKeigue, M. E.
The Journal of the American Osteopathic Association, 2009/12
Free full text

2146

NICE clinical guidelines. Low back pain: The early management of persistent non-specific back pain
Vogel, S.
International Journal of Osteopathic Medicine, 2009/12
Free full text

2147

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text





2152

Discrimination against DOs alive and well
Hoegerl, C.
The Journal of the American Osteopathic Association, 2009/12
Free full text

2153

Osteopathic manipulative treatment in the management of notalgia paresthetica
Richardson, B. S., Way, B. V., Speece III., A. J.
The Journal of the American Osteopathic Association, 2009/11
Free full text

2154

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text

2155

Complementary and alternative health care use in young children with physical disabilities waiting for rehabilitation services in Canada
April, K. T., Feldman, D. E., Zunzunegui, M. V., Descarreaux, M., Grilli, L.
Disability and Rehabilitation, 2009/11





2160

Personality types and performance: COMLEX-USA Level 2-CE
Getz, R., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2009/10
Free full text

2161

Personality types and performance on aptitude and achievement tests
Kimmelman, M., Giacobbe, J., Switala, C. A.
The Journal of the American Osteopathic Association, 2009/10
Free full text



2164

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

2165

Management of chronic posttraumatic headache: a multidisciplinary approach
Channell, M. K., Mueller, L. L., Hahn, R.
The Journal of the American Osteopathic Association, 2009/09
Free full text

2166

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09

2167

Editorial - Of originality, breathing dysfunction and clinical education
Lucas, N. P., Moran, R.
International Journal of Osteopathic Medicine, 2009/09


2169

Efectos de la variación muscular en la prueba neurodinámica del nervio mediano en una población sana con arco axilar de Langer
(The impact of muscular variation on the neurodynamic test for the median nerve in a healthy population with Langer's axillary arch)
Van Hoof, T., Vangestel, C., Forward, M., Eng, C., Verhaeghe, B., Van Thilborgh, L., Plasschaert, F., de Muynck, M., Vanderstraeten, G., D&rsquo, Herde, K.
Osteopatía Científica, 2009/09

2170

La langue : déglutition, fonctions oro-faciales, croissance crânio-faciale
(The tongue: deglutition, orofacial functions and craniofacial growth)
Landouzy, J.M., Sergent Delattre, A., Fenart, R., Delattre, B., Claire, J., Biecq, M.
International Orthodontics, 2009/09

2171

Hamstring flexibility in young women following passive stretch and muscle energy technique
Shadmehr, A., Hadian, M. R., Naiemi, S. S., Jalaie, S.
Journal of Back and Musculoskeletal Rehabilitation, 2009/09

2172

Interest in rural medicine among osteopathic residents and medical students
Colegrove, D. J., Whitacre, B. E.
Rural and Remote Health, 2009/09



2175

Inter-examiner reliability of palpation for tissue texture abnormality in the thoracic paraspinal region
Paulet, T., Fryer, G.
International Journal of Osteopathic Medicine, 2009/09

2176

Principios de la osteopatía en la investigación
(Osteopathic principles in research)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/09


2178

The use of osteopathic manipulative treatment as adjuvant therapy in patients with peripheral arterial disease
Lombardini, R., Marchesi, S., Collebrusco, L., Vaudo, G., Pasqualini, L., Ciuffetti, G., Brozzetti, M., Lupattelli, G., Mannarino, E.
Manual Therapy, 2009/08
Free full text

2179

Use and Spread of Osteopathic Medical Literature and Research Findings
Lipoff, D., Sharma, S., Sharma, S., Hallas, B. H., Ramos, R. L.
The Journal of the American Osteopathic Association, 2009/08

2180

Spiritual and Religious Characteristics of Osteopathic Medical Students
Workman, G. M., Lee, M. M., Nichols, K. J., Workman, D. E., Christian, V. L., Orlinsky, D. E.
The Journal of the American Osteopathic Association, 2009/08

2181

Headache (chronic tension-type)
Krishnan, A., Silver, N.
BMJ Clinical Evidence, 2009/07
Free full text


2183

Magenulkus
(Gastric ulcer)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

2184

Sinusitis
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

2185

Measuring awareness, interest, and involvement in the osteopathic community through board certification: a survey of DO residents in ACGME-accredited training programs
Scott, S. C., O'Connor, E. M., Marlow, R. A.
The Journal of the American Osteopathic Association, 2009/06
Free full text

2186

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text

2187

Clinical guidelines, adverse events and SQUID
Lucas, N. P., Moran, R.
International Journal of Osteopathic Medicine, 2009/06

2188

Die gewollte Spaltung
(Deliberate division)
Gröbmüller, J.
Osteopathische Medizin, 2009/06

2189

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text


2191

Osteopathic postdoctoral training institutions: a decentralized model for facilitating accreditation and program quality
Peska, D. N., Opipari, M. I., Watson, D. K.
Academic Medicine, 2009/06
Free full text








2199


2200

Contraindications in Osteopathy
Gatterbauer, A.
Unpublished MSc thesis, 2009/05
Free full text

2201

Treatment approaches in osteopathy for the therapy of migraine
Michal, I.
Unpublished MSc thesis, 2009/05
Free full text


2203

The Changing Face of Medical Education: The Role of Religion, Integrative Medicine and Osteopathy
Grossoehme, D. H., Ragsdale, J., Dixon, C., Berz, K., Zimmer, M.
The Open Medical Education Journal, 2009/05
Free full text

2204

Osteopatía basada en la evidencia
(Evidence-based osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/05

2205

Intent to “teach“ and pay to play in osteopathic medical education
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/04
Free full text

2206




2209

La investigación, el desarrollo y la innovación en osteopatía
(Research, development and innovation in osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/04


2211

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text

2212

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03

2213

Osteopathic medical education in 2009: sails set for improved healthcare?
Shannon, S. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text

2214

Introducing the new masterclass section
Moran, R.
International Journal of Osteopathic Medicine, 2009/03

2215

Evolution of colleges of osteopathic medicine: a discussion of the COCA's “substantive change“ policies
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text

2216

The Use Of Heel Lifts and Custom Orthotics In Reducing Self-Reported Chronic Musculoskeletal Pain Scores
Lipton, J. A., Flowers-Johnson, J., Bunnell, M. T., Carter, L.
The AAO Journal, 2009/03
Free full text

2217

Osteopathic Manipulative Treatment as Adjuvant Therapy in Peripheral Arterial Disease.
Lombardini, R., Collebrusco, L.
Manual Therapy, 2009/03
Free full text



2220

Professional satisfaction among new osteopathic family physicians: a survey-based investigation of residency-trained graduates
Simpson, C., Cutright, M., Heh, V., Simpson, M. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text


2222

Osteopathic Medicine and Primary Care looks forward to 2009
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/02
Free full text





2227

Criteria to Determine Intervals of Treatment
Halasz, C.
Unpublished MSc thesis, 2009/02
Free full text


2229

Osteopathy - the way from therapy to prevention
May, M.
Unpublished MSc thesis, 2009/02
Free full text

2230

What do patients expect, who come to an osteopathic clinic?
Meuser, A.
Unpublished MSc thesis, 2009/02
Free full text


2232


2233

Attitudes and beliefs of New Zealand osteopaths towards chronic pain
Carrington, A. L.
Unpublished MSc thesis, 2009/01
Free full text


2235

Reliability of visual assessment of forward head posture in standing
Aitken, A. W.
Unpublished MSc thesis, 2009/01
Free full text

2236

Collaboration and excellence in osteopathic medical research
Manion, K. M.
The Journal of the American Osteopathic Association, 2009/01
Free full text

2237

Changes in masseter muscle trigger points following strain-counterstrain or neuro-muscular technique
Ibanez-Garcia, J., Alburquerque-Sendin, F., Rodriguez-Blanco, C., Girao, D., Atienza-Meseguer, A., Planella-Abella, S., Fernandez-de-Las Penas, C.
Journal of Bodywork and Movement Therapies, 2009/01

2238

Treating patellar tendinopathy with Fascial Manipulation
Pedrelli, A., Stecco, C., Day, J. A.
Journal of Bodywork and Movement Therapies, 2009/01

2239

Comparing Changes in Serum Nitric Oxide Levels and Heart Rate After Osteopathic Manipulative Treatment (OMT) Using the Dalrymple Pedal Pump to Changes Measured After Active Exercise
Overberger, R., Hoyt, J. A., Daghigh, F., Bell, M., Schoenfeldt, B., Bailey, J. W., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2009/01



2242



2244

Exploring the use of exercise therapy in UK osteopathic practice
Zamani, J., Vogel, S., Moore, A., Lucas, K.
International Journal of Osteopathic Medicine, 2008/12

2245

Influence of a mobilization of the mesentery on the hepatic portal vein capacity measured with doppler echo
van Dun, P. L. S., Dobbelaere, E., Dillies, P., Inghelbrecht, F., Van Eeghem, P., Steyaert, L., Danse, E., Rosseel, Y.
International Journal of Osteopathic Medicine, 2008/12

2246

The effects of lumbar spine high velocity low amplitude thrust (HVLAT) manipulation on upper limb cutaneous blood supply
Sugrue, N., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12

2247

Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with chronic rhino sinusitis (CRS)? A randomized controlled trial
Steinbauer, U., Roos, S., Amann, P., Schwerla, F., Resch, K.L.
International Journal of Osteopathic Medicine, 2008/12


2249

Hamo-study i: investigation of the effect of breathing on the position of the heart
Roncada, G., Bijnens, E., Dendale, P., Buekens, J.
International Journal of Osteopathic Medicine, 2008/12

2250

Hamo-study ii: effects of sternotomy on the mobility of the heart under influence of respiration
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2008/12

2251

The standing flexion test is reproducible but fails to reveal sacroiliac joint ankylosis
Mandara, A., Sosio, S., Di Mattia, C.
International Journal of Osteopathic Medicine, 2008/12


2253

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12

2254

Research underpins the evidence base for osteopathic medicine
Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12
Free full text

2255

Defining adverse events in manual therapies
Carnes, D., Underwood, M.
International Journal of Osteopathic Medicine, 2008/12

2256

Three pathways to a physician career: applicants to U.S. MD and DO schools and U.S. Citizen applicants to international medical schools
Jolly, P., Garrison, G., Boulet, J. R., Levitan, T., Cooper, R. A.
Academic Medicine, 2008/12

2257

Mathematical analysis of applied loads on skeletal muscles during manual therapy
Chaudhry, H., Bukiet, B., Findley, T.
The Journal of the American Osteopathic Association, 2008/12
Free full text

2258

Response: Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Fitzgerald, M.
The Journal of the American Osteopathic Association, 2008/12
Free full text

2259

Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Lanier, W. L.
The Journal of the American Osteopathic Association, 2008/12
Free full text



2262

La osteopatía como método científico
(Osteopathy as a scientific method)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2008/12


2264

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12

2265

The hands of the osteopaths. Thinking fingers. Their special training
Hansak, S.
Unpublished MSc thesis, 2008/11
Free full text








2273

Framingham–Studie
(Framingham Study)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

2274

Functional gestational problems and osteopathy
Steinbauer, S.
Unpublished MSc thesis, 2008/11
Free full text

2275

Patient perception of osteopathic manipulative treatment in a hospitalized setting: a survey-based study
Pomykala, M., McElhinney, B., Beck, B. L., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2008/11
Free full text







2282

Echinacea purpurea and osteopathic manipulative treatment in children with recurrent otitis media: a randomized controlled trial
Wahl, R. A., Aldous, M. B., Worden, K. A., Grant, K. L.
BMC Complementary and Alternative Medicine, 2008/10
Free full text

2283

Supporting and promoting osteopathic medicine through community-based family practice preceptorships: a survey-based study
Aguwa, M. I., Monson, C. L., Liechty, D. K., Fowler, L. V., Kost, M. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text

2284

Effectiveness of osteopathy in the cranial field and myofascial release versus acupuncture as complementary treatment for children with spastic cerebral palsy: a pilot study
Duncan, B., McDonough-Means, S., Worden, K., Schnyer, R., Andrews, J., Meaney, F. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text




2288

Osteopathic support for a survivor of gastric cancer: A case report
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/09


2290

Aetiology of idiopathic scoliosis. Current biomedical research and osteopathic theories
Lüftinger, M.
Unpublished MSc thesis, 2008/09
Free full text

2291

The Meaning of Tensegrity Principles in Osteopathic Medicine
Pflüger, C.
Unpublished MSc thesis, 2008/09
Free full text

2292

Will the ‘real’ osteopathy please speak up?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/09
Free full text

2293

Commentary on ‘Is there a place for science in the definition of osteopathy’?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09


2295

Intraobserver reliability of cranial strain patterns as evaluated by osteopathic physicians: a pilot study
Halma, K. D., Degenhardt, B. F., Snider, K. T., Johnson, J. C., Flaim, M. S., Bradshaw, D.
The Journal of the American Osteopathic Association, 2008/09
Free full text

2296

Efficacy of Manipulative Treatment for Acute Low Back Pain in Active Duty Military Personnel
Stoll, S. T., Maurer, D., Hensel, K., Cruser, D.
The Journal of the American Osteopathic Association, 2008/08

2297

Osteopathic Manipulative Medicine in the Treatment of Acute Otitis Media Symptoms
Torres, J. W., Mason, D. C., Kaari, J.
The Journal of the American Osteopathic Association, 2008/08

2298

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

2299

Querschnitt– und Längsschnittstudien
(Cross-sectional and longitudinal studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

2300

Sonne statt Krebs?
(Sun instead of cancer?)
Moan, J., Porojnicu, A. C., Dahlback, A., Setlow, R. B.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

2301

Atopische Dermatitis: (osteopathische) Hand anlegen!
(Atopic dermatitis: (osteopathic) hands on!)
Oezbay, I., Reckwerth, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

2302

Evidence-based publications: balancing research mission and our community's needs
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2008/08
Free full text


2304

ED physicians beware when using OMT for patients with motor vehicle injuries
Fletcher, S. A.
The Journal of the American Osteopathic Association, 2008/08
Free full text

2305

Keeping the flames of OMM burning
Hogarty, D. C.
The Journal of the American Osteopathic Association, 2008/08
Free full text

2306

Osteopathic Manipulative Treatment for Postoperative Nausea and Vomiting
Schrick-Senasac, S. L., King, H. H.
The Journal of the American Osteopathic Association, 2008/08


2308

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text

2309

Eliminating bad, bad medicine: problems with P4P initiatives
McDonald, R.
The Journal of the American Osteopathic Association, 2008/08
Free full text

2310

Dangers of for-profit education: more than just words
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2008/08
Free full text

2311

Election year's first shot over the bow: reforms needed
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2008/08
Free full text

2312

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text

2313

Relationship of Osteopathic Manipulative Treatment During Labor and Delivery on Selected Maternal Morbidity Outcomes: A Randomized Controlled Trial
Keurentjes, A., Showalter, A., James, C., Vawter, A., Cross, B. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text



2316

Inpatient osteopathic structural examinations: is “red tape“ getting in the way of personalized patient care?
Fennig Jr., G. A., Shubrook Jr., J. H.
The Journal of the American Osteopathic Association, 2008/07
Free full text

2317

DOs need to define value of osteopathic medicine
Snow, R. J., Seffinger, M. A., McGill, S. L., Vincent, R. A.
The Journal of the American Osteopathic Association, 2008/07
Free full text

2318

Role of exercise therapy in osteopathic education, treatment and management
Zamani, J. M.
Unpublished PhD thesis, 2008/07
Free full text

2319

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06

2320

Due thanks, moving forward, and valuing the journey
Vogel, S.
International Journal of Osteopathic Medicine, 2008/06
Free full text

2321

Consistency of standing and seated posture of asymptomatic male adults over a one-week interval: A digital camera analysis of multiple landmarks
Pownall, P. J., Moran, R. W., Stewart, A. M.
International Journal of Osteopathic Medicine, 2008/06


2323

Solitary fibrous pleural tumor
Jenkins, L. A., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2008/06
Free full text

2324

Saying what you mean and meaning what you say
Rogers, F. J.
The Journal of the American Osteopathic Association, 2008/06
Free full text

2325

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text


2327

Constraints to caring: service to medically indigent patients by allopathic and osteopathic physicians
Chirayath, H. T., Wentworth, A. L.
Journal of Health Care for the Poor and Underserved, 2008/05

2328

A randomized controlled trial of the effectiveness of osteopathy-based manual physical therapy in treating pediatric dysfunctional voiding
Nemett, D. R., Fivush, B. A., Mathews, R., Camirand, N., Eldridge, M. A., Finney, K., Gerson, A. C.
Journal of Pediatric Urology, 2008/04
Free full text



2331

Spirituality and medicine: prevalence of spirituality-in-medicine instruction at osteopathic medical schools
McClain, E. K., McClain, R. L., Desai, G. J., Pyle, S. A.
The Journal of the American Osteopathic Association, 2008/04
Free full text





2336

10 Years of research in the journal: What's next?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2008/03
Free full text

2337

Clinical inquiries. Is osteopathic manipulation effective for headaches?
Keays, A. C., Neher, J. O., Safranek, S., Webb, C. W.
The Journal of Family Practice, 2008/03

2338

Pushing bodies through COMs
Lisowsky, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

2339

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03

2340

The importance of monitoring patient's ability to achieve functional tasks in those with musculoskeletal pain
Carnes, D., Underwood, M.
International Journal of Osteopathic Medicine, 2008/03

2341

Osteopathic medical education in 2008: course corrections and new horizons
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/03
Free full text


2343


2344

The Phenomenon Spondylolisthesis from an Osteopathic Point of View
Schiener, M.
Unpublished MSc thesis, 2008/02
Free full text


2346


2347


2348

Pregnancy-related pelvic girdle pain: intertester reliability of 3 tests to determine asymmetric mobility of the sacroiliac joints
van Kessel-Cobelens, A. M., Verhagen, A. P., Mens, J. M., Snijders, C. J., Koes, B. W.
Journal of Manipulative and Physiological Therapeutics, 2008/02
Free full text

2349

Eigenrhythmizität von Blutgefäßen
(The Innate Rhythmicity of Blood Vessels)
Schmid-Schönbein, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02


2351

Doctors’ knowledge of osteopathy in the district of Bregenz
Seewald, S.
Unpublished MSc thesis, 2008/02
Free full text

2352

The Historical Background of the German Law Regulating Health Practitioners
Einenkel, T.
Unpublished MSc thesis, 2008/02
Free full text


2354

Knowing hands converse with an expressive body: An experience of osteopathic touch
Consedine, S.
Unpublished MSc thesis, 2008/01
Free full text


2356

Die Gleitfähigkeit subkutaner Strukturen beim Menschen – eine Einführung
(Introduction to the knowledge of subcutaneous sliding system in humans)
Guimberteau, J. C., Sentucy-Rigall, J., Panconi, B., Bouleau, R., Mouton, P., Bakhach, J.
Osteopathische Medizin, 2008/01





2361

Attitudes toward pay-for-performance initiatives among primary care osteopathic physicians in small group practices
Locke, R. G., Srinivasan, M.
The Journal of the American Osteopathic Association, 2008/01
Free full text



2364

Intertester reliability and validity of motion assessments during lumbar spine accessory motion testing
Landel, R., Kulig, K., Fredericson, M., Li, B., Powers, C. M.
Physical Therapy & Rehabilitation Journal, 2008/01
Free full text


2366

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text

2367

Who are our guests?
Sumesgutner, A.
Unpublished MSc thesis, 2007/12
Free full text

2368

Osteopathic manipulative treatment for pandemic influenza: many questions, few answers
Sanderlin, B. W., Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2007/12
Free full text

2369

An investigation into the side of joint cavitation associated with cervical spine manipulation
Bolton, A., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/12

2370

Is there a place for science in the definition of osteopathy?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/12

2371

Analysis of exercise content in undergraduate osteopathic education – A content analysis of UK curricula
Zamani, J., Vogel, S., Moore, A., Lucas, K.
International Journal of Osteopathic Medicine, 2007/12

2372


2373

Applying osteopathic principles to formulate treatment for patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2007/11
Free full text

2374

Hypermobility and the hypermobility syndrome
Simmonds, J. V., Keer, R. J.
Manual Therapy, 2007/11
Free full text

2375

Using integrative therapies to treat women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2007/11
Free full text


2377



2379

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

2380

Lebensqualität
(Quality of Life)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

2381

Nonprofit and for-profit COMs: investing in the future of osteopathic medicine
Ajluni, P. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text




2385

Occipital Compression and its Potential Uses in Obstetrics
McAfee, S. N., Chila, A. G.
The AAO Journal, 2007/09
Free full text

2386


2387

Role of osteopathic manipulative treatment in altering pain biomarkers: a pilot study
Degenhardt, B. F., Darmani, N. A., Johnson, J. C., Towns, L. C., Rhodes, D. C., Trinh, C., McClanahan, B., DiMarzo, V.
The Journal of the American Osteopathic Association, 2007/09
Free full text

2388

Treatment of irritable bowel syndrome with osteopathy: results of a randomized controlled pilot study
Hundscheid, H. W., Pepels, M. J., Engels, L. G., Loffeld, R. J.
Journal of Gastroenterology and Hepatology, 2007/09
Free full text

2389

Chiropractic through the eyes of physiotherapists, manual therapists, and osteopaths in the Netherlands
Langworthy, J. M., Smink, R. D.
The Journal of Alternative and Complementary Medicine, 2007/09

2390

Attitudes towards Osteopathic Manipulation in Career Choices (ATOMICC)
Dunbar, B. D., Desai, G. J.
The Journal of the American Osteopathic Association, 2007/08

2391

Inter-rater Reliability of Rib Strain-Counterstrain Tenderpoints
Hartinger, J., Cloar, N., Seffinger, M.
The Journal of the American Osteopathic Association, 2007/08

2392

Foot Ankle Biomechanics: Effects of Manipulative Intervention on Plantar Fasciitis Subjects
Morton, A. L., McGrew, A., Burns, J. M., Karodogan, E., Conatser, R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2007/08

2393

Comparing the Effects of Cranial Manipulation on Heart Rate Variability and Traube-Hering-Mayer Waves
Pexton, T., Nelson, K., Glonek, T., Heinking, K., Kappler, R., Sergueef, N.
The Journal of the American Osteopathic Association, 2007/08

2394

Factors Contributing to Osteopathic Manipulation Usage at Army Family Medicine Residency Programs
Platz, K. E., Asplund, C. A.
The Journal of the American Osteopathic Association, 2007/08

2395

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

2396

Medizin und Kreativität
(Medicine and creativity)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

2397

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

2398

Hope for larger study on otitis media
Galgano, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text

2399

Getting “beyond the barriers“ in reforming osteopathic medical education
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2007/07
Free full text

2400

Reported prevalence rates of somatic dysfunction raise an... Heel?
Kotoske, D. E.
The Journal of the American Osteopathic Association, 2007/07
Free full text

2401

COM Accreditation: the Flexner Report revisited
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2007/07
Free full text

2402

Study on recurrent otitis media: potential value vs actual value of OMT
Orenstein, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text

2403

Ehlers Danlos Syndrome: A Case Report
Kumar, A., Stoll, S. T., Hensel, K.
The AAO Journal, 2007/06
Free full text

2404

Is estimating USMLE performance useful?
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2007/06
Free full text


2406

Should your GP be an osteopath? Patients' views of an osteopathy clinic based in primary care
Westmoreland, J. L., Williams, N. H., Wilkinson, C., Wood, F., Westmoreland, A.
Complementary Therapies in Medicine, 2007/06
Free full text

2407

Researching osteopathy: Who is responsible?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/06

2408


2409

The effects of high-velocity, low-amplitude manipulation and muscle energy technique on suboccipital tenderness
Hamilton, L., Boswell, C., Fryer, G.
International Journal of Osteopathic Medicine, 2007/06



2412

Step forward to stop bird flu
Austin, D. L.
The Journal of the American Osteopathic Association, 2007/05
Free full text

2413

Repatriating DOs with MD-affiliated residencies
Forte, T. E.
The Journal of the American Osteopathic Association, 2007/05
Free full text

2414

Attitudes to back pain amongst musculoskeletal practitioners: a comparison of professional groups and practice settings using the ABS-mp
Pincus, T., Foster, N. E., Vogel, S., Santos, R., Breen, A., Underwood, M.
Manual Therapy, 2007/05

2415

Competence levels in musculoskeletal medicine: a call to action
Ruane, J. J.
The Journal of the American Osteopathic Association, 2007/05
Free full text

2416

Irresistible indexes for somatic dysfunction
Sucher, B. M.
The Journal of the American Osteopathic Association, 2007/05
Free full text



2419

Die Motrizität
(Motricity)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04


2421

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text

2422

Unexplained Subfertility and Osteopathic Treatment
Kapper, A.
Unpublished MSc thesis, 2007/03
Free full text


2424

Dysgnathia as a correlative to an SBS – Lesion?
Krenner, E.
Unpublished MSc thesis, 2007/03
Free full text

2425

The Effectiveness of Osteopathic Treatment in Perimenopause
Zanon, B.
Unpublished MSc thesis, 2007/03
Free full text

2426

The Midline in Osteopathy – A Balancing Act between Structure and Spirituality
Dunshirn, M.
Unpublished MSc thesis, 2007/03
Free full text

2427

Development of a Questionnaire to Analyse the Knowledge of Medical Doctors About Osteopathy
Eppensteiner, M.
Unpublished MSc thesis, 2007/03
Free full text

2428

Osteopathy is not only a job, it is a vocation!
Forthuber, K.
Unpublished MSc thesis, 2007/03
Free full text

2429

The Influence of osteopathy on the vegetative nervous system in chronic pain patients
Fürpaß, E.
Unpublished MSc thesis, 2007/03
Free full text


2431

The Influence of Osteopathy on ADHD
Hubmann, B.
Unpublished MSc thesis, 2007/03
Free full text

2432

Osteopathic medical education in 2007: plumbing the depths with the questions we ask
Shannon, S. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text

2433

Practice patterns among osteopathic dermatologists in the United States
Yoo, J. Y., Lee, H., Kimball, A. B.
Journal of the American Academy of Dermatology, 2007/03

2434

Osteopathy in idiopathic sudden hearing loss
Staffa, U.
Unpublished MSc thesis, 2007/03
Free full text


2436

Beyond spinal manipulation
McClune, T.
International Journal of Osteopathic Medicine, 2007/03

2437

Validity of an electronic pressure algometer
Vaughan, B., McLaughlin, P., Gosling, C.
International Journal of Osteopathic Medicine, 2007/03




2441

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2007/02
Free full text

2442

Comparison between CV4 and EV4 via Biofeedback-measurement
Grill, M.
Unpublished MSc thesis, 2007/01
Free full text


2444

Does Osteopathy Influence Diabetes Mellitus Type II?
Kiegerl, G.
Unpublished MSc thesis, 2007/01
Free full text

2445

Osteopathic Treatment During Transition of Perimenopause
Mückler, A.
Unpublished MSc thesis, 2007/01
Free full text

2446

Influence of Osteopathic Treatment on Congestive Menstrual Disorders and Premenstrual Syndrome
Riepler-Reisecker, I.
Unpublished MSc thesis, 2007/01
Free full text

2447

Touching Reliability
Sommerfeld, P.
Unpublished MSc thesis, 2007/01
Free full text


2449

The influence of sitting position on (ventro-) dorsal head translation
Hoffmann, F.
Unpublished MSc thesis, 2007/01
Free full text

2450

Osteopathic degrees overseas
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2007/01
Free full text



2453

Can Vital Capacity be Improved by Osteopathic Treatment of the Mediastinum?
Wieser, R.
Unpublished MSc thesis, 2007/01
Free full text


2455

Osteopathy and Tinnitus
Plamberger, M.
Unpublished MSc thesis, 2007
Free full text

2456

Approval of ACGME Training as an AOA-approved internship: history and review of current data
Bulger, J. B.
The Journal of the American Osteopathic Association, 2006/12
Free full text

2457

The Use of OMT in Patients with Osteoarthritis: Case Report
Zaidi, T., Williams, S.
The AAO Journal, 2006/12
Free full text

2458

Do any treatments work for irritable bowel syndrome?
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/12


2460

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text

2461

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11

2462

Craniosacral therapy and professional responsibility
Flynn, T. W., Cleland, J. A., Schaible, P.
The Journal of Orthopaedic and Sports Physical Therapy, 2006/11
Free full text



2465

Nitric oxide and anandamide in OMT research
Stefano, G. B., Salamon, E. J.
The Journal of the American Osteopathic Association, 2006/10
Free full text




2469

Mechanisms of change: animal models in osteopathic medical research
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/10
Free full text


2471

Die Bewegungen der Viszera: Die Mobilität - Teil 1
(Visceral Movements: Mobility - Part 1)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10

2472

Was bringt die Ganganalyse? - Pro und Contra
(What are the benefits of gait analysis? - Pros and cons)
Fink, M., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10

2473

Patient confidentiality vs disclosure of inheritable risk: a survey-based study
Erde, E. L., McCormack, M. K., Steer, R. A., Ciervo, C. A., Jr., McAbee
The Journal of the American Osteopathic Association, 2006/10
Free full text

2474

Interventions need to be consistent with osteopathic philosophy
Vasquez, A.
The Journal of the American Osteopathic Association, 2006/09
Free full text

2475

Embryological study of the spinal dura and its attachment into the vertebral canal
van Dun, P. L. S., Girardin, M. R. G
International Journal of Osteopathic Medicine, 2006/09

2476

One Heritage, Two Traditions; A Look to the Future
Steele, K. M.
The AAO Journal, 2006/09
Free full text

2477

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text

2478

Osteopathic medicine in transition: postmortem of the Osteopathic Medical Center of Texas
Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2006/09
Free full text

2479

Computer-assisted instruction: a survey on the attitudes of osteopathic medical students
Forman, L. J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text


2481

Establishing a case for cause and effect
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text


2483

Patient Expectations Between OMT, Subtherapeutic Ultrasound and Light Touch Placebo Controls
Fulda, K., Slicho, T., Marshall, K., Stoll, S. T.
The Journal of the American Osteopathic Association, 2006/08

2484

Determining the Intra-observer Reliability of the Evaluation of Cranial Strain Patterns
Halma, K. D., Snider, K. T., Johnson, J. C., Schaun Flaim, M., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2006/08

2485

AOA certifying boards are credible and capable
Reeves, R. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text


2487

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08

2488

Worlds of Western medicine and Chinese medicine learning from each other
Wu, E.
The Journal of the American Osteopathic Association, 2006/07
Free full text

2489

Neuropsychiatric symptoms and medical illness in patients with dementia: an exploratory study
Tran, P., Schmidt, K., Gallo, J., Tuppo, E., Scheinthal, S., Chopra, A., Libon, D. J.
The Journal of the American Osteopathic Association, 2006/07
Free full text

2490

Nervus vestibulocochlearis (VIII.)
(Vestibulocochlear nerve)
Toth, A. B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

2491

Das Ohr, Anatomie und Physiologie
(The Ear, Anatomy and Physiology)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07


2493


2494

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

2495

Violations of the 80-duty-hours work standard to be investigated
Opipari, M. I.
The Journal of the American Osteopathic Association, 2006/07

2496

Tinnitus aurium - Wenn das Ohr pfeift
(Tinnitus - When the ear whistles)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

2497

Sciatic Neuritis: A Research Study
Beal, M. C.
The AAO Journal, 2006/06
Free full text

2498

Osteopathy and pain: Does psychology matter?
Pincus, T.
International Journal of Osteopathic Medicine, 2006/06

2499

Manipulation of Adhesive Capsulitis under Anesthesia
Hurrell, J., Speece, A. J., Williams, S. F.
The AAO Journal, 2006/06
Free full text

2500

Front-line osteopathic medicine
Hayes, D. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text

2501

Osteopathic manipulative treatment of a 27-year-old man after anterior cruciate ligament reconstruction
Gugel, M. R., Johnston, W. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text


2503

Osteopathic evaluation and manipulative treatment in reducing the morbidity of otitis media: a pilot study
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text

2504

Progressive idea for osteopathic medical education
Belsky, D. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text

2505

Understanding comorbidity with depression and anxiety disorders
Aina, Y., Susman, J. L.
The Journal of the American Osteopathic Association, 2006/05

2506

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05


2508

Let the beauty of the marketplace benefit healthcare
Bliss, G.
The Journal of the American Osteopathic Association, 2006/04
Free full text

2509

The Drive for Legitimation by Osteopathy and Chiropractic in Australia: Between Heterodoxy and Orthodoxy
Baer, H. A.
Complementary Health Practice Review, 2006/04
Free full text



2512

Im Gedenken an Anne Wales, D.O. 1904-2005
(In memory of Anne Wales, D.O. 1904-2005)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

2513

Women's reproductive health and neonatal care
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/04
Free full text

2514

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

2515

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

2516

Trunk and limb muscle activity during the application of a mobilisation type force to the vertebral column
Blaich, R., Ginn, K., Cathers, I., Lee, M.
International Journal of Osteopathic Medicine, 2006/03

2517

Lower extremity Extension Dynamic Test: sensitivity and specificity in diagnosing a leg length inequality (LLI)
Alfonso, M., Andrea, M.
International Journal of Osteopathic Medicine, 2006/03

2518

Intraexaminer Reliability of Identifying a Dysfunctional Segment in the Thoracic and Lumbar Spine
Potter, L., McCarthy, C., Oldham, J.
Journal of Manipulative and Physiological Therapeutics, 2006/03

2519

Faith without works
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/03
Free full text

2520

Reliability of visual assessment for lumbar curves in standing: Does clinical experience matter?
Moran, R. W., Ljubotenski, E.
International Journal of Osteopathic Medicine, 2006/03


2522

Risk and negligence: A minefield or an opportunity?
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2006/03


2524

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03

2525

Center or periphery? The future of osteopathic principles and practices
Gevitz, N.
The Journal of the American Osteopathic Association, 2006/03
Free full text

2526

The electromyographic activity of thoracic paraspinal muscles identified as abnormal with palpation
Fryer, G., Morris, T., Gibbons, P., Briggs, A.
International Journal of Osteopathic Medicine, 2006/03


2528

In vitro biophysical strain model for understanding mechanisms of osteopathic manipulative treatment
Dodd, J. G., Good, M. M., Nguyen, T. L., Grigg, A. I., Batia, L. M., Standley, P. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text

2529

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text

2530

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text

2531

Osteopathic medical education in 2006: charting a course for the future
Shannon, S. C.
The Journal of the American Osteopathic Association, 2006/02
Free full text






2537


2538

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text


2540

To what should we attribute the effects of OMT?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/12


2542

The coming influenza pandemic: lessons from the past for the future
Patterson, M. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text

2543

American Osteopathic Association's policy statement on end-of-life care
Issues, Council on Palliative Care
The Journal of the American Osteopathic Association, 2005/11
Free full text

2544

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text


2546

Systematic review of effects of manual therapy in infants with kinetic imbalance due to suboccipital strain (KISS) syndrome
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Journal of Manual and Manipulative Therapy, 2005/10

2547

Interobserver reliability of osteopathic palpatory diagnostic tests of the lumbar spine: improvements from consensus training
Degenhardt, B. F., Snider, K. T., Snider, E. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2005/10
Free full text

2548

Cost-effective osteopathic manipulative medicine: a literature review of cost-effectiveness analyses for osteopathic manipulative treatment
Gamber, R., Holland, S., Russo, D. P., Cruser d, A., Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2005/10
Free full text


2550

Missed opportunity for osteopathic medical education
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text






2556

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10


2558

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10



2561

Clinical Prevention and Population Health Curriculum Framework: the nursing perspective
Allan, J. D., Stanley, J., Crabtree, M. K., Werner, K. E., Swenson, M.
Journal of Professional Nursing, 2005/09
Free full text

2562

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2563

Management of osteoarthritic knee pain
Rubin, B. R.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2564

Attention applicants: please submit emotional intelligence scores
Sefcik, D. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2565

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2566

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text




2570

Interview mit Karel Lewit
(An interview with Karel Lewit)
Schmidt, S.
Osteopathische Medizin, 2005/09

2571

The cranio-cervical flexion test using pressure biofeedback: A useful measure of cervical dysfunction in the clinical setting?
Hudswell, S., von Mengersen, M., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09

2572

The active knee extension test and Slump test in subjects with perceived hamstring tightness
Kuilart, K. E., Woollam, M., Barling, E., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09

2573

Osteopathy in the cranial field – moving towards evidence for causality and effectiveness
Moran, R. W.
International Journal of Osteopathic Medicine, 2005/09



2576

Interexaminer Reliability of Osteopathic Palpatory Findings
Licciardone, J. C., Fulda, K., Stoll, S. T., Gamber, R. G., Cage, A. C.
The Journal of the American Osteopathic Association, 2005/07




2580

Effect of Counterstrain on Reflexes and Clinical Outcomes in Subjects with Plantar Fasciitis
Wynne, M. M., Burns, J. M., Eland, D. C., Conatser, R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2005/07

2581

Etienne Cloet - Was wirklich zählt
(Etienne Cloet - What really matters)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07



2584

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text

2585

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text


2587

What is the significance of somatic dysfunction in a multicausal model of aetiology?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2005/06

2588

IM ketorolac versus OMT: was agent at peak analgesic effect in JAOA study?
Coston, J. L., McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text

2589

Taking osteopathic distinctiveness seriously: historical and philosophical perspectives
Osborn, G. G.
The Journal of the American Osteopathic Association, 2005/05
Free full text

2590

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text


2592

A Pilot Study to Investigate the Validity of the Rule of Threes of the Thoracic Spine
Geelhoed, M. A., Viti, J. A., Brewer, P. A.
Journal of Manual & Manipulative Therapy, 2005/04/01



2595

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text


2597

Specialist or Generalist?
Chila, A. G.
The AAO Journal, 2005/03
Free full text

2598

Survey of osteopathic and allopathic residents' attitudes toward osteopathic manipulative treatment
Allee, B. A., Pollak, M. H., Malnar, K. F.
The Journal of the American Osteopathic Association, 2005/03
Free full text

2599

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03



2602


2603



2605

From small acorns
Gibbons, P.
International Journal of Osteopathic Medicine, 2005/03

2606

Attitudes towards prescribing rights: a qualitative focus group study with UK osteopaths
Grundy, M., Vogel, S.
International Journal of Osteopathic Medicine, 2005/03

2607

Welcome to IJOM
Moore, A. P.
International Journal of Osteopathic Medicine, 2005/03

2608

IJOM: An international journal for an international readership
Moran, R. W., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/03

2609

An account of the development of the conceptual basis of osteopathy course at the British School of Osteopathy
Nash, K., Tyreman, S.
International Journal of Osteopathic Medicine, 2005/03


2611

Intramuscular ketorolac versus osteopathic manipulative treatment in the management of acute neck pain in the emergency department: a randomized clinical trial
McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/02
Free full text

2612

Cranial manipulation can alter sleep latency and sympathetic nerve activity in humans: a pilot study
Cutler, M. J., Holland, B. S., Stupski, B. A., Gamber, R. G., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2005/02

2613

Hysteresis as a measure of ankle dysfunction
Cohen, A. M., Mertz, J., Stewart, P., Warner, M. J., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/01
Free full text

2614

Chronic low back pain: osteopaths' attitudes and management
Griffiths, L.
Unpublished MSc thesis, 2005/01
Free full text


2616

The effect of a muscle energy stretch on suboccipital tenderness
Boswell, C.
Unpublished MSc thesis, 2005/01
Free full text

2617

Osteopaths' views on prescription rights: a qualitative pilot study
Burns, R.
Unpublished MSc thesis, 2005/01
Free full text




2621

Spondylodiszitis
(Spondylodiscitis)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01



2624

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text

2625

Cost-utility analysis of osteopathy in primary care: results from a pragmatic randomized controlled trial
Williams, N. H., Edwards, R. T., Linck, P., Muntz, R., Hibbs, R., Wilkinson, C., Russell, I., Russell, D., Hounsome, B.
Family Practice, 2004/12
Free full text










2635

The international conference on advances in osteopathic research (ICAOR) — the first five years
Walters, N.
Journal of Osteopathic Medicine, 2004/10
Free full text

2636

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09

2637

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09


2639

The hospitalist: a patient-focused paradigm?
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2004/09
Free full text

2640

Influenza epidemic or pandemic? Time to roll up sleeves, vaccinate patients, and hone osteopathic manipulative skills
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/09
Free full text

2641


2642

Chronic Pelvic Pain Syndrome
Rossi, P. J., Dickey, J. L.
The AAO Journal, 2004/09
Free full text

2643

A review of King HH and Lay EM, “Osteopathy in the Cranial Field,“ in Foundations for Osteopathic Medicine, 2nd ed
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2004/09

2644




2647

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text

2648

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text

2649

Treatment Credibility in Osteopathic Manipulative Treatment Research
Russo, D. P., Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/08

2650

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07

2651

Yes, Dr Still, an MD won the 2004 Northup Writing Award!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/07
Free full text

2652

Wither the Osteopathic Hospital
Chila, A. G.
The AAO Journal, 2004/06
Free full text

2653

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text



2656

Pseudokrupp
(Pseudo Croup)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05


2658

A randomized controlled trial of osteopathic manipulative treatment following knee or hip arthroplasty
Licciardone, J. C., Stoll, S. T., Cardarelli, K. M., Gamber, R. G., Swift, J. N., Jr., Winn
The Journal of the American Osteopathic Association, 2004/05
Free full text


2660


2661

Osteopathie auf der Intensivstation
(Osteopathy in the intensive care unit)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
Free full text

2662

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text

2663

The effect of manipulation and mobilisation on pressure pain thresholds in the thoracic spine
Fryer, G., Carub, J., McIver, S.
Journal of Osteopathic Medicine, 2004/04

2664

Musculoskeletal disorders: does the osteopathic medical profession demonstrate its unique and distinctive characteristics?
Sun, C., Desai, G. J., Pucci, D. S., Jew, S.
The Journal of the American Osteopathic Association, 2004/04
Free full text

2665

The seven year itch
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2004/04
Free full text

2666

Interdisciplinary approach to teaching medication adherence to pharmacy and osteopathic medical students
Singla, D. L., MacKinnon, G. E., 3rd, MacKinnon, K. J., Younis, W., Field
The Journal of the American Osteopathic Association, 2004/03
Free full text



2669

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text

2670

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text


2672

Accuracy of the OMRON M4 automatic sphygmomanometer
Clarke, A.
Unpublished MSc thesis, 2004/01
Free full text

2673

Migraine and emotion: a qualitative pilot study
Conroy, K.
Unpublished MSc thesis, 2004/01
Free full text






2679

Spirituality and osteopathy: a practitioners' views
Huggett, S.
Unpublished MSc thesis, 2004/01
Free full text


2681

Erectile dysfunction and comorbid diseases, androgen deficiency, and diminished libido in men
Fine, S. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text



2684

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text


2686

Inter-examiner and intra-examiner reliability of the seated flexion test
O'Keefe, P.
Unpublished MSc thesis, 2004/01
Free full text

2687

Lasting effects of atlanto-axial manipulation on edge light pupil cycle time
Olarenshaw, A.
Unpublished MSc thesis, 2004/01
Free full text

2688

Osteopathic emergency physician training and use of osteopathic manipulative treatment
Ray, A. M., Cohen, J. E., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text

2689

Emu oil for osteoarthritic hand pain
Power, R.
Unpublished MSc thesis, 2004/01
Free full text

2690

The effect of osteopathic treatment on the irritable bowel syndrome: a case series
Stasiuk, D.
Unpublished MSc thesis, 2004/01
Free full text


2692

Effects of osteopathic treatment on people with psoriatic arthritis: a pilot study
Wall, R., Ryan, E., Kiatos, J.
Unpublished MSc thesis, 2004/01
Free full text


2694

Postmenopause: womens' experiences
Walshe, S.
Unpublished MSc thesis, 2004/01
Free full text

2695

Support needed for clinical faculty in osteopathic emergency medicine residencies
Minor, S. K., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2003/12
Free full text

2696

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11

2697

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text



2700

The effect of muscle energy technique on hamstring extensibility: the mechanism of altered flexibility
Ballantyne, F., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/10

2701

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10

2702

William L. Johnston, DO, 1921–2003
McPartland, J. M.
Journal of Osteopathic Medicine, 2003/10

2703

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10

2704

A prospective study of osteopathic medical students' attitudes toward use of osteopathic manipulative treatment in caring for patients
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2003/10
Free full text

2705

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text

2706

Presence of Chapman reflex points in hospitalized patients with pneumonia
Washington, K., Mosiello, R., Venditto, M., Simelaro, J., Coughlin, P., Crow, W. T., Nicholas, A.
The Journal of the American Osteopathic Association, 2003/10
Free full text




2710

Editorial
Moran, R., Lucas, N.
Journal of Osteopathic Medicine, 2003/10
Free full text


2712

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10


2714

Osteopathic manipulative treatment in the emergency department for patients with acute ankle injuries
Eisenhart, A. W., Gaeta, T. J., Yens, D. P.
The Journal of the American Osteopathic Association, 2003/09
Free full text

2715

Development of the Attitudes Toward Osteopathic Principles and Practice Scale (ATOPPS): preliminary results
Russo, D. P., Stoll, S. T., Shores, J. H.
The Journal of the American Osteopathic Association, 2003/09
Free full text


2717

The use of osteopathic manipulative treatment as adjuvant therapy in children with recurrent acute otitis media
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F.
Archives of Pediatrics & Adolescent Medicine, 2003/09
Free full text

2718

Osteopathic manipulation to prevent otitis media--does it work?
Pichichero, M. E.
Archives of Pediatrics & Adolescent Medicine, 2003/09

2719

Osteopathic and Allopathic Family Practice Residents' Attitudes Toward OMT/OPP
Allee, B. A., Pollak, M. H., Malnar, K. F., Elfrink, L. D., Mulkey, L. E.
Journal of Osteopathic Medicine, 2003/08

2720

Determining the Impact of Osteopathic Manipulative Therapy in the Management of Irritable Bowel Syndrome
Chiesa, J. C., Pomerantz, S. C., Shinkle, J. W., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08

2721

A primary care approach to comprehensive care of patients with type 1 and type 2 diabetes mellitus
Keilers, R. K.
The Journal of the American Osteopathic Association, 2003/08
Free full text

2722

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text



2725

Osteopathic Manipulative Therapy (OMT) as a Non-pharmacological Treatment for Stable Patients with Emphysema and Chronic Bronchitis
Morley, T. F., Shinkle, J. W., Pomerantz, S. C., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08

2726

Aufbau und Funktion des Peritoneums
(Structure and function of the peritoneum)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07


2728

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

2729



2731

Osteopathic manipulative treatment techniques preferred by contemporary osteopathic physicians
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2003/05
Free full text

2732

Practice-based osteopathic research
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2003/04

2733

Osteopathie bei chronischer Sinusitis
(Osteopathy for chronic sinusitis)
Häfner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2734

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2735

Die chronische Sinusitis: Eine Übersicht
(A review of chronic sinusitis)
Resch, K.L., Häfner, S., Stadler, M., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2736

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2737

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2738

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2739

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2740

Time to forge affiliations between osteopathic medical schools and hospitals
Belsky, D. H.
The Journal of the American Osteopathic Association, 2003/03
Free full text

2741

Tobaccoism revisited
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/03
Free full text

2742

Bibliotherapy: the therapeutic use of didactic and literary texts in treatment, diagnosis, prevention, and training
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2003/03
Free full text


2744

Etiological Factors in Sacral Somatic Dysfunctions
Danto, J. B.
The AAO Journal, 2003/03
Free full text

2745

From the Archives: The Contribution of John Martin Littlejohn to Osteopathy
Hall, T. E., Wernham, J.
The AAO Journal, 2003/03
Free full text

2746

Validity and reliability of the Osteopathic Survey of Health Care in America (OSTEOSURV)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/02
Free full text

2747

Results of a survey of inaugural class graduates of a college of osteopathic medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2003/01
Free full text



2750

DOs should embrace increased emphasis on care for older adults
Vieder, J. N.
The Journal of the American Osteopathic Association, 2003/01
Free full text




2754


2755

Functional instability of the ankle and its relationship to the Q angle
Kenney, M.
Unpublished MSc thesis, 2003/01
Free full text

2756

The effect of manipulation on pressure pain thresholds in the thoracic spine
McIver, S.
Unpublished MSc thesis, 2003/01
Free full text

2757



2759

Reliability and validity of selected pain provocation tests at the sacroiliac joint
Thompson, J.
Unpublished MSc thesis, 2003/01
Free full text



2762

Hausaufgaben und Tipps für’s Knie
(Homework and tips for the knee)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01


2764

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

2765

Social Capital and Osteopathic Medicine in Transition
Ward, R. C.
The AAO Journal, 2002/12
Free full text

2766

Aptitude for osteopathic training. 1939
Yarborough, J. U.
The Journal of the American Osteopathic Association, 2002/11
Free full text

2767

Training family medicine residents for assessment and advocacy of older adults
Robbins, M. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text

2768

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text

2769

The effect of cranial manipulation on the Traube-Hering-Mayer oscillation as measured by laser-Doppler flowmetry
Sergueef, N., Nelson, K. E., Glonek, T.
Alternative Therapies in Health and Medicine, 2002/11

2770

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text






2776

Editorial
Moran, R., Lucas, N.
Journal of Osteopathic Medicine, 2002/10

2777

Editorial
Moran, R., Lucas, N.
Journal of Osteopathic Medicine, 2002/10
Free full text

2778

How physicians approach advance care planning in patients with mild to moderate Alzheimer's disease
Cavalieri, T. A., Latif, W., Ciesielski, J., Ciervo, C. A., Jr., Forman
The Journal of the American Osteopathic Association, 2002/10
Free full text

2779

Developing research at The British School of Osteopathy
Nash, K., Vogel, S.
Journal of Osteopathic Medicine, 2002/10


2781

Re: Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
McGovern, J. J., McGovern, R. J., Lemley, W. W.
The AAO Journal, 2002/09
Free full text

2782

Osteopathic Manipulative Treatment and Task Specific Practice Enhance Locomotor Recovery after Unilateral Sensorimotor Cortex Lesions in Rats
Schmanke, T., Rosario, H., Chughtai, H., Ruiz, C., O'Halpin, S., Wells, M. R., Hallas, B. H., Scandalis, T. A.
The Journal of the American Osteopathic Association, 2002/09

2783

Establishment of a Research Culture in an Osteopathic Family Medicine Department: Results of a Three-Year Project
Smith-Barbaro, P., Knisley, C., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2002/09

2784

Long nights a long time ago
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2002/09
Free full text

2785

Osteopathic Manipulation Increases Active Range of Motion and Gait Parameters in Osteoarthritis: A Pilot Study
Bahamonde, L. G., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
Journal of Osteopathic Medicine, 2002/08

2786

The Effects of Cranio-Sacral CV-4 on Muscle Sympathetic Nerve Activity
Cutler, M. J., Stupski, B. A., Gamber, R. G., Smith, M. L.
The Journal of the American Osteopathic Association, 2002/08

2787

Impact of Osteopathic Manual Medicine in Patients with Knee Osteoarthritis
Degenhardt, B. F., Kenney, R. G., McGovern, R. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/08

2788

Interexaminer Reliability in Palpatory Evaluation of the Lumbar Spine
Degenhardt, B. F., Snider, K. T., Johnson, J. C., Snider, E. J.
The Journal of the American Osteopathic Association, 2002/08

2789

Joint Kinetic Parameters as Indicators of Osteopathic Manipulative Treatment Effect in Osteoarthritis of the Knee
Kilbury Nason, L. L., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
The Journal of the American Osteopathic Association, 2002/08

2790

Effect of Osteopathic Manipulative Treatment (OMT) On Recurrent Acute Otitis Media in Children
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F., Worden, K.
The Journal of the American Osteopathic Association, 2002/08

2791

High Velocity Low Amplitude Thrust Techniques: How Much Force is Applied During These Therapeutic Maneuvers?
Rivera-Martinez, S., DiGiovanna, E. L., Yao, S. C., Mazzie, J., Protopapas, M. G.
The Journal of the American Osteopathic Association, 2002/08

2792

Interexaminer Reliability of Somatic Palpatory Findings Associated With Chronic Low Back Pain
Russo, D. P., Stoll, S. T., Licciardone, J. C., Gamber, R. G.
The Journal of the American Osteopathic Association, 2002/08

2793

The anatomy professor that ate New York: some dinosaurs are teachers, and some teach about dinosaurs
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2002/08
Free full text

2794

Rating interest in clinical research among osteopathic medical students
Licciardone, J. C., Fulda, K. G., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/08
Free full text

2795

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text

2796

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text


2798

Osteopathic manipulative treatment in conjunction with medication relieves pain associated with fibromyalgia syndrome: results of a randomized clinical pilot project
Gamber, R. G., Shores, J. H., Russo, D. P., Jimenez, C., Rubin, B. R.
The Journal of the American Osteopathic Association, 2002/06
Free full text

2799

Resources in bioethics at osteopathic medical schools
Peppin, J., Leeper, K., Garloff, D.
Academic Medicine, 2002/05
Free full text

2800

Can we afford to lose another osteopathic teaching facility?
Dickason, R. H.
The Journal of the American Osteopathic Association, 2002/05
Free full text

2801

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text

2802

Health status and satisfaction of patients receiving ambulatory care at osteopathic training clinics
Licciardone, J. C., Brittain, P. D., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2002/04
Free full text

2803


2804

Editorial
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2002/04

2805

Search Words: Osteopath, Osteopathy, Osteopathic
Chila, A. G.
The AAO Journal, 2002/03
Free full text

2806

Quality of life in referred patients presenting to a specialty clinic for osteopathic manipulative treatment
Licciardone, J. C., Gamber, R. G., Russo, D. P.
The Journal of the American Osteopathic Association, 2002/03
Free full text

2807

Evaluation of osteopathic manipulative treatment training by practicing physicians in Ohio
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2002/03
Free full text


2809

Spirituality and end-of-life care
Reeves, R. R., Reynolds, M.
The Journal of the American Osteopathic Association, 2002/02
Free full text

2810

Interexaminer reliability and cranial osteopathy
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2002/01

2811

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text


2813

Attitudes of osteopathic physicians toward physician-assisted suicide
Cavalieri, T. A., Pomerantz, S. C., Ciesielski, J., Shinkle, J. W., Forman, L. J.
The Journal of the American Osteopathic Association, 2002/01
Free full text

2814

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text

2815

FIMM 2001
Chila, A. G.
The AAO Journal, 2001/12
Free full text

2816

Is there any osteopathy in the specialty training of osteopathic residents?
Glover, J. C.
The AAO Journal, 2001/12
Free full text

2817

An adventure in excellence. 1962
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/12

2818

A Fact: The Medical Industry Doesn't Support Hands-On CME!
Noone, S. J.
The AAO Journal, 2001/12
Free full text

2819

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text

2820

The value of magnetic resonance imaging of the lumbar spine to predict low-back pain in asymptomatic subjects: a seven-year follow-up study
Borenstein, D. G., O'Mara, J. W., Boden, S. D., Lauerman, W. C., Jacobson, A., Platenberg, C., Schellinger, D., Wiesel, S. W.
Journal of Osteopathic Medicine, 2001/10

2821

Measurement challenges in physical diagnosis: refining inter-rater palpation, perception and communication
Comeaux, Z., Eland, D., Chila, A. G., Pheley, A., Tate, M.
Journal of Osteopathic Medicine, 2001/10

2822

Comparison of effects of spinal manipulation and massage on motoneuron excitability
Dishman, J. D., Bulbulian, R.
Journal of Osteopathic Medicine, 2001/10

2823

Good and compassionate care for dying patients
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/10

2824

Patient positioning and spinal locking for lumbar spine rotation manipulation
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10

2825

Motivation for change and personal resources in patients with prolonged musculoskeletal disorders
Grahn, E. B. M., Stigmar, G. K. E., Ekdahl, C. S.
Journal of Osteopathic Medicine, 2001/10

2826

The effective forces transmitted by high-speed, low-amplitude thoracic manipulation
Herzog, W., Kats, M., Symons, B.
Journal of Osteopathic Medicine, 2001/10

2827

Thoracic spine dysfunction in upper extremity complex regional pain syndrome type I
Menck, J. Y., Requejo, S. M., Kulik, K.
Journal of Osteopathic Medicine, 2001/10

2828

Intra-examiner and inter-examiner reliability of a positional diagnostic screen for the lumbar spine
Spring, F., Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10

2829

Pain and muscular responses to a neural tissue provocation test in the upper limb
van der Heide, B., Allison, G. T., Zusman, M.
Journal of Osteopathic Medicine, 2001/10

2830

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text

2831

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09

2832

Respect the friendly adversary
Anderson, R. B.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2833

Marketing lessons and retaining the traditional osteopathic internship
Broder, D. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2834

Knowing more than the score: providing sideline medical care coverage for athletic competition
Brolinson, G., Cibor, G. M.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2835

Decline in structural examination compliance in the hospital medical record with advancing level of training
Essig-Beatty, D. R., Klebba, G. E., LaPointe, N. G., Miller, E. D., Strong, R. E.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2836

Has our profession become its own worst enemy?
Fettig, L. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2837

Development of the Attitudes Toward Osteopathic Principles and Practices Scale (ATOPPS): Preliminary Results of a Pilot Project
Russo, D. P., Stoll, S. T., Shores, J.
The Journal of the American Osteopathic Association, 2001/09

2838


2839

The Effects of OMT on Vital Signs During Headache
Parikh, A. S.
The Journal of the American Osteopathic Association, 2001/08

2840

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text

2841

A new year--a new era
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

2842

Who is there to listen?
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

2843

Signifying what?
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

2844

Vox populi
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

2845

Sixty-five pieces of silver
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

2846

“The judgment is reversed“
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

2847

Sinusitis in children: the importance of diagnosis and treatment
Shrum, K. M., Grogg, S. E., Barton, P., Shaw, H. H., Dyer, R. R.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2848

More on spirituality
Chin, W. L.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2849

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2850

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2851

President Bush's 2002 budget proposal would hamper geriatric education
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2852

Allergy test results of a rural and small-city population compared with those of an urban population
Taksey, J., Craig, T. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2853

More on spirituality
Horton, J. G.
The Journal of the American Osteopathic Association, 2001/05

2854



2856

Inter-examiner reliability of the Johnson and Friedman percussion scan of the thoracic spine
Ghoukassian, M., Nicholls, B., McLaughlin, B.
Journal of Osteopathic Medicine, 2001/04

2857

Spinal manipulation: Indications, risks and benefits
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/04

2858

Extensibility and stiffness of the hamstrings in patients with nonspecific low back pain
Halbertsma, J. P. K., Göeken, L. N. H., Hof, A. L., Groothoff, J. W., Eisma, W. H.
Journal of Osteopathic Medicine, 2001/04


2860

Centralization phenomenon as a prognostic factor for chronic low back pain and disability
Werneke, M., Hart, D. L.
Journal of Osteopathic Medicine, 2001/04

2861

Intraexaminer and interexaminer reliability for palpation of the cranial rhythmic impulse at the head and sacrum
Moran, R. W., Gibbons, P.
Journal of Manipulative and Physiological Therapeutics, 2001/03

2862

International growth of osteopathy
Noone, S. J.
The AAO Journal, 2001/03
Free full text

2863

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text

2864

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text

2865

Going global with osteopathic medicine
Smith, D. A.
The Journal of the American Osteopathic Association, 2001/03
Free full text

2866

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text

2867

On becoming a doctor
Kelly, M.
The Journal of the American Osteopathic Association, 2001/02
Free full text

2868

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text

2869

Testing osteopathic medical school graduates for licensure: is COMLEX-USA the most appropriate examination?
Graneto, J.
The Journal of the American Osteopathic Association, 2001/01
Free full text

2870

Minor depression in primary care
Banazak, D. A.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2871

Endoscopic retrograde cholangiopancreatography: what role does it have in primary care?
Biery, D. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2872

Fair hearing/peer review: truth or oxymoron?
Chalifoux, R. F.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2873

Sleep-related gastroesophageal reflux
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2874

Spirituality in Osteopathic Medicine
Lee, R. P.
The AAO Journal, 2000/12
Free full text

2875

Time for Medicare reform is now
Linz, A. J.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2876

Benefits of osteopathic manipulative treatment for hospitalized elderly patients with pneumonia
Noll, D. R., Shores, J. H., Gamber, R. G., Herron, K. M., Swift, J.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2877

The future in retrospect. 1935
Swope, C. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2878

Tendencies in a social, political, and governmental way which may influence doctors. 1937
Thomas, E. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2879

Spirituality in medicine
Travaline, J. M., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2880

Long-term therapy of coronary artery disease: a vascular biology perspective
Mathé, A. J., Clearfield, M. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2881

A fresh look at osteopathic medical education in 2000
Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2000/11

2882

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2883

Thrombolytic, antithrombin, and antiplatelet treatment of acute coronary syndromes
Puma, J. A., Sketch, M. H.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2884

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2885

Galbreath technique: a manipulative treatment for otitis media revisited
Pratt-Harrington, D.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2886

Osteopathic Treatment of Secretory Otitis Media (SOM)(Glue Ear)
Zingerle, M.L.
Unpublished MSc thesis, 2000/10
Free full text

2887

Osteoporosis
Cymet, T. C., Wood, B., Orbach, N.
The Journal of the American Osteopathic Association, 2000/10

2888

Managing common problems in perimenopausal women
Forstein, D. A.
The Journal of the American Osteopathic Association, 2000/10

2889

Glycation as the glucose link to diabetic complications
Gugliucci, A.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2890

Diagnosis and medical management of patients with intermittent claudication
LaPerna, L.
The Journal of the American Osteopathic Association, 2000/10
Free full text


2892

Spirituality in history taking
Spaeth, D. G.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2893

Individualizing treatment plan and combining approaches key to pain management and holistic care: a student's perspective
Lawlor, T. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2894

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2895

Headache as a manifestation of otolaryngologic disease
Cosenza, M. J.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2896

An Ancient Persian High-Velocity, Low-Amplitude Thrusting Technique for Somatic Dysfunctions of the Thoracic Spine
Namazian, M., Clark, R. C., Binkerd, J.
The AAO Journal, 2000/09
Free full text

2897

Osteopathic research imperative-III. 1936
McCaughan, R. C., Hulburt, R. G.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2898

Psychologic aspects of chronic headache
Mueller, L.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2899


2900

Clinical research and the office-based physician
Smutny, C. J.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2901

Patients' satisfaction with osteopathic and GP management of low back pain in the same surgery
Pincus, T., Vogel, S., Savage, R., Newman, S.
Complementary Therapies in Medicine, 2000/09

2902

Workup and indications for polysomnography in patients with sleep-related complaints
Knox, K. S., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2903

Effects of Osteopathic Manipulative Treatment on Knee Osteoarthritis
Pham, C. N., Knebl, J.
The Journal of the American Osteopathic Association, 2000/08

2904

Osteopathic Manipulation in the Management of Parkinson's Disease
Wells, M. R., McCarty, C. L., Smutny, C. J., Scandalis, T. A., Dittrich, F., Fazzini, E. A.
The Journal of the American Osteopathic Association, 2000/08

2905

Opinions Toward The Use of OMT by Oklahoma D.O.s Responding to Surveys in 1984 and 1999
Yates, H., Johnson, J. C.
The Journal of the American Osteopathic Association, 2000/08

2906

Profession's research has come a long way, Dr Still!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2907

Efficacy of a steroid nasal spray compared with an antihistamine nasal spray in the treatment of perennial allergic rhinitis
Berlin, J. M., Golden, S. J., Teets, S., Lehman, E. B., Lucas, T., Craig, T. J.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2908

Latex allergy: a primary care primer
Mahmoudi, M., Hunt, L. W.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2909

Inhaled corticosteroid-induced bone loss and preventive strategies
Singh, R. F., Muskelly, C. C.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2910

Cardiovascular disease and obstructive sleep apnea: implications for physicians
Foresman, B. H., Gwirtz, P. A., McMahon, J. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2911

Consortium publishes guidelines to lessen “headache“ of treating migraine
Freitag, F. G.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2912

Study underscores need to consider multiple factors in debate on physician-assisted suicide
Goldstein, F. J.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2913

Time to take bolder initiative with regard to public accountability
Harper, D. L.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2914

Opinions and reactions of physicians in New Jersey regarding the Oregon Death with Dignity Act
Kersh, S., 3rd, Cavalieri, T. A., Ciesielski, J., Forman
The Journal of the American Osteopathic Association, 2000/06
Free full text

2915

Progressive inhibition of neuromuscular structures (PINS) technique
Dowling, D. J.
The Journal of the American Osteopathic Association, 2000/05
Free full text

2916

The treatment of influenza. 1918
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/05
Free full text

2917

Opportunities for the osteopathic medical profession to pursue worldwide acclaim and recognition
Smith, D. A.
The Journal of the American Osteopathic Association, 2000/05
Free full text

2918

His eighty-five years. 1913
Chiles, H.L.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2919

A home for research. 1913
Chiles, H. L.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2920

Are there any more Louisa Burnses out there?
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2921

Use of magnetic resonance imaging to diagnose common wrist disorders
DiMarcangelo, M. T., Smith, P. A.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2922

Early research: the A.T. Still Research Institute and Louisa Burns
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2923

Lift Treatment in Naval Special Warfare (NSW) Personnel: A Retrospective Study
Lipton, J. A., Brooks, J. S., Hickey, M. J., Drew, B. G., Eggleston, M. T., Gemmer, C. H.
The AAO Journal, 2000/03
Free full text

2924

AOA's voice supporting fair treatment of physicians in quality review process
Loniewski, E. A.
The Journal of the American Osteopathic Association, 2000/03
Free full text

2925

Interstitial cystitis: a retrospective analysis of treatment with pentosan polysulfate and follow-up patient survey
Waters, M. G., Suleskey, J. F., Finkelstein, L. J., Van Overbeke, M. E., Zizza, V. J., Stommel, M.
The Journal of the American Osteopathic Association, 2000/03
Free full text

2926

Research on OPP/OMT is Critical to the Profession's Future
Noone, S. J.
The AAO Journal, 2000/03
Free full text

2927

Letters to the Editor
Orlando, C., Field, L.
The New England Journal of Medicine, 2000/03

2928

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02


2930

Beyond MEDLINE
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2000/02
Free full text

2931

Passing of the “Old Doctor“. 1918
Hildreth, A. G., Macon, D. O.
The Journal of the American Osteopathic Association, 2000/02
Free full text

2932

Reiter's syndrome and reactive arthritis
Parker, C. T., Thomas, D.
The Journal of the American Osteopathic Association, 2000/02

2933

Death of Dr. Still
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/02
Free full text

2934

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02

2935

Effective strategies for the prevention of osteoporosis across the life span
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2000/01

2936

Role of antileukotriene agents in asthma therapy
Gawchik, S. M., Saccar, C. L.
The Journal of the American Osteopathic Association, 2000/01
Free full text

2937

Evaluation of osteoporosis
Nichols, K. J.
The Journal of the American Osteopathic Association, 2000/01

2938

Troponin I sensitivity and specificity for the diagnosis of acute myocardial infarction
Ross, G., Bever, F. N., Uddin, Z., Hockman, E. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text

2939

In defense of Dr Kevorkian
Suls, M. E.
The Journal of the American Osteopathic Association, 2000/01
Free full text

2940

Muscle energy concepts - a need for change.
Fryer, G.
Journal of Osteopathic Medicine, 2000
Free full text

2941

A systematic review of craniosacral therapy: Biological plausibility, assessment reliability and clinical effectiveness
Green, C., Martin, C. W., Bassett, K., Kazanjian, A.
Complementary Therapies in Medicine, 1999/12/01/

2942

Pilot study relating pulmonary function to leg length inequality
Crosby, C. J.
The AAO Journal, 1999/12
Free full text

2943

Comparison of osteopathic and allopathic medical schools' support for primary care
Peters, A. S., Clark-Chiarelli, N., Block, S. D.
Journal of General Internal Medicine, 1999/12

2944

What's in a name? For DOs, plenty
Guglielmo, W. J.
Medical Economics, 1999/12

2945

Mechanism of action of high-velocity, low amplitude thrust technique
Mesina, J., Balmer, J., Esper, S., Esper, E., Evans, R., Hampton, D.
The AAO Journal, 1999/12
Free full text


2947

Obesity article ignores surgery as possible option
Sing, R. F., Backus, C. L., Heniford, B. T.
Journal of Osteopathic Medicine, 1999/11
Free full text

2948

The paradox of osteopathy
Howell, J. D.
The New England Journal of Medicine, 1999/11

2949

New England Journal of Medicine article may be misleading about OMT
Coughlin, P., Kriebel, R., Fogel, R.
Journal of Osteopathic Medicine, 1999/11
Free full text


2951

Osteopathic unity must continue
Ross, K. E.
Journal of Osteopathic Medicine, 1999/10
Free full text




2955

DOs need more training in diagnosing and treating addiction
Goldstein, F. J.
Journal of Osteopathic Medicine, 1999/09
Free full text

2956

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text

2957



2959

As uniquely trained holistic caregivers, DOs have duty to overweight patients
Perkins, R. C.
Journal of Osteopathic Medicine, 1999/07
Free full text

2960

Osteopathic family physicians' attitudes, knowledge, and self-reported practices regarding obesity
Harris, J. E., Hamaday, V., Mochan, E.
Journal of Osteopathic Medicine, 1999/07
Free full text

2961

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text

2962

DO's approach to patient is 'wholistic'--not holistic
Gotfried, R.
Journal of Osteopathic Medicine, 1999/05
Free full text

2963

Beyond the 'box'
Foresman, B. H.
Journal of Osteopathic Medicine, 1999/05
Free full text

2964


2965

Meeting the challenges of the 'triple threat' makes for a complete osteopathic physician
Patterson, M. M.
Journal of Osteopathic Medicine, 1999/03
Free full text

2966

Chiropractic and osteopathic education at Royal Melbourne Institute of Technology. A student perspective
French, S. D., Marshall, S. J., Webb, M., Tucker, C.
Australasian Chiropractic & Osteopathy, 1999/03
Free full text

2967

The Use of OMT in Stroke Rehabilitation
Maxwell, S.
The AAO Journal, 1999/03
Free full text

2968

The management of low back pain: Short leg syndrome/postural balance
Nelson, K. E.
The AAO Journal, 1999/03
Free full text


2970

Standard osteopathic manipulative treatment acutely improves gait performance in patients with Parkinson's disease
Wells, M. R., Giantinoto, S., D'Agate, D., Areman, R. D., Fazzini, E. A., Dowling, D., Bosak, A.
Journal of Osteopathic Medicine, 1999/02
Free full text


2972

Revisiting the role of osteopathic manipulation in primary care
Hopp, R. J.
Journal of Osteopathic Medicine, 1999/02
Free full text

2973

What we have to be is what we are
Chila, A. G.
Journal of Osteopathic Medicine, 1999/02
Free full text

2974


2975

The meaning of natural medicine: an interpretive study
Di Stefano, V.
Unpublished MSc thesis, 1998/12
Free full text

2976

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text

2977

Osteopathic medical education in 1998 prepares for the future
Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text


2979

International recognition of osteopathic medicine
Glassman, J.
Journal of Osteopathic Medicine, 1998/11
Free full text

2980

Simultaneous palpation of the craniosacral rate at the head and feet: intrarater and interrater reliability and rate comparisons
Rogers, J. S., Witt, P. L., Gross, M. T., Hacke, J. D., Genova, P. A.
Physical Therapy, 1998/11


2982

Sinusitus Supplement missing osteopathic component
Dudley, G.
Journal of Osteopathic Medicine, 1998/10

2983

Scalene entrapment syndrome
Royder, J. O.
The AAO Journal, 1998/09
Free full text


2985

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06


2987

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05


2989

Are D.O.s losing their unique identity?
Guglielmo, W. J.
Medical Economics, 1998/04

2990

Coming full circle: osteopathic manipulative treatment and immunity
Allen, T. W.
Journal of Osteopathic Medicine, 1998/04

2991

Partners for two decades: AOA and the National High Blood Pressure Education Program
Nickey, W. A., Lenfant, C.
Journal of Osteopathic Medicine, 1998/03

2992

Effect of lymphatic and splenic pump techniques on the antibody response to hepatitis B vaccine: a pilot study
Jackson, K. M., Steele, T. F., Dugan, E. P., Kukulka, G., Blue, W., Roberts, A.
Journal of Osteopathic Medicine, 1998/03

2993

Craniosacral rhythm: reliability and relationships with cardiac and respiratory rates
Hanten, W. P., Dawson, D. D., Iwata, M., Seiden, M., Whitten, F. G., Zink, T.
Journal of Orthopaedic & Sports Physical Therapy, 1998/03
Free full text

2994

Sinusitis and OMT
Sept, K.
The AAO Journal, 1998/03
Free full text

2995

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02

2996

Join the new national healthcare initiative against COPD
Seebass, J. S., Petty, T. L.
Journal of Osteopathic Medicine, 1998/01

2997

Cycle-to-cycle variability attributed to the primary respiratory mechanism
Lockwood, M. D., Degenhardt, B. F.
Journal of Osteopathic Medicine, 1998/01

2998

Clinical implications of a cervical myodural bridge
Hallgren, R. C., Hack, G. D., Lipton, J. A.
The AAO Journal, 1997/12
Free full text

2999

Comparing psychotic and affective disorders by musculoskeletal structural examination
Iwata, J. L., Rodos, J. J., Glonek, T., Habenicht, A. L.
Journal of Osteopathic Medicine, 1997/12
Free full text

3000

Leading the pace of change: crisis or opportunity?
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/12
Free full text

3001

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text

3002

Anatomy of an OPTI dissected: structure, function, and the impact of budget reconciliation legislation
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/11
Free full text

3003

A snapshot of osteopathic medical education in 1997
Retz, K. C.
Journal of Osteopathic Medicine, 1997/11
Free full text

3004

Anatomy of an OPTI: Part I. Form, function, and relationships
Meyer, C. T., Mann, M. P., Riley, C., Portanova, R.
Journal of Osteopathic Medicine, 1997/10
Free full text


3006

Osteopathic manipulative treatment: Practice use and and opinions of the Texas College of Osteopathic Medicine alumni
Gamber, R. G., Kennedy, D. A., Erickson, R. C., Moss, J. A., McKay Hart, C., Zengerle, C., Stone, R. C., Gish, E. E.
The AAO Journal, 1997/09
Free full text

3007

The Legacy of Robert C. Fulford, DO
Koss, R. W.
The AAO Journal, 1997/09
Free full text

3008

Case history: Low back pain with a radiating 'electric shock'
McCarty, C. L.
The AAO Journal, 1997/09
Free full text

3009

A challenge to the profession: initiate evidence-based osteopathic medicine now
Goldstein, M.
Journal of Osteopathic Medicine, 1997/08
Free full text

3010

Informing public, students will make profession 'visible'
Bahrami, P.
Journal of Osteopathic Medicine, 1997/06
Free full text


3012

Will failure to use OMT be grounds for malpractice?
Allen, T. W.
Journal of Osteopathic Medicine, 1997/05
Free full text

3013

Repositioning maneuver for benign paroxysmal positional vertigo (BPPV)
Brooks, J. G., Abidin, M. R.
Journal of Osteopathic Medicine, 1997/05
Free full text

3014

Establishment of behavioral parameters for the evaluation of osteopathic treatment principles in a rat model of arthritis
Hallas, B., Lehman, S., Bosak, A., Tierney, S., Galler, R., Jacovina, P., Scandalis, T. A., Wells, M.
Journal of Osteopathic Medicine, 1997/04
Free full text


3016

'Visible and recognized': osteopathic invisibility syndrome and the two percent solution
Gevitz, N.
Journal of Osteopathic Medicine, 1997/03
Free full text

3017

Can DOs still 'circle the wagons'? Reflections on the use of osteopathic manipulative treatment
Fry, L. J.
Journal of Osteopathic Medicine, 1997/02
Free full text

3018

Osteopathic manipulative treatment: student attitudes before and after intensive clinical exposure
Magnus, W. W., Gamber, R. G.
Journal of Osteopathic Medicine, 1997/02
Free full text


3020

A challenge to the concept of craniosacral interaction
Norton, J. M.
The AAO Journal, 1996/12
Free full text

3021

AOA continuing medical education
MacPherson, S. B., Rodgers, D. J.
The Journal of the American Osteopathic Association, 1996/11
Free full text

3022

Osteopathic medical education at the bridge to the 21st century
Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

3023

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

3024

Certification of osteopathic physicians
Glatz, L., Dolan, S.
The Journal of the American Osteopathic Association, 1996/11
Free full text

3025

Why is it so difficult?
Patterson, M. M.
The Journal of the American Osteopathic Association, 1996/09
Free full text

3026

Factitious disorders and the 'professional patient'
Lande, R. G.
The Journal of the American Osteopathic Association, 1996/08
Free full text

3027

Osteopathic manipulative treatment applications for the emergency department patient
Paul, F. A., Buser, B. R.
The Journal of the American Osteopathic Association, 1996/07
Free full text

3028

AAO Case Study: Recurrent Otitis Media
Gintis, B. R.
The AAO Journal, 1996/06
Free full text

3029

A functional approach to heel lift therapy
Johnson, K. H.
The AAO Journal, 1996/03
Free full text

3030

Late-life depression in primary care. How well are we doing?
Banazak, D. A.
Journal of General Internal Medicine, 1996/03

3031

When it comes to OMT, do we practice what we preach?
Kasovac, M.
The Journal of the American Osteopathic Association, 1996/02
Free full text

3032

Marketing key to increased women applicants to COMs
Payson, S. M.
The Journal of the American Osteopathic Association, 1996/01
Free full text

3033

Osteopathic medicine: an inherently natural approach to cholesterol reduction
Rogers, F. J.
The Journal of the American Osteopathic Association, 1996/01
Free full text

3034

Synergism strengthens osteopathic medical education programs
Allen, T. W.
Journal of Osteopathic Medicine, 1995/10
Free full text

3035

The Nature of Fascia and the Role of Lower Extremity Fascia in Low Back Pain
Hessler, D. D.
The AAO Journal, 1995/09
Free full text

3036

Proposed matrix could yield bountiful 'harvest'
Stiles, E. G.
The Journal of the American Osteopathic Association, 1995/09
Free full text

3037

Phenobarbital-induced fibromyalgia as the cause of bilateral shoulder pain
Goldman, S. I., Krings, M. S.
The Journal of the American Osteopathic Association, 1995/08
Free full text

3038

Three-Dimensional Counterstrain Lifts (3-DCL) Theoretical Concept and Applications
Carlson, J. A., Carlson, J. M., Earl, D. T.
The AAO Journal, 1995/06
Free full text

3039

Making sense of federal GME reforms: the impact on osteopathic medicine
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/04
Free full text

3040

AAO Case Study: Chronic Upper Extremity Pain
DeFeo, G. A.
The AAO Journal, 1995/03
Free full text

3041

Interexaminer agreement on palpatory diagnosis and patient self-assessment of disability: a pilot study
Beal, M. C., Patriquin, D. A.
The Journal of the American Osteopathic Association, 1995/02
Free full text

3042

Standardization of the hospital record for osteopathic structural examination: recording of musculoskeletal findings and somatic dysfunction diagnosis
Seffinger, M. A., Friedman, H. D., Johnston, W. L.
The Journal of the American Osteopathic Association, 1995/02
Free full text

3043

A Hypothesis for the Facilitated Segment Based Upon Biological Principles Associated with Tumorigenesis
Yonuschot, G., Mokler, J., Winterson, B. J.
The AAO Journal, 1994/12
Free full text

3044

Healthcare reform and practice choices: a survey of osteopathic medical students
Shubrook, J. H., Jr., Solomon, J. A., Ross-Lee
The Journal of the American Osteopathic Association, 1994/11
Free full text

3045

Osteopathic medical education adapts to a changing environment
Ward, W. D.
The Journal of the American Osteopathic Association, 1994/11
Free full text

3046

Membership of AOA Committees on Osteopathic Medical Education 1994-1995
The Journal of the American Osteopathic Association, 1994/11
Free full text

3047

AAO Case Study: Sinusitis
Sept, K.
The AAO Journal, 1994/09
Free full text

3048

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text

3049

A Tensegrity Model for Osteopathy in the Cranial Field
Cummings, C. H.
The AAO Journal, 1994/06
Free full text

3050

Performance-based assessment of moral reasoning and ethical judgment among medical students
Smith, S. R., Balint, J. A., Krause, K. C., Moore-West, M., Viles, P. H.
Academic Medicine, 1994/05
Free full text

3051

DOs encouraged to participate in pharmaceutical, clinical trials
Allen, T. W.
The Journal of the American Osteopathic Association, 1994/05
Free full text

3052

Healthcare policy reform comes under fire
Brooker, A. S.
The Journal of the American Osteopathic Association, 1994/05
Free full text

3053

Opportunities and Issues for Osteopathic Hospitals
The AAO Journal, 1994/03
Free full text


3055

Osteopathic Identity: Finding the Pony
Hruby, R. J.
The AAO Journal, 1993/12
Free full text

3056

Definitions of Osteopathy as a School of Medicine
McCole, G. M.
The AAO Journal, 1993/12
Free full text

3057

Focused goals of osteopathic medical education achieve results
Ward, W. D.
The Journal of the American Osteopathic Association, 1993/11
Free full text

3058

An MD's note to his osteopathic medical students
Friedlander, E. R.
The Journal of the American Osteopathic Association, 1993/10
Free full text

3059

Do medical students' knowledge and attitudes about health and exercise affect their physical fitness?
Liang, M. T., Dombrowski, H. T., Allen, T. W., Chang, C. O., Andriulli, J., Bastianelli, M., Davina, E., Norris, S. D.
The Journal of the American Osteopathic Association, 1993/10
Free full text

3060

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text

3061

Promoting the health and fitness of osteopathic medical students
Licciardone, J. C.
The Journal of the American Osteopathic Association, 1993/10
Free full text

3062

AAO Case History
Somner, L.
The AAO Journal, 1993/09
Free full text

3063

'Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/09
Free full text

3064

'Blueprint' for creating classroom facilities in teaching hospitals
Hayes, O. W.
The Journal of the American Osteopathic Association, 1993/06
Free full text

3065

The Osteopaths Bill
Maxwell, R. J.
British Medical Journal, 1993/06
Free full text

3066

Investigating the role of osteopathic manipulation in the treatment of asthma
Allen, T. W., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 1993/06
Free full text

3067

Research important to education--and society
Retz, K. C.
The Journal of the American Osteopathic Association, 1993/05
Free full text

3068

Support of collaborative practice
Kuehn, A. F.
The Missouri Nurse, 1993/04

3069

Integrating OMT Into The Hospital Setting
Jones, L. B.
The AAO Journal, 1993/03
Free full text

3070

Outcomes assessment: 'buzz words' in medical education whose time has come
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/03
Free full text

3071

Panic Attack – Another View
Wright, H. O. L.
The AAO Journal, 1993/03
Free full text

3072

Efficacy of high-velocity low-amplitude manipulative technique in subjects with low-back pain during menstrual cramping
Boesler, D., Warner, M., Alpers, A., Finnerty, E. P., Kilmore, M. A.
The Journal of the American Osteopathic Association, 1993/02
Free full text

3073

Progress in scientifically proving the benefits of OMT in treating symptoms of dysmenorrhea
Chapman, J. D.
The Journal of the American Osteopathic Association, 1993/02
Free full text


3075

Primary & Secondary Respiration – Part I
Lee, R. P.
The AAO Journal, 1992/12
Free full text

3076

Short lever, specific contact articular chiropractic technique
Bergmann, T. F.
Journal of Manipulative and Physiological Therapeutics, 1992/12

3077

With a look at the past, osteopathic medical education heads into its second century
Ward, D.
The Journal of the American Osteopathic Association, 1992/11
Free full text

3078

Voices From the Future: what students, interns, and residents want from osteopathic graduate medical training
Kushner, D., Cooney, J.
The Journal of the American Osteopathic Association, 1992/10
Free full text

3079

Heed 'Voices From the Future' and reform GME training
Meyer, C. T.
The Journal of the American Osteopathic Association, 1992/10
Free full text

3080

Characterization of the Cranial Rhythmic Impulse in Healthy Human Adults
Norton, J. M., Sibley, G., Broder-Oldach, R.
The AAO Journal, 1992/09
Free full text

3081

Strategy for Addressing Third Party Payors on OMT
O'Connell, J. A.
The AAO Journal, 1992/09
Free full text

3082

Osteopathic medicine: 100 years in the making
Allen, T. W.
The Journal of the American Osteopathic Association, 1992/09
Free full text

3083

Paralymics offer athletes--and DOs--new challenges
Richter, K. J.
The Journal of the American Osteopathic Association, 1992/07
Free full text

3084

Will Your Recipe Even Be In The Cookbook?
Ammann-Hasbrouck, L.
The AAO Journal, 1992/06
Free full text

3085

Rheumatoid Arthritis: The Incurable Disease?
Wright, H. O. L.
The AAO Journal, 1992/06
Free full text

3086

Testing osteopathic medical concepts in a real-life setting
Patterson, M. M.
The Journal of the American Osteopathic Association, 1992/06
Free full text

3087

Revamped osteopathic hospital group flourishing
Burda, D.
Modern Healthcare, 1992/05

3088

'Loopholes' weaken hospital accreditation policy
Horspool, J. C.
The Journal of the American Osteopathic Association, 1992/04
Free full text

3089

The Patient Who Wouldn't Give Up
Wright, H. O. L.
The AAO Journal, 1992/03
Free full text

3090


3091

The physical fitness of first-year osteopathic medical students
Licciardone, J. C., Hagan, R. D.
The Journal of the American Osteopathic Association, 1992/03
Free full text

3092

New HIV series helps to define osteopathic physicians' role in AIDS epidemic
Calabrese, L. H.
The Journal of the American Osteopathic Association, 1992/01
Free full text

3093

Let's Return to the Basics
Heatherington, J. S.
The AAO Journal, 1991/12
Free full text

3094

A Disease Which No Longer Exists
Wright, H. O. L.
The AAO Journal, 1991/12
Free full text

3095

Alternative and complementary medicine for asthma
Lane, D. J., Lane, T. V.
Thorax, 1991/11
Free full text

3096

Superlatives and concerns in osteopathic medical education
Baker, H. H.
The Journal of the American Osteopathic Association, 1991/11
Free full text

3097

Traitements non prouvés en cancérologie
(Unproven treatments in cancerology)
Schraub, S., Helary, J. P.
Bulletin du cancer, 1991/10

3098

Examining the complexities of HIV testing for healthcare workers
Allen, T. W.
The Journal of the American Osteopathic Association, 1991/10
Free full text

3099

The osteopathic cranial concept: fact or fiction?
Ferré, J. C., Barbin, J. Y.
Surgical and Radiologic Anatomy, 1991/09

3100

Osteopathic vs. chiropractic education: a student perspective
McNamee, K. P., Magarian, K., Phillips, R. B., Greenman, P. E.
Journal of Manipulative and Physiological Therapeutics, 1991/09

3101

The Value of Some Clinical Tests of the Sacroiliac Joint
van Deursen, L. L. J. M., Patijn, J., Ockhuysen, A. L., Vortman, B. J.
The AAO Journal, 1991/09
Free full text

3102

Osteopathic interns' attitudes toward their education and training
Shlapentokh, V., O'Donnell, N., Grey, M. B.
The Journal of the American Osteopathic Association, 1991/08
Free full text

3103

Osteopathic medical educators should heed lesson from interns
Johnston, W. L.
The Journal of the American Osteopathic Association, 1991/08
Free full text

3104

Osteopathic Medicine: A Century Old Prophesy of Modern Health, Nutrition and Exercise Principles
Ramirez, M. A., Spillman, D. M., Lipnickey, S. C.
The AAO Journal, 1991/06
Free full text

3105

Osteopathic research: where have we been and where are we going?
Allen, T. W.
The Journal of the American Osteopathic Association, 1991/02
Free full text

3106

The sociopolitical development of British chiropractic
Baer, H. A.
Journal of Manipulative and Physiological Therapeutics, 1991/01



3109

Measuring our success in meeting 1990 hypertension health objectives
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/12
Free full text

3110

Practicing what we teach: integrating osteopathic principles into practice
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/10
Free full text

3111

Just what is osteopathic medicine's role in society?
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/09
Free full text

3112

Calling for theories that test the underlying osteopathic concepts
Patterson, M. M.
The Journal of the American Osteopathic Association, 1990/09
Free full text

3113

Time to reemphasize OMT as stress reliever
Northup, G. W.
The Journal of the American Osteopathic Association, 1990/08
Free full text


3115

Quality assurance monitoring of osteopathic manipulative treatment
Koss, R. W.
The Journal of the American Osteopathic Association, 1990/05
Free full text

3116

The Century Club: a model for staff-supported medical education
Meyer, C. T.
The Journal of the American Osteopathic Association, 1990/05
Free full text

3117

Another hurrah for a 'smoke-free' environment
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/04
Free full text

3118

Correcting the misperceptions surrounding osteopathic medicine
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/02
Free full text

3119

War, politics, and osteopathic medicine
Goldstein, M.
The Journal of the American Osteopathic Association, 1990/02
Free full text


3121

An integrated osteopathic treatment approach in acute otitis media
Pintal, W. J., Kurtz, M. E.
The Journal of the American Osteopathic Association, 1989/09
Free full text


3123

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12

3124


 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends